data_7TA8 # _entry.id 7TA8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7TA8 pdb_00007ta8 10.2210/pdb7ta8/pdb WWPDB D_1000261025 ? ? BMRB 30977 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'NMR structure of crosslinked cyclophilin A' _pdbx_database_related.db_id 30977 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7TA8 _pdbx_database_status.recvd_initial_deposition_date 2021-12-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lu, M.' 1 0000-0002-4156-4975 'Toptygin, D.' 2 ? 'Xiang, Y.' 3 ? 'Shi, Y.' 4 ? 'Schwieters, C.D.' 5 0000-0002-4216-4658 'Lipinski, E.C.' 6 ? 'Ahn, J.' 7 ? 'Byeon, I.-J.L.' 8 ? 'Gronenborn, A.M.' 9 0000-0001-9072-3525 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 144 _citation.language ? _citation.page_first 10809 _citation.page_last 10816 _citation.title 'The Magic of Linking Rings: Discovery of a Unique Photoinduced Fluorescent Protein Crosslink.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.2c02054 _citation.pdbx_database_id_PubMed 35574633 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lu, M.' 1 0000-0002-4156-4975 primary 'Toptygin, D.' 2 0000-0001-5800-861X primary 'Xiang, Y.' 3 ? primary 'Shi, Y.' 4 ? primary 'Schwieters, C.D.' 5 ? primary 'Lipinski, E.C.' 6 ? primary 'Ahn, J.' 7 ? primary 'Byeon, I.L.' 8 ? primary 'Gronenborn, A.M.' 9 0000-0001-9072-3525 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Peptidyl-prolyl cis-trans isomerase A' _entity.formula_weight 18065.502 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 5.2.1.8 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PPIase A,Cyclophilin A,Cyclosporin A-binding protein,Rotamase A' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MQNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYG EKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIAD CGQLE ; _entity_poly.pdbx_seq_one_letter_code_can ;MQNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYG EKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIAD CGQLE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLN n 1 3 ASN n 1 4 PRO n 1 5 THR n 1 6 VAL n 1 7 PHE n 1 8 PHE n 1 9 ASP n 1 10 ILE n 1 11 ALA n 1 12 VAL n 1 13 ASP n 1 14 GLY n 1 15 GLU n 1 16 PRO n 1 17 LEU n 1 18 GLY n 1 19 ARG n 1 20 VAL n 1 21 SER n 1 22 PHE n 1 23 GLU n 1 24 LEU n 1 25 PHE n 1 26 ALA n 1 27 ASP n 1 28 LYS n 1 29 VAL n 1 30 PRO n 1 31 LYS n 1 32 THR n 1 33 ALA n 1 34 GLU n 1 35 ASN n 1 36 PHE n 1 37 ARG n 1 38 ALA n 1 39 LEU n 1 40 SER n 1 41 THR n 1 42 GLY n 1 43 GLU n 1 44 LYS n 1 45 GLY n 1 46 PHE n 1 47 GLY n 1 48 TYR n 1 49 LYS n 1 50 GLY n 1 51 SER n 1 52 CYS n 1 53 PHE n 1 54 HIS n 1 55 ARG n 1 56 ILE n 1 57 ILE n 1 58 PRO n 1 59 GLY n 1 60 PHE n 1 61 MET n 1 62 CYS n 1 63 GLN n 1 64 GLY n 1 65 GLY n 1 66 ASP n 1 67 PHE n 1 68 THR n 1 69 ARG n 1 70 HIS n 1 71 ASN n 1 72 GLY n 1 73 THR n 1 74 GLY n 1 75 GLY n 1 76 LYS n 1 77 SER n 1 78 ILE n 1 79 TYR n 1 80 GLY n 1 81 GLU n 1 82 LYS n 1 83 PHE n 1 84 GLU n 1 85 ASP n 1 86 GLU n 1 87 ASN n 1 88 PHE n 1 89 ILE n 1 90 LEU n 1 91 LYS n 1 92 HIS n 1 93 THR n 1 94 GLY n 1 95 PRO n 1 96 GLY n 1 97 ILE n 1 98 LEU n 1 99 SER n 1 100 MET n 1 101 ALA n 1 102 ASN n 1 103 ALA n 1 104 GLY n 1 105 PRO n 1 106 ASN n 1 107 THR n 1 108 ASN n 1 109 GLY n 1 110 SER n 1 111 GLN n 1 112 PHE n 1 113 PHE n 1 114 ILE n 1 115 CYS n 1 116 THR n 1 117 ALA n 1 118 LYS n 1 119 THR n 1 120 GLU n 1 121 TRP n 1 122 LEU n 1 123 ASP n 1 124 GLY n 1 125 LYS n 1 126 HIS n 1 127 VAL n 1 128 VAL n 1 129 PHE n 1 130 GLY n 1 131 LYS n 1 132 VAL n 1 133 LYS n 1 134 GLU n 1 135 GLY n 1 136 MET n 1 137 ASN n 1 138 ILE n 1 139 VAL n 1 140 GLU n 1 141 ALA n 1 142 MET n 1 143 GLU n 1 144 ARG n 1 145 PHE n 1 146 GLY n 1 147 SER n 1 148 ARG n 1 149 ASN n 1 150 GLY n 1 151 LYS n 1 152 THR n 1 153 SER n 1 154 LYS n 1 155 LYS n 1 156 ILE n 1 157 THR n 1 158 ILE n 1 159 ALA n 1 160 ASP n 1 161 CYS n 1 162 GLY n 1 163 GLN n 1 164 LEU n 1 165 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 165 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PPIA, CYPA' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PPIA_HUMAN _struct_ref.pdbx_db_accession P62937 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYG EKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIAD CGQLE ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7TA8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 165 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P62937 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 165 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 165 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 7TA8 _struct_ref_seq_dif.mon_id GLN _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 2 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P62937 _struct_ref_seq_dif.db_mon_id VAL _struct_ref_seq_dif.pdbx_seq_db_seq_num 2 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 2 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 2 isotropic 2 1 1 '2D 1H-13C HSQC aromatic' 2 isotropic 3 1 1 '2D 1H-13C TROSY' 2 isotropic 4 1 1 '3D HNCACB' 2 isotropic 5 1 1 '3D HNCA' 2 isotropic 7 1 1 '3D HN(CO)CA' 2 isotropic 9 1 1 '3D HNCO' 2 isotropic 8 1 1 '3D C(CO)NH' 2 isotropic 10 1 1 '3D H(CCO)NH' 2 isotropic 11 1 1 '3D simultaneous 13C,15N-edited NOESY' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 25 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '390 uM [U-13C; U-15N] cyclophilin A, 93% H2O/7% D2O' _pdbx_nmr_sample_details.solvent_system '93% H2O/7% D2O' _pdbx_nmr_sample_details.label U-15N,13C _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 AVANCE ? Bruker 900 ? 2 'AVANCE III HD' ? Bruker 600 ? # _pdbx_nmr_refine.entry_id 7TA8 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # _pdbx_nmr_ensemble.entry_id 7TA8 _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7TA8 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' 'CcpNmr Analysis' ? CCPN 2 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 3 collection TopSpin ? 'Bruker Biospin' 4 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 5 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7TA8 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7TA8 _struct.title 'NMR structure of crosslinked cyclophilin A' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7TA8 _struct_keywords.text 'Isomerase, side chain crosslink' _struct_keywords.pdbx_keywords ISOMERASE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 VAL A 29 ? GLY A 42 ? VAL A 29 GLY A 42 1 ? 14 HELX_P HELX_P2 AA2 GLY A 135 ? PHE A 145 ? GLY A 135 PHE A 145 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id PHE _struct_conn.ptnr1_label_seq_id 60 _struct_conn.ptnr1_label_atom_id CZ _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id TRP _struct_conn.ptnr2_label_seq_id 121 _struct_conn.ptnr2_label_atom_id CZ2 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id PHE _struct_conn.ptnr1_auth_seq_id 60 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id TRP _struct_conn.ptnr2_auth_seq_id 121 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.546 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 131 ? GLU A 134 ? LYS A 131 GLU A 134 AA1 2 GLU A 15 ? GLU A 23 ? GLU A 15 GLU A 23 AA1 3 THR A 5 ? VAL A 12 ? THR A 5 VAL A 12 AA1 4 ILE A 156 ? LEU A 164 ? ILE A 156 LEU A 164 AA2 1 ARG A 55 ? ILE A 57 ? ARG A 55 ILE A 57 AA2 2 MET A 61 ? GLY A 64 ? MET A 61 GLY A 64 AA2 3 PHE A 112 ? CYS A 115 ? PHE A 112 CYS A 115 AA2 4 LEU A 98 ? SER A 99 ? LEU A 98 SER A 99 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LYS A 131 ? O LYS A 131 N GLU A 23 ? N GLU A 23 AA1 2 3 O LEU A 17 ? O LEU A 17 N ILE A 10 ? N ILE A 10 AA1 3 4 N ASP A 9 ? N ASP A 9 O ALA A 159 ? O ALA A 159 AA2 1 2 N ARG A 55 ? N ARG A 55 O GLN A 63 ? O GLN A 63 AA2 2 3 N GLY A 64 ? N GLY A 64 O PHE A 112 ? O PHE A 112 AA2 3 4 O PHE A 113 ? O PHE A 113 N SER A 99 ? N SER A 99 # _atom_sites.entry_id 7TA8 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 CYS 52 52 52 CYS CYS A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 ILE 56 56 56 ILE ILE A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 MET 61 61 61 MET MET A . n A 1 62 CYS 62 62 62 CYS CYS A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 HIS 70 70 70 HIS HIS A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 TYR 79 79 79 TYR TYR A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 GLU 81 81 81 GLU GLU A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 GLY 96 96 96 GLY GLY A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 MET 100 100 100 MET MET A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 ASN 102 102 102 ASN ASN A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 ASN 108 108 108 ASN ASN A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 SER 110 110 110 SER SER A . n A 1 111 GLN 111 111 111 GLN GLN A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 CYS 115 115 115 CYS CYS A . n A 1 116 THR 116 116 116 THR THR A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 TRP 121 121 121 TRP TRP A . n A 1 122 LEU 122 122 122 LEU LEU A . n A 1 123 ASP 123 123 123 ASP ASP A . n A 1 124 GLY 124 124 124 GLY GLY A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 HIS 126 126 126 HIS HIS A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 VAL 128 128 128 VAL VAL A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 MET 136 136 136 MET MET A . n A 1 137 ASN 137 137 137 ASN ASN A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 MET 142 142 142 MET MET A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 ARG 144 144 144 ARG ARG A . n A 1 145 PHE 145 145 145 PHE PHE A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 ARG 148 148 148 ARG ARG A . n A 1 149 ASN 149 149 149 ASN ASN A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 LYS 151 151 151 LYS LYS A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 SER 153 153 153 SER SER A . n A 1 154 LYS 154 154 154 LYS LYS A . n A 1 155 LYS 155 155 155 LYS LYS A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 ILE 158 158 158 ILE ILE A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 ASP 160 160 160 ASP ASP A . n A 1 161 CYS 161 161 161 CYS CYS A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 GLN 163 163 163 GLN GLN A . n A 1 164 LEU 164 164 164 LEU LEU A . n A 1 165 GLU 165 165 165 GLU GLU A . n # _pdbx_contact_author.id 3 _pdbx_contact_author.email amg100@pitt.edu _pdbx_contact_author.name_first Angela _pdbx_contact_author.name_last Gronenborn _pdbx_contact_author.name_mi M. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-9072-3525 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-06-01 2 'Structure model' 1 1 2022-06-29 3 'Structure model' 1 2 2023-04-12 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Derived calculations' 4 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' pdbx_validate_close_contact 3 3 'Structure model' struct_conn 4 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component 'cyclophilin A' _pdbx_nmr_exptl_sample.concentration 390 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units uM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-13C; U-15N]' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 60 ? ? -142.05 -73.22 2 1 ASN A 87 ? ? 175.51 173.25 3 1 GLN A 111 ? ? 175.86 126.96 4 1 LYS A 125 ? ? -141.08 -33.24 5 2 GLN A 2 ? ? 64.47 128.58 6 2 PHE A 46 ? ? -87.74 39.87 7 2 LYS A 49 ? ? -38.09 138.37 8 2 PHE A 60 ? ? -145.61 -81.19 9 2 ASN A 71 ? ? -145.28 28.55 10 2 ASN A 87 ? ? 172.10 -178.76 11 2 GLN A 111 ? ? 70.75 114.44 12 3 PHE A 46 ? ? -97.03 36.96 13 3 TYR A 48 ? ? -57.69 -178.18 14 3 LYS A 49 ? ? -37.12 135.76 15 3 PHE A 60 ? ? -153.11 -68.11 16 3 ARG A 69 ? ? -140.16 -27.38 17 3 GLN A 111 ? ? -177.84 122.20 18 3 LYS A 125 ? ? -122.65 -67.33 19 4 TYR A 48 ? ? -61.80 96.57 20 4 PHE A 60 ? ? -145.46 -76.76 21 4 ASN A 87 ? ? 167.58 -179.50 22 4 LEU A 90 ? ? -104.14 77.92 23 4 ASN A 108 ? ? -66.21 -165.30 24 4 GLN A 111 ? ? 164.19 148.24 25 5 PHE A 46 ? ? -90.51 35.85 26 5 TYR A 48 ? ? -56.66 -175.73 27 5 LYS A 49 ? ? -35.35 137.57 28 5 PHE A 60 ? ? -150.60 -73.38 29 5 ASN A 87 ? ? 174.20 172.79 30 5 PHE A 88 ? ? -111.80 65.54 31 5 GLN A 111 ? ? 168.47 125.90 32 5 LYS A 125 ? ? -120.86 -59.95 33 5 PHE A 129 ? ? -161.26 109.18 34 6 PHE A 25 ? ? -104.64 69.02 35 6 PHE A 46 ? ? -92.65 34.62 36 6 TYR A 48 ? ? -68.80 -177.89 37 6 LYS A 49 ? ? -36.14 133.81 38 6 PHE A 60 ? ? -109.32 -71.01 39 6 ASN A 87 ? ? 168.72 175.29 40 6 PHE A 88 ? ? -115.97 62.67 41 6 GLN A 111 ? ? 61.83 110.58 42 6 LYS A 125 ? ? -131.62 -54.11 43 6 PHE A 129 ? ? -162.33 112.73 44 7 PHE A 46 ? ? -91.12 32.56 45 7 TYR A 48 ? ? -52.84 -179.01 46 7 LYS A 49 ? ? -36.88 138.04 47 7 PHE A 60 ? ? -148.16 -74.93 48 7 ASN A 71 ? ? -138.58 -84.51 49 7 GLN A 111 ? ? 64.90 115.74 50 7 LYS A 125 ? ? -139.70 -51.11 51 8 PHE A 46 ? ? -92.99 39.77 52 8 LYS A 49 ? ? -38.58 137.19 53 8 PHE A 60 ? ? -136.85 -74.96 54 8 ASN A 71 ? ? -162.24 -79.84 55 8 ASN A 87 ? ? 170.14 179.72 56 8 LEU A 90 ? ? -100.58 76.95 57 8 LYS A 91 ? ? -56.19 -177.53 58 8 GLN A 111 ? ? 62.84 109.49 59 8 LYS A 125 ? ? -97.20 -76.15 60 9 PHE A 25 ? ? -114.76 67.24 61 9 PHE A 46 ? ? -96.73 41.82 62 9 LYS A 49 ? ? -38.29 136.91 63 9 PHE A 60 ? ? -149.47 -70.95 64 9 ARG A 69 ? ? -155.63 -49.50 65 9 HIS A 70 ? ? 62.16 61.78 66 9 ASN A 71 ? ? -152.33 27.82 67 9 HIS A 92 ? ? -68.97 99.14 68 9 GLN A 111 ? ? 73.28 120.48 69 9 LYS A 125 ? ? -129.80 -59.28 70 9 PHE A 129 ? ? -163.31 112.21 71 10 PHE A 46 ? ? -97.91 38.02 72 10 LYS A 49 ? ? -37.54 136.59 73 10 PHE A 60 ? ? -135.34 -75.74 74 10 HIS A 70 ? ? 38.56 49.29 75 10 ASN A 71 ? ? -158.70 58.46 76 10 TYR A 79 ? ? -116.32 57.12 77 10 HIS A 92 ? ? -69.26 80.78 78 10 GLN A 111 ? ? -171.20 133.44 79 10 LYS A 125 ? ? -131.29 -67.00 80 10 PHE A 129 ? ? -160.57 114.46 81 11 TYR A 48 ? ? -65.61 96.74 82 11 PHE A 53 ? ? -63.60 98.83 83 11 PHE A 60 ? ? -143.12 -75.58 84 11 ASN A 71 ? ? -154.03 16.15 85 11 TYR A 79 ? ? -119.73 56.89 86 11 ASN A 87 ? ? 171.26 -179.80 87 11 HIS A 92 ? ? -67.41 83.64 88 11 ALA A 103 ? ? -105.37 76.47 89 11 GLN A 111 ? ? -171.29 129.45 90 11 LYS A 125 ? ? -142.00 -63.54 91 12 LEU A 17 ? ? -120.28 -53.31 92 12 TYR A 48 ? ? -69.32 95.63 93 12 PHE A 53 ? ? -62.91 92.21 94 12 PHE A 60 ? ? -148.13 -70.88 95 12 ALA A 103 ? ? -105.05 78.98 96 12 GLN A 111 ? ? 76.50 137.63 97 13 PHE A 25 ? ? -103.15 67.85 98 13 TYR A 48 ? ? -64.96 94.35 99 13 PHE A 60 ? ? -130.46 -74.87 100 13 ARG A 69 ? ? -136.61 -32.90 101 13 HIS A 92 ? ? -68.61 78.01 102 13 GLN A 111 ? ? 66.55 122.61 103 14 PHE A 25 ? ? -102.67 75.97 104 14 TYR A 48 ? ? -65.53 94.66 105 14 PHE A 53 ? ? -69.33 91.33 106 14 PHE A 60 ? ? -149.18 -75.01 107 14 ASN A 87 ? ? 168.34 178.38 108 14 PHE A 88 ? ? -114.57 57.10 109 14 GLN A 111 ? ? 73.03 124.02 110 14 PHE A 129 ? ? -160.78 113.19 111 15 GLN A 2 ? ? 51.73 -160.36 112 15 PHE A 25 ? ? -103.01 77.22 113 15 TYR A 48 ? ? -66.57 94.56 114 15 PHE A 53 ? ? -45.69 103.97 115 15 PHE A 60 ? ? -146.10 -74.14 116 15 ASN A 71 ? ? -165.69 -34.78 117 15 ASN A 87 ? ? 175.88 169.91 118 15 GLN A 111 ? ? -176.28 133.94 119 15 LYS A 125 ? ? -90.84 -79.84 120 16 PHE A 46 ? ? -86.77 38.26 121 16 LYS A 49 ? ? -35.40 138.30 122 16 PHE A 60 ? ? -142.66 -77.43 123 16 ARG A 69 ? ? -142.25 -48.07 124 16 GLN A 111 ? ? 66.43 109.44 125 16 LYS A 125 ? ? -133.52 -61.74 126 17 PHE A 25 ? ? -101.71 68.01 127 17 PHE A 46 ? ? -93.34 34.98 128 17 TYR A 48 ? ? -56.21 -176.56 129 17 LYS A 49 ? ? -34.93 136.35 130 17 PHE A 60 ? ? -152.21 -69.13 131 17 ASN A 87 ? ? 171.92 171.04 132 17 PHE A 88 ? ? -107.23 62.60 133 17 GLN A 111 ? ? -179.55 126.94 134 17 LYS A 125 ? ? -101.43 -66.66 135 18 TYR A 48 ? ? -58.86 -176.39 136 18 LYS A 49 ? ? -35.39 137.64 137 18 PHE A 60 ? ? -148.70 -73.29 138 18 ASN A 71 ? ? -165.41 -36.66 139 18 ASN A 87 ? ? 170.67 172.07 140 18 ASN A 108 ? ? -69.19 -172.08 141 18 GLN A 111 ? ? 167.15 120.13 142 18 LYS A 125 ? ? -97.39 -73.86 143 19 PHE A 46 ? ? -78.85 37.82 144 19 LYS A 49 ? ? -39.43 132.10 145 19 PHE A 60 ? ? -147.36 -68.44 146 19 HIS A 70 ? ? 39.34 46.86 147 19 ASN A 87 ? ? 169.94 178.83 148 19 LYS A 91 ? ? -60.78 -177.39 149 19 GLN A 111 ? ? 65.34 124.08 150 19 LYS A 125 ? ? -106.20 -64.45 151 20 TYR A 48 ? ? -67.17 95.31 152 20 PHE A 53 ? ? -46.81 105.41 153 20 PHE A 60 ? ? -143.21 -76.68 154 20 LEU A 90 ? ? -102.46 71.50 155 20 LYS A 91 ? ? -55.82 178.85 156 20 ASN A 108 ? ? -59.42 -163.78 157 20 GLN A 111 ? ? 169.92 129.22 158 20 LYS A 125 ? ? -152.53 -44.19 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' P50AI150481 1 'National Science Foundation (NSF, United States)' 'United States' CHE-1708773 2 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #