data_7T9O # _entry.id 7T9O # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.357 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7T9O pdb_00007t9o 10.2210/pdb7t9o/pdb WWPDB D_1000261881 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7T9O _pdbx_database_status.recvd_initial_deposition_date 2021-12-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Khan, J.A.' 1 ? 'Lewis, H.' 2 ? 'Kish, K.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 65 _citation.language ? _citation.page_first 4949 _citation.page_last 4971 _citation.title ;Design, Synthesis, and Preclinical Profiling of GSK3739936 (BMS-986180), an Allosteric Inhibitor of HIV-1 Integrase with Broad-Spectrum Activity toward 124/125 Polymorphs. ; _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.1c02169 _citation.pdbx_database_id_PubMed 35235334 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Naidu, B.N.' 1 0000-0002-2624-7023 primary 'Patel, M.' 2 ? primary 'McAuliffe, B.' 3 ? primary 'Ding, B.' 4 ? primary 'Cianci, C.' 5 ? primary 'Simmermacher, J.' 6 ? primary 'Jenkins, S.' 7 ? primary 'Parker, D.D.' 8 ? primary 'Sivaprakasam, P.' 9 ? primary 'Khan, J.A.' 10 ? primary 'Kish, K.' 11 ? primary 'Lewis, H.' 12 ? primary 'Hanumegowda, U.' 13 ? primary 'Krystal, M.' 14 ? primary 'Meanwell, N.A.' 15 0000-0002-8857-1515 primary 'Kadow, J.F.' 16 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7T9O _cell.details ? _cell.formula_units_Z ? _cell.length_a 70.919 _cell.length_a_esd ? _cell.length_b 70.919 _cell.length_b_esd ? _cell.length_c 66.920 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7T9O _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Integrase 19685.273 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 3 ? ? ? ? 3 non-polymer syn '(2S)-tert-butoxy[4-(4,4-dimethylpiperidin-1-yl)-5-{4-[2-(4-fluorophenyl)ethoxy]phenyl}-2,6-dimethylpyridin-3-yl]acetic acid' 562.715 1 ? ? ? ? 4 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 5 water nat water 18.015 62 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMHGQVDSSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWP VKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKG GIGGYSAGERIVDIIATDIQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMHGQVDSSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWP VKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKG GIGGYSAGERIVDIIATDIQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 HIS n 1 23 GLY n 1 24 GLN n 1 25 VAL n 1 26 ASP n 1 27 SER n 1 28 SER n 1 29 PRO n 1 30 GLY n 1 31 ILE n 1 32 TRP n 1 33 GLN n 1 34 LEU n 1 35 ASP n 1 36 CYS n 1 37 THR n 1 38 HIS n 1 39 LEU n 1 40 GLU n 1 41 GLY n 1 42 LYS n 1 43 VAL n 1 44 ILE n 1 45 LEU n 1 46 VAL n 1 47 ALA n 1 48 VAL n 1 49 HIS n 1 50 VAL n 1 51 ALA n 1 52 SER n 1 53 GLY n 1 54 TYR n 1 55 ILE n 1 56 GLU n 1 57 ALA n 1 58 GLU n 1 59 VAL n 1 60 ILE n 1 61 PRO n 1 62 ALA n 1 63 GLU n 1 64 THR n 1 65 GLY n 1 66 GLN n 1 67 GLU n 1 68 THR n 1 69 ALA n 1 70 TYR n 1 71 PHE n 1 72 LEU n 1 73 LEU n 1 74 LYS n 1 75 LEU n 1 76 ALA n 1 77 GLY n 1 78 ARG n 1 79 TRP n 1 80 PRO n 1 81 VAL n 1 82 LYS n 1 83 THR n 1 84 VAL n 1 85 HIS n 1 86 THR n 1 87 ASP n 1 88 ASN n 1 89 GLY n 1 90 SER n 1 91 ASN n 1 92 PHE n 1 93 THR n 1 94 SER n 1 95 THR n 1 96 THR n 1 97 VAL n 1 98 LYS n 1 99 ALA n 1 100 ALA n 1 101 CYS n 1 102 TRP n 1 103 TRP n 1 104 ALA n 1 105 GLY n 1 106 ILE n 1 107 LYS n 1 108 GLN n 1 109 GLU n 1 110 ASP n 1 111 GLY n 1 112 ILE n 1 113 PRO n 1 114 TYR n 1 115 ASN n 1 116 PRO n 1 117 GLN n 1 118 SER n 1 119 GLN n 1 120 GLY n 1 121 VAL n 1 122 ILE n 1 123 GLU n 1 124 SER n 1 125 MET n 1 126 ASN n 1 127 LYS n 1 128 GLU n 1 129 LEU n 1 130 LYS n 1 131 LYS n 1 132 ILE n 1 133 ILE n 1 134 GLY n 1 135 GLN n 1 136 VAL n 1 137 ARG n 1 138 ASP n 1 139 GLN n 1 140 ALA n 1 141 GLU n 1 142 HIS n 1 143 LEU n 1 144 LYS n 1 145 THR n 1 146 ALA n 1 147 VAL n 1 148 GLN n 1 149 MET n 1 150 ALA n 1 151 VAL n 1 152 PHE n 1 153 ILE n 1 154 HIS n 1 155 ASN n 1 156 HIS n 1 157 LYS n 1 158 ARG n 1 159 LYS n 1 160 GLY n 1 161 GLY n 1 162 ILE n 1 163 GLY n 1 164 GLY n 1 165 TYR n 1 166 SER n 1 167 ALA n 1 168 GLY n 1 169 GLU n 1 170 ARG n 1 171 ILE n 1 172 VAL n 1 173 ASP n 1 174 ILE n 1 175 ILE n 1 176 ALA n 1 177 THR n 1 178 ASP n 1 179 ILE n 1 180 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 180 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human immunodeficiency virus 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11676 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q76353_9HIV1 _struct_ref.pdbx_db_accession Q76353 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTV KAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIAT DIQ ; _struct_ref.pdbx_align_begin 47 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7T9O _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 18 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 180 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q76353 _struct_ref_seq.db_align_beg 47 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 209 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 47 _struct_ref_seq.pdbx_auth_seq_align_end 209 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7T9O MET A 1 ? UNP Q76353 ? ? 'expression tag' 30 1 1 7T9O GLY A 2 ? UNP Q76353 ? ? 'expression tag' 31 2 1 7T9O SER A 3 ? UNP Q76353 ? ? 'expression tag' 32 3 1 7T9O SER A 4 ? UNP Q76353 ? ? 'expression tag' 33 4 1 7T9O HIS A 5 ? UNP Q76353 ? ? 'expression tag' 34 5 1 7T9O HIS A 6 ? UNP Q76353 ? ? 'expression tag' 35 6 1 7T9O HIS A 7 ? UNP Q76353 ? ? 'expression tag' 36 7 1 7T9O HIS A 8 ? UNP Q76353 ? ? 'expression tag' 37 8 1 7T9O HIS A 9 ? UNP Q76353 ? ? 'expression tag' 38 9 1 7T9O HIS A 10 ? UNP Q76353 ? ? 'expression tag' 39 10 1 7T9O SER A 11 ? UNP Q76353 ? ? 'expression tag' 40 11 1 7T9O SER A 12 ? UNP Q76353 ? ? 'expression tag' 41 12 1 7T9O GLY A 13 ? UNP Q76353 ? ? 'expression tag' 42 13 1 7T9O LEU A 14 ? UNP Q76353 ? ? 'expression tag' 43 14 1 7T9O VAL A 15 ? UNP Q76353 ? ? 'expression tag' 44 15 1 7T9O PRO A 16 ? UNP Q76353 ? ? 'expression tag' 45 16 1 7T9O ARG A 17 ? UNP Q76353 ? ? 'expression tag' 46 17 1 7T9O SER A 19 ? UNP Q76353 GLU 48 conflict 48 18 1 7T9O HIS A 20 ? UNP Q76353 ALA 49 conflict 49 19 1 7T9O SER A 27 ? UNP Q76353 CYS 56 conflict 56 20 1 7T9O ASP A 110 ? UNP Q76353 PHE 139 conflict 139 21 1 7T9O HIS A 156 ? UNP Q76353 PHE 185 conflict 185 22 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GEI non-polymer . '(2S)-tert-butoxy[4-(4,4-dimethylpiperidin-1-yl)-5-{4-[2-(4-fluorophenyl)ethoxy]phenyl}-2,6-dimethylpyridin-3-yl]acetic acid' ? 'C34 H43 F N2 O4' 562.715 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7T9O _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.47 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.16 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '4.6%(w/v) PEG 3350, 261 mM ammonium acetate, 0.81% glycerol(v/v), 91 mM magnesium chloride and 100 mM MES pH 6.0' _exptl_crystal_grow.pdbx_pH_range 6.0? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX-300' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-05-14 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'CLSI BEAMLINE 08ID-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 08ID-1 _diffrn_source.pdbx_synchrotron_site CLSI # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7T9O _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.95 _reflns.d_resolution_low 50.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14550 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.5 _reflns.pdbx_Rmerge_I_obs 0.060 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 34.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.95 _reflns_shell.d_res_low 2.02 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1435 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.587 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -0.7999 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -0.7999 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 1.5998 _refine.B_iso_max 107.030 _refine.B_iso_mean 41.8900 _refine.B_iso_min 26.200 _refine.correlation_coeff_Fo_to_Fc 0.9520 _refine.correlation_coeff_Fo_to_Fc_free 0.9500 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7T9O _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.9500 _refine.ls_d_res_low 45.2500 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14527 _refine.ls_number_reflns_R_free 732 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8000 _refine.ls_percent_reflns_R_free 5.0400 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1921 _refine.ls_R_factor_R_free 0.2189 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1908 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6NCJ _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.1220 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.1230 _refine.pdbx_overall_SU_R_Blow_DPI 0.1330 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.1310 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 7T9O _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.240 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.9500 _refine_hist.d_res_low 45.2500 _refine_hist.number_atoms_solvent 62 _refine_hist.number_atoms_total 1177 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 138 _refine_hist.pdbx_B_iso_mean_ligand 51.53 _refine_hist.pdbx_B_iso_mean_solvent 53.12 _refine_hist.pdbx_number_atoms_protein 1045 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 70 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? ? ? 394 ? t_dihedral_angle_d 2.000 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_trig_c_planes ? ? 'X-RAY DIFFRACTION' ? ? ? 224 ? t_gen_planes 5.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1147 ? t_it 10.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 154 ? t_chiral_improper_torsion 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 1059 ? t_ideal_dist_contact 4.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? 0.008 ? 1198 ? t_bond_d 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 0.890 ? 1676 ? t_angle_deg 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 3.290 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 13.140 ? ? ? t_other_torsion ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.9500 _refine_ls_shell.d_res_low 1.9700 _refine_ls_shell.number_reflns_all 404 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 23 _refine_ls_shell.number_reflns_R_work 381 _refine_ls_shell.percent_reflns_obs 94.6100 _refine_ls_shell.percent_reflns_R_free 5.6900 _refine_ls_shell.R_factor_all 0.1891 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2387 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.1864 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 37 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7T9O _struct.title 'HIV Integrase in complex with Compound-25' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7T9O _struct_keywords.text 'DNA Integration, AIDS, RNASEH, LEDGF, ENDONUCLEASE, HIV-1 integrase, DNA BINDING PROTEIN, Viral Protein' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN, Viral Protein' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 4 ? G N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 64 ? TRP A 79 ? THR A 93 TRP A 108 1 ? 16 HELX_P HELX_P2 AA2 ASN A 88 ? SER A 94 ? ASN A 117 SER A 123 1 ? 7 HELX_P HELX_P3 AA3 SER A 94 ? GLY A 105 ? SER A 123 GLY A 134 1 ? 12 HELX_P HELX_P4 AA4 GLU A 123 ? ARG A 137 ? GLU A 152 ARG A 166 1 ? 15 HELX_P HELX_P5 AA5 ASP A 138 ? ALA A 140 ? ASP A 167 ALA A 169 5 ? 3 HELX_P HELX_P6 AA6 HIS A 142 ? LYS A 157 ? HIS A 171 LYS A 186 1 ? 16 HELX_P HELX_P7 AA7 SER A 166 ? ILE A 179 ? SER A 195 ILE A 208 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 55 ? ILE A 60 ? ILE A 84 ILE A 89 AA1 2 LYS A 42 ? HIS A 49 ? LYS A 71 HIS A 78 AA1 3 ILE A 31 ? LEU A 39 ? ILE A 60 LEU A 68 AA1 4 THR A 83 ? HIS A 85 ? THR A 112 HIS A 114 AA1 5 LYS A 107 ? GLU A 109 ? LYS A 136 GLU A 138 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 60 ? O ILE A 89 N VAL A 43 ? N VAL A 72 AA1 2 3 O VAL A 46 ? O VAL A 75 N ASP A 35 ? N ASP A 64 AA1 3 4 N LEU A 34 ? N LEU A 63 O HIS A 85 ? O HIS A 114 AA1 4 5 N VAL A 84 ? N VAL A 113 O GLU A 109 ? O GLU A 138 # _atom_sites.entry_id 7T9O _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014101 _atom_sites.fract_transf_matrix[1][2] 0.008141 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016282 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014943 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C F H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 30 ? ? ? A . n A 1 2 GLY 2 31 ? ? ? A . n A 1 3 SER 3 32 ? ? ? A . n A 1 4 SER 4 33 ? ? ? A . n A 1 5 HIS 5 34 ? ? ? A . n A 1 6 HIS 6 35 ? ? ? A . n A 1 7 HIS 7 36 ? ? ? A . n A 1 8 HIS 8 37 ? ? ? A . n A 1 9 HIS 9 38 ? ? ? A . n A 1 10 HIS 10 39 ? ? ? A . n A 1 11 SER 11 40 ? ? ? A . n A 1 12 SER 12 41 ? ? ? A . n A 1 13 GLY 13 42 ? ? ? A . n A 1 14 LEU 14 43 ? ? ? A . n A 1 15 VAL 15 44 ? ? ? A . n A 1 16 PRO 16 45 ? ? ? A . n A 1 17 ARG 17 46 ? ? ? A . n A 1 18 GLY 18 47 ? ? ? A . n A 1 19 SER 19 48 ? ? ? A . n A 1 20 HIS 20 49 ? ? ? A . n A 1 21 MET 21 50 ? ? ? A . n A 1 22 HIS 22 51 ? ? ? A . n A 1 23 GLY 23 52 ? ? ? A . n A 1 24 GLN 24 53 ? ? ? A . n A 1 25 VAL 25 54 ? ? ? A . n A 1 26 ASP 26 55 ? ? ? A . n A 1 27 SER 27 56 ? ? ? A . n A 1 28 SER 28 57 57 SER SER A . n A 1 29 PRO 29 58 58 PRO PRO A . n A 1 30 GLY 30 59 59 GLY GLY A . n A 1 31 ILE 31 60 60 ILE ILE A . n A 1 32 TRP 32 61 61 TRP TRP A . n A 1 33 GLN 33 62 62 GLN GLN A . n A 1 34 LEU 34 63 63 LEU LEU A . n A 1 35 ASP 35 64 64 ASP ASP A . n A 1 36 CYS 36 65 65 CYS CYS A . n A 1 37 THR 37 66 66 THR THR A . n A 1 38 HIS 38 67 67 HIS HIS A . n A 1 39 LEU 39 68 68 LEU LEU A . n A 1 40 GLU 40 69 69 GLU GLU A . n A 1 41 GLY 41 70 70 GLY GLY A . n A 1 42 LYS 42 71 71 LYS LYS A . n A 1 43 VAL 43 72 72 VAL VAL A . n A 1 44 ILE 44 73 73 ILE ILE A . n A 1 45 LEU 45 74 74 LEU LEU A . n A 1 46 VAL 46 75 75 VAL VAL A . n A 1 47 ALA 47 76 76 ALA ALA A . n A 1 48 VAL 48 77 77 VAL VAL A . n A 1 49 HIS 49 78 78 HIS HIS A . n A 1 50 VAL 50 79 79 VAL VAL A . n A 1 51 ALA 51 80 80 ALA ALA A . n A 1 52 SER 52 81 81 SER SER A . n A 1 53 GLY 53 82 82 GLY GLY A . n A 1 54 TYR 54 83 83 TYR TYR A . n A 1 55 ILE 55 84 84 ILE ILE A . n A 1 56 GLU 56 85 85 GLU GLU A . n A 1 57 ALA 57 86 86 ALA ALA A . n A 1 58 GLU 58 87 87 GLU GLU A . n A 1 59 VAL 59 88 88 VAL VAL A . n A 1 60 ILE 60 89 89 ILE ILE A . n A 1 61 PRO 61 90 90 PRO PRO A . n A 1 62 ALA 62 91 91 ALA ALA A . n A 1 63 GLU 63 92 92 GLU GLU A . n A 1 64 THR 64 93 93 THR THR A . n A 1 65 GLY 65 94 94 GLY GLY A . n A 1 66 GLN 66 95 95 GLN GLN A . n A 1 67 GLU 67 96 96 GLU GLU A . n A 1 68 THR 68 97 97 THR THR A . n A 1 69 ALA 69 98 98 ALA ALA A . n A 1 70 TYR 70 99 99 TYR TYR A . n A 1 71 PHE 71 100 100 PHE PHE A . n A 1 72 LEU 72 101 101 LEU LEU A . n A 1 73 LEU 73 102 102 LEU LEU A . n A 1 74 LYS 74 103 103 LYS LYS A . n A 1 75 LEU 75 104 104 LEU LEU A . n A 1 76 ALA 76 105 105 ALA ALA A . n A 1 77 GLY 77 106 106 GLY GLY A . n A 1 78 ARG 78 107 107 ARG ARG A . n A 1 79 TRP 79 108 108 TRP TRP A . n A 1 80 PRO 80 109 109 PRO PRO A . n A 1 81 VAL 81 110 110 VAL VAL A . n A 1 82 LYS 82 111 111 LYS LYS A . n A 1 83 THR 83 112 112 THR THR A . n A 1 84 VAL 84 113 113 VAL VAL A . n A 1 85 HIS 85 114 114 HIS HIS A . n A 1 86 THR 86 115 115 THR THR A . n A 1 87 ASP 87 116 116 ASP ASP A . n A 1 88 ASN 88 117 117 ASN ASN A . n A 1 89 GLY 89 118 118 GLY GLY A . n A 1 90 SER 90 119 119 SER SER A . n A 1 91 ASN 91 120 120 ASN ASN A . n A 1 92 PHE 92 121 121 PHE PHE A . n A 1 93 THR 93 122 122 THR THR A . n A 1 94 SER 94 123 123 SER SER A . n A 1 95 THR 95 124 124 THR THR A . n A 1 96 THR 96 125 125 THR THR A . n A 1 97 VAL 97 126 126 VAL VAL A . n A 1 98 LYS 98 127 127 LYS LYS A . n A 1 99 ALA 99 128 128 ALA ALA A . n A 1 100 ALA 100 129 129 ALA ALA A . n A 1 101 CYS 101 130 130 CYS CYS A . n A 1 102 TRP 102 131 131 TRP TRP A . n A 1 103 TRP 103 132 132 TRP TRP A . n A 1 104 ALA 104 133 133 ALA ALA A . n A 1 105 GLY 105 134 134 GLY GLY A . n A 1 106 ILE 106 135 135 ILE ILE A . n A 1 107 LYS 107 136 136 LYS LYS A . n A 1 108 GLN 108 137 137 GLN GLN A . n A 1 109 GLU 109 138 138 GLU GLU A . n A 1 110 ASP 110 139 139 ASP ASP A . n A 1 111 GLY 111 140 140 GLY GLY A . n A 1 112 ILE 112 141 ? ? ? A . n A 1 113 PRO 113 142 ? ? ? A . n A 1 114 TYR 114 143 ? ? ? A . n A 1 115 ASN 115 144 ? ? ? A . n A 1 116 PRO 116 145 ? ? ? A . n A 1 117 GLN 117 146 ? ? ? A . n A 1 118 SER 118 147 ? ? ? A . n A 1 119 GLN 119 148 ? ? ? A . n A 1 120 GLY 120 149 ? ? ? A . n A 1 121 VAL 121 150 ? ? ? A . n A 1 122 ILE 122 151 151 ILE ILE A . n A 1 123 GLU 123 152 152 GLU GLU A . n A 1 124 SER 124 153 153 SER SER A . n A 1 125 MET 125 154 154 MET MET A . n A 1 126 ASN 126 155 155 ASN ASN A . n A 1 127 LYS 127 156 156 LYS LYS A . n A 1 128 GLU 128 157 157 GLU GLU A . n A 1 129 LEU 129 158 158 LEU LEU A . n A 1 130 LYS 130 159 159 LYS LYS A . n A 1 131 LYS 131 160 160 LYS LYS A . n A 1 132 ILE 132 161 161 ILE ILE A . n A 1 133 ILE 133 162 162 ILE ILE A . n A 1 134 GLY 134 163 163 GLY GLY A . n A 1 135 GLN 135 164 164 GLN GLN A . n A 1 136 VAL 136 165 165 VAL VAL A . n A 1 137 ARG 137 166 166 ARG ARG A . n A 1 138 ASP 138 167 167 ASP ASP A . n A 1 139 GLN 139 168 168 GLN GLN A . n A 1 140 ALA 140 169 169 ALA ALA A . n A 1 141 GLU 141 170 170 GLU GLU A . n A 1 142 HIS 142 171 171 HIS HIS A . n A 1 143 LEU 143 172 172 LEU LEU A . n A 1 144 LYS 144 173 173 LYS LYS A . n A 1 145 THR 145 174 174 THR THR A . n A 1 146 ALA 146 175 175 ALA ALA A . n A 1 147 VAL 147 176 176 VAL VAL A . n A 1 148 GLN 148 177 177 GLN GLN A . n A 1 149 MET 149 178 178 MET MET A . n A 1 150 ALA 150 179 179 ALA ALA A . n A 1 151 VAL 151 180 180 VAL VAL A . n A 1 152 PHE 152 181 181 PHE PHE A . n A 1 153 ILE 153 182 182 ILE ILE A . n A 1 154 HIS 154 183 183 HIS HIS A . n A 1 155 ASN 155 184 184 ASN ASN A . n A 1 156 HIS 156 185 185 HIS HIS A . n A 1 157 LYS 157 186 186 LYS LYS A . n A 1 158 ARG 158 187 187 ARG ARG A . n A 1 159 LYS 159 188 188 LYS LYS A . n A 1 160 GLY 160 189 ? ? ? A . n A 1 161 GLY 161 190 ? ? ? A . n A 1 162 ILE 162 191 ? ? ? A . n A 1 163 GLY 163 192 ? ? ? A . n A 1 164 GLY 164 193 193 GLY GLY A . n A 1 165 TYR 165 194 194 TYR TYR A . n A 1 166 SER 166 195 195 SER SER A . n A 1 167 ALA 167 196 196 ALA ALA A . n A 1 168 GLY 168 197 197 GLY GLY A . n A 1 169 GLU 169 198 198 GLU GLU A . n A 1 170 ARG 170 199 199 ARG ARG A . n A 1 171 ILE 171 200 200 ILE ILE A . n A 1 172 VAL 172 201 201 VAL VAL A . n A 1 173 ASP 173 202 202 ASP ASP A . n A 1 174 ILE 174 203 203 ILE ILE A . n A 1 175 ILE 175 204 204 ILE ILE A . n A 1 176 ALA 176 205 205 ALA ALA A . n A 1 177 THR 177 206 206 THR THR A . n A 1 178 ASP 178 207 207 ASP ASP A . n A 1 179 ILE 179 208 208 ILE ILE A . n A 1 180 GLN 180 209 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email javed.khan@bms.com _pdbx_contact_author.name_first javed _pdbx_contact_author.name_last khan _pdbx_contact_author.name_mi a _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7486-857X # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 301 209 SO4 SO4 A . C 2 SO4 1 302 210 SO4 SO4 A . D 2 SO4 1 303 211 SO4 SO4 A . E 3 GEI 1 304 301 GEI LG1 A . F 4 GOL 1 305 401 GOL GOL A . G 5 HOH 1 401 63 HOH HOH A . G 5 HOH 2 402 23 HOH HOH A . G 5 HOH 3 403 8 HOH HOH A . G 5 HOH 4 404 1 HOH HOH A . G 5 HOH 5 405 19 HOH HOH A . G 5 HOH 6 406 48 HOH HOH A . G 5 HOH 7 407 43 HOH HOH A . G 5 HOH 8 408 6 HOH HOH A . G 5 HOH 9 409 9 HOH HOH A . G 5 HOH 10 410 12 HOH HOH A . G 5 HOH 11 411 54 HOH HOH A . G 5 HOH 12 412 51 HOH HOH A . G 5 HOH 13 413 46 HOH HOH A . G 5 HOH 14 414 16 HOH HOH A . G 5 HOH 15 415 36 HOH HOH A . G 5 HOH 16 416 22 HOH HOH A . G 5 HOH 17 417 52 HOH HOH A . G 5 HOH 18 418 4 HOH HOH A . G 5 HOH 19 419 24 HOH HOH A . G 5 HOH 20 420 27 HOH HOH A . G 5 HOH 21 421 14 HOH HOH A . G 5 HOH 22 422 15 HOH HOH A . G 5 HOH 23 423 5 HOH HOH A . G 5 HOH 24 424 50 HOH HOH A . G 5 HOH 25 425 10 HOH HOH A . G 5 HOH 26 426 53 HOH HOH A . G 5 HOH 27 427 29 HOH HOH A . G 5 HOH 28 428 3 HOH HOH A . G 5 HOH 29 429 2 HOH HOH A . G 5 HOH 30 430 21 HOH HOH A . G 5 HOH 31 431 38 HOH HOH A . G 5 HOH 32 432 41 HOH HOH A . G 5 HOH 33 433 13 HOH HOH A . G 5 HOH 34 434 26 HOH HOH A . G 5 HOH 35 435 44 HOH HOH A . G 5 HOH 36 436 30 HOH HOH A . G 5 HOH 37 437 35 HOH HOH A . G 5 HOH 38 438 45 HOH HOH A . G 5 HOH 39 439 31 HOH HOH A . G 5 HOH 40 440 47 HOH HOH A . G 5 HOH 41 441 28 HOH HOH A . G 5 HOH 42 442 20 HOH HOH A . G 5 HOH 43 443 7 HOH HOH A . G 5 HOH 44 444 40 HOH HOH A . G 5 HOH 45 445 37 HOH HOH A . G 5 HOH 46 446 25 HOH HOH A . G 5 HOH 47 447 32 HOH HOH A . G 5 HOH 48 448 60 HOH HOH A . G 5 HOH 49 449 39 HOH HOH A . G 5 HOH 50 450 42 HOH HOH A . G 5 HOH 51 451 58 HOH HOH A . G 5 HOH 52 452 61 HOH HOH A . G 5 HOH 53 453 57 HOH HOH A . G 5 HOH 54 454 33 HOH HOH A . G 5 HOH 55 455 49 HOH HOH A . G 5 HOH 56 456 55 HOH HOH A . G 5 HOH 57 457 17 HOH HOH A . G 5 HOH 58 458 59 HOH HOH A . G 5 HOH 59 459 64 HOH HOH A . G 5 HOH 60 460 56 HOH HOH A . G 5 HOH 61 461 34 HOH HOH A . G 5 HOH 62 462 18 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4850 ? 1 MORE -91 ? 1 'SSA (A^2)' 11680 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 y,x,-z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 431 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id G _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2022-04-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 12.2345 _pdbx_refine_tls.origin_y 33.9313 _pdbx_refine_tls.origin_z -6.2698 _pdbx_refine_tls.T[1][1] -0.0485 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0072 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0132 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] -0.0323 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0077 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] -0.0729 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 2.3019 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.7905 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.0906 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 1.0775 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.1867 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 1.5547 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.0170 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.2254 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.0750 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0409 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0616 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.0301 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.1279 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.0755 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.0445 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 57 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 208 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details '{ A|* }' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? '2.11.7 (17-DEC-2019)' 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 7T9O _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 139 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -83.32 _pdbx_validate_torsion.psi -145.81 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 111 ? CG ? A LYS 82 CG 2 1 Y 1 A LYS 111 ? CD ? A LYS 82 CD 3 1 Y 1 A LYS 111 ? CE ? A LYS 82 CE 4 1 Y 1 A LYS 111 ? NZ ? A LYS 82 NZ 5 1 Y 1 A LYS 136 ? CD ? A LYS 107 CD 6 1 Y 1 A LYS 136 ? CE ? A LYS 107 CE 7 1 Y 1 A LYS 136 ? NZ ? A LYS 107 NZ 8 1 Y 1 A GLU 152 ? CG ? A GLU 123 CG 9 1 Y 1 A GLU 152 ? CD ? A GLU 123 CD 10 1 Y 1 A GLU 152 ? OE1 ? A GLU 123 OE1 11 1 Y 1 A GLU 152 ? OE2 ? A GLU 123 OE2 12 1 Y 1 A SER 153 ? OG ? A SER 124 OG 13 1 Y 1 A LYS 156 ? CG ? A LYS 127 CG 14 1 Y 1 A LYS 156 ? CD ? A LYS 127 CD 15 1 Y 1 A LYS 156 ? CE ? A LYS 127 CE 16 1 Y 1 A LYS 156 ? NZ ? A LYS 127 NZ 17 1 Y 1 A LYS 160 ? CD ? A LYS 131 CD 18 1 Y 1 A LYS 160 ? CE ? A LYS 131 CE 19 1 Y 1 A LYS 160 ? NZ ? A LYS 131 NZ 20 1 Y 1 A LYS 186 ? CD ? A LYS 157 CD 21 1 Y 1 A LYS 186 ? CE ? A LYS 157 CE 22 1 Y 1 A LYS 186 ? NZ ? A LYS 157 NZ 23 1 Y 1 A LYS 188 ? CG ? A LYS 159 CG 24 1 Y 1 A LYS 188 ? CD ? A LYS 159 CD 25 1 Y 1 A LYS 188 ? CE ? A LYS 159 CE 26 1 Y 1 A LYS 188 ? NZ ? A LYS 159 NZ 27 1 Y 1 A ASP 202 ? OD1 ? A ASP 173 OD1 28 1 Y 1 A ASP 202 ? OD2 ? A ASP 173 OD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 30 ? A MET 1 2 1 Y 1 A GLY 31 ? A GLY 2 3 1 Y 1 A SER 32 ? A SER 3 4 1 Y 1 A SER 33 ? A SER 4 5 1 Y 1 A HIS 34 ? A HIS 5 6 1 Y 1 A HIS 35 ? A HIS 6 7 1 Y 1 A HIS 36 ? A HIS 7 8 1 Y 1 A HIS 37 ? A HIS 8 9 1 Y 1 A HIS 38 ? A HIS 9 10 1 Y 1 A HIS 39 ? A HIS 10 11 1 Y 1 A SER 40 ? A SER 11 12 1 Y 1 A SER 41 ? A SER 12 13 1 Y 1 A GLY 42 ? A GLY 13 14 1 Y 1 A LEU 43 ? A LEU 14 15 1 Y 1 A VAL 44 ? A VAL 15 16 1 Y 1 A PRO 45 ? A PRO 16 17 1 Y 1 A ARG 46 ? A ARG 17 18 1 Y 1 A GLY 47 ? A GLY 18 19 1 Y 1 A SER 48 ? A SER 19 20 1 Y 1 A HIS 49 ? A HIS 20 21 1 Y 1 A MET 50 ? A MET 21 22 1 Y 1 A HIS 51 ? A HIS 22 23 1 Y 1 A GLY 52 ? A GLY 23 24 1 Y 1 A GLN 53 ? A GLN 24 25 1 Y 1 A VAL 54 ? A VAL 25 26 1 Y 1 A ASP 55 ? A ASP 26 27 1 Y 1 A SER 56 ? A SER 27 28 1 Y 1 A ILE 141 ? A ILE 112 29 1 Y 1 A PRO 142 ? A PRO 113 30 1 Y 1 A TYR 143 ? A TYR 114 31 1 Y 1 A ASN 144 ? A ASN 115 32 1 Y 1 A PRO 145 ? A PRO 116 33 1 Y 1 A GLN 146 ? A GLN 117 34 1 Y 1 A SER 147 ? A SER 118 35 1 Y 1 A GLN 148 ? A GLN 119 36 1 Y 1 A GLY 149 ? A GLY 120 37 1 Y 1 A VAL 150 ? A VAL 121 38 1 Y 1 A GLY 189 ? A GLY 160 39 1 Y 1 A GLY 190 ? A GLY 161 40 1 Y 1 A ILE 191 ? A ILE 162 41 1 Y 1 A GLY 192 ? A GLY 163 42 1 Y 1 A GLN 209 ? A GLN 180 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id GEI _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id GEI _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 '(2S)-tert-butoxy[4-(4,4-dimethylpiperidin-1-yl)-5-{4-[2-(4-fluorophenyl)ethoxy]phenyl}-2,6-dimethylpyridin-3-yl]acetic acid' GEI 4 GLYCEROL GOL 5 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #