data_7TFS # _entry.id 7TFS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.403 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7TFS pdb_00007tfs 10.2210/pdb7tfs/pdb WWPDB D_1000262237 ? ? EMDB EMD-25879 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2022-05-04 ? 2 'EM metadata' 1 0 2022-05-04 ? 3 Image 1 0 2022-05-04 ? 4 'Primary map' 1 0 2022-05-04 ? 5 'Structure model' 1 1 2022-11-16 ? 6 Image 1 0 2022-05-04 ? 7 'Primary map' 1 0 2022-05-04 ? 8 'Structure model' 1 2 2024-12-25 ? 9 Image 1 0 2022-05-04 ? 10 'Primary map' 1 0 2022-05-04 ? 11 'Structure model' 1 3 2025-05-14 ? 12 'EM metadata' 1 1 2025-05-14 ? # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'EM metadata' repository 'Initial release' ? ? 3 3 Image repository 'Initial release' ? ? 4 4 'Primary map' repository 'Initial release' ? ? 5 6 Image repository 'Initial release' ? ? 6 7 'Primary map' repository 'Initial release' ? ? 7 9 Image repository 'Initial release' ? ? 8 10 'Primary map' repository 'Initial release' ? ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 5 'Structure model' 'Database references' 2 8 'Structure model' Advisory 3 8 'Structure model' 'Data collection' 4 8 'Structure model' 'Derived calculations' 5 8 'Structure model' 'Structure summary' 6 11 'Structure model' 'Data collection' 7 12 'EM metadata' 'Data processing' 8 12 'EM metadata' 'Experimental summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' citation 2 5 'Structure model' citation_author 3 8 'Structure model' chem_comp_atom 4 8 'Structure model' chem_comp_bond 5 8 'Structure model' em_admin 6 8 'Structure model' pdbx_entry_details 7 8 'Structure model' pdbx_modification_feature 8 8 'Structure model' pdbx_validate_close_contact 9 8 'Structure model' struct_conn 10 11 'Structure model' em_admin 11 11 'Structure model' em_software 12 12 'EM metadata' em_admin 13 12 'EM metadata' em_software # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_citation.country' 2 5 'Structure model' '_citation.journal_abbrev' 3 5 'Structure model' '_citation.journal_id_CSD' 4 5 'Structure model' '_citation.journal_id_ISSN' 5 5 'Structure model' '_citation.journal_volume' 6 5 'Structure model' '_citation.page_first' 7 5 'Structure model' '_citation.page_last' 8 5 'Structure model' '_citation.pdbx_database_id_DOI' 9 5 'Structure model' '_citation.pdbx_database_id_PubMed' 10 5 'Structure model' '_citation.title' 11 5 'Structure model' '_citation.year' 12 8 'Structure model' '_em_admin.last_update' 13 8 'Structure model' '_pdbx_entry_details.has_protein_modification' 14 11 'Structure model' '_em_admin.last_update' 15 11 'Structure model' '_em_software.name' 16 12 'EM metadata' '_em_admin.last_update' 17 12 'EM metadata' '_em_software.name' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7TFS _pdbx_database_status.recvd_initial_deposition_date 2022-01-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name EMDB _pdbx_database_related.details 'Cryo-EM of the OmcE nanowires from Geobacter sulfurreducens' _pdbx_database_related.db_id EMD-25879 _pdbx_database_related.content_type 'associated EM volume' # _pdbx_contact_author.id 2 _pdbx_contact_author.email egelman@virginia.edu _pdbx_contact_author.name_first Edward _pdbx_contact_author.name_last Egelman _pdbx_contact_author.name_mi H _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-4844-5212 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wang, F.' 1 ? 'Mustafa, K.' 2 ? 'Chan, C.H.' 3 ? 'Joshi, K.' 4 ? 'Hochbaum, A.I.' 5 ? 'Bond, D.R.' 6 ? 'Egelman, E.H.' 7 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Microbiol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2058-5276 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 7 _citation.language ? _citation.page_first 1291 _citation.page_last 1300 _citation.title 'Cryo-EM structure of an extracellular Geobacter OmcE cytochrome filament reveals tetrahaem packing.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41564-022-01159-z _citation.pdbx_database_id_PubMed 35798889 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, F.' 1 ? primary 'Mustafa, K.' 2 ? primary 'Suciu, V.' 3 0000-0003-2335-2650 primary 'Joshi, K.' 4 ? primary 'Chan, C.H.' 5 ? primary 'Choi, S.' 6 0000-0002-0033-0734 primary 'Su, Z.' 7 0000-0001-6495-3351 primary 'Si, D.' 8 0000-0001-7039-2589 primary 'Hochbaum, A.I.' 9 0000-0002-5377-8065 primary 'Egelman, E.H.' 10 0000-0003-4844-5212 primary 'Bond, D.R.' 11 0000-0001-8083-7107 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'Cytochrome c' 23839.742 1 ? ? ? ? 2 non-polymer syn 'HEME C' 618.503 4 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MRSEVKIGLALTALLVAVTAAGAASIKNTKHDLSSGSTGATFKATNTDQICVFCHTPHNAQQDIPLWNRGNPTASTFTLY SSSSMNNVPVKQGFTADSISLFCMSCHDGATGLGGAVHNDPNGAAIAMVGGNDLITGEANLGTDLSNDHPVNFEVTPAGI AADGNLGALDTGTNPPTMKTGDVTNGLPLFKSARGATTLECGSCHKVHDNTDAPFLRTTMAGSKLCLGCHKK ; _entity_poly.pdbx_seq_one_letter_code_can ;MRSEVKIGLALTALLVAVTAAGAASIKNTKHDLSSGSTGATFKATNTDQICVFCHTPHNAQQDIPLWNRGNPTASTFTLY SSSSMNNVPVKQGFTADSISLFCMSCHDGATGLGGAVHNDPNGAAIAMVGGNDLITGEANLGTDLSNDHPVNFEVTPAGI AADGNLGALDTGTNPPTMKTGDVTNGLPLFKSARGATTLECGSCHKVHDNTDAPFLRTTMAGSKLCLGCHKK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'HEME C' _pdbx_entity_nonpoly.comp_id HEC # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 SER n 1 4 GLU n 1 5 VAL n 1 6 LYS n 1 7 ILE n 1 8 GLY n 1 9 LEU n 1 10 ALA n 1 11 LEU n 1 12 THR n 1 13 ALA n 1 14 LEU n 1 15 LEU n 1 16 VAL n 1 17 ALA n 1 18 VAL n 1 19 THR n 1 20 ALA n 1 21 ALA n 1 22 GLY n 1 23 ALA n 1 24 ALA n 1 25 SER n 1 26 ILE n 1 27 LYS n 1 28 ASN n 1 29 THR n 1 30 LYS n 1 31 HIS n 1 32 ASP n 1 33 LEU n 1 34 SER n 1 35 SER n 1 36 GLY n 1 37 SER n 1 38 THR n 1 39 GLY n 1 40 ALA n 1 41 THR n 1 42 PHE n 1 43 LYS n 1 44 ALA n 1 45 THR n 1 46 ASN n 1 47 THR n 1 48 ASP n 1 49 GLN n 1 50 ILE n 1 51 CYS n 1 52 VAL n 1 53 PHE n 1 54 CYS n 1 55 HIS n 1 56 THR n 1 57 PRO n 1 58 HIS n 1 59 ASN n 1 60 ALA n 1 61 GLN n 1 62 GLN n 1 63 ASP n 1 64 ILE n 1 65 PRO n 1 66 LEU n 1 67 TRP n 1 68 ASN n 1 69 ARG n 1 70 GLY n 1 71 ASN n 1 72 PRO n 1 73 THR n 1 74 ALA n 1 75 SER n 1 76 THR n 1 77 PHE n 1 78 THR n 1 79 LEU n 1 80 TYR n 1 81 SER n 1 82 SER n 1 83 SER n 1 84 SER n 1 85 MET n 1 86 ASN n 1 87 ASN n 1 88 VAL n 1 89 PRO n 1 90 VAL n 1 91 LYS n 1 92 GLN n 1 93 GLY n 1 94 PHE n 1 95 THR n 1 96 ALA n 1 97 ASP n 1 98 SER n 1 99 ILE n 1 100 SER n 1 101 LEU n 1 102 PHE n 1 103 CYS n 1 104 MET n 1 105 SER n 1 106 CYS n 1 107 HIS n 1 108 ASP n 1 109 GLY n 1 110 ALA n 1 111 THR n 1 112 GLY n 1 113 LEU n 1 114 GLY n 1 115 GLY n 1 116 ALA n 1 117 VAL n 1 118 HIS n 1 119 ASN n 1 120 ASP n 1 121 PRO n 1 122 ASN n 1 123 GLY n 1 124 ALA n 1 125 ALA n 1 126 ILE n 1 127 ALA n 1 128 MET n 1 129 VAL n 1 130 GLY n 1 131 GLY n 1 132 ASN n 1 133 ASP n 1 134 LEU n 1 135 ILE n 1 136 THR n 1 137 GLY n 1 138 GLU n 1 139 ALA n 1 140 ASN n 1 141 LEU n 1 142 GLY n 1 143 THR n 1 144 ASP n 1 145 LEU n 1 146 SER n 1 147 ASN n 1 148 ASP n 1 149 HIS n 1 150 PRO n 1 151 VAL n 1 152 ASN n 1 153 PHE n 1 154 GLU n 1 155 VAL n 1 156 THR n 1 157 PRO n 1 158 ALA n 1 159 GLY n 1 160 ILE n 1 161 ALA n 1 162 ALA n 1 163 ASP n 1 164 GLY n 1 165 ASN n 1 166 LEU n 1 167 GLY n 1 168 ALA n 1 169 LEU n 1 170 ASP n 1 171 THR n 1 172 GLY n 1 173 THR n 1 174 ASN n 1 175 PRO n 1 176 PRO n 1 177 THR n 1 178 MET n 1 179 LYS n 1 180 THR n 1 181 GLY n 1 182 ASP n 1 183 VAL n 1 184 THR n 1 185 ASN n 1 186 GLY n 1 187 LEU n 1 188 PRO n 1 189 LEU n 1 190 PHE n 1 191 LYS n 1 192 SER n 1 193 ALA n 1 194 ARG n 1 195 GLY n 1 196 ALA n 1 197 THR n 1 198 THR n 1 199 LEU n 1 200 GLU n 1 201 CYS n 1 202 GLY n 1 203 SER n 1 204 CYS n 1 205 HIS n 1 206 LYS n 1 207 VAL n 1 208 HIS n 1 209 ASP n 1 210 ASN n 1 211 THR n 1 212 ASP n 1 213 ALA n 1 214 PRO n 1 215 PHE n 1 216 LEU n 1 217 ARG n 1 218 THR n 1 219 THR n 1 220 MET n 1 221 ALA n 1 222 GLY n 1 223 SER n 1 224 LYS n 1 225 LEU n 1 226 CYS n 1 227 LEU n 1 228 GLY n 1 229 CYS n 1 230 HIS n 1 231 LYS n 1 232 LYS n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num 1 _entity_src_nat.pdbx_end_seq_num 232 _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Geobacter sulfurreducens' _entity_src_nat.pdbx_ncbi_taxonomy_id 35554 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain 'ATCC 51573 / DSM 12127 / PCA' _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEC non-polymer . 'HEME C' ? 'C34 H34 Fe N4 O4' 618.503 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ARG 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 GLU 4 4 ? ? ? A . n A 1 5 VAL 5 5 ? ? ? A . n A 1 6 LYS 6 6 ? ? ? A . n A 1 7 ILE 7 7 ? ? ? A . n A 1 8 GLY 8 8 ? ? ? A . n A 1 9 LEU 9 9 ? ? ? A . n A 1 10 ALA 10 10 ? ? ? A . n A 1 11 LEU 11 11 ? ? ? A . n A 1 12 THR 12 12 ? ? ? A . n A 1 13 ALA 13 13 ? ? ? A . n A 1 14 LEU 14 14 ? ? ? A . n A 1 15 LEU 15 15 ? ? ? A . n A 1 16 VAL 16 16 ? ? ? A . n A 1 17 ALA 17 17 ? ? ? A . n A 1 18 VAL 18 18 ? ? ? A . n A 1 19 THR 19 19 ? ? ? A . n A 1 20 ALA 20 20 ? ? ? A . n A 1 21 ALA 21 21 ? ? ? A . n A 1 22 GLY 22 22 ? ? ? A . n A 1 23 ALA 23 23 ? ? ? A . n A 1 24 ALA 24 24 ? ? ? A . n A 1 25 SER 25 25 ? ? ? A . n A 1 26 ILE 26 26 ? ? ? A . n A 1 27 LYS 27 27 ? ? ? A . n A 1 28 ASN 28 28 ? ? ? A . n A 1 29 THR 29 29 ? ? ? A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 ASN 46 46 46 ASN ASN A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 CYS 51 51 51 CYS CYS A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 HIS 55 55 55 HIS HIS A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 TRP 67 67 67 TRP TRP A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 MET 85 85 85 MET MET A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 SER 98 98 98 SER SER A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 PHE 102 102 102 PHE PHE A . n A 1 103 CYS 103 103 103 CYS CYS A . n A 1 104 MET 104 104 104 MET MET A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 CYS 106 106 106 CYS CYS A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 HIS 118 118 118 HIS HIS A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 ASP 120 120 120 ASP ASP A . n A 1 121 PRO 121 121 121 PRO PRO A . n A 1 122 ASN 122 122 122 ASN ASN A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 MET 128 128 128 MET MET A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 THR 136 136 136 THR THR A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 ALA 139 139 139 ALA ALA A . n A 1 140 ASN 140 140 140 ASN ASN A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 ASN 147 147 147 ASN ASN A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 HIS 149 149 149 HIS HIS A . n A 1 150 PRO 150 150 150 PRO PRO A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 ASN 152 152 152 ASN ASN A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 THR 156 156 156 THR THR A . n A 1 157 PRO 157 157 157 PRO PRO A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 ILE 160 160 160 ILE ILE A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 ASP 163 163 163 ASP ASP A . n A 1 164 GLY 164 164 164 GLY GLY A . n A 1 165 ASN 165 165 165 ASN ASN A . n A 1 166 LEU 166 166 166 LEU LEU A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 ASP 170 170 170 ASP ASP A . n A 1 171 THR 171 171 171 THR THR A . n A 1 172 GLY 172 172 172 GLY GLY A . n A 1 173 THR 173 173 173 THR THR A . n A 1 174 ASN 174 174 174 ASN ASN A . n A 1 175 PRO 175 175 175 PRO PRO A . n A 1 176 PRO 176 176 176 PRO PRO A . n A 1 177 THR 177 177 177 THR THR A . n A 1 178 MET 178 178 178 MET MET A . n A 1 179 LYS 179 179 179 LYS LYS A . n A 1 180 THR 180 180 180 THR THR A . n A 1 181 GLY 181 181 181 GLY GLY A . n A 1 182 ASP 182 182 182 ASP ASP A . n A 1 183 VAL 183 183 183 VAL VAL A . n A 1 184 THR 184 184 184 THR THR A . n A 1 185 ASN 185 185 185 ASN ASN A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 PRO 188 188 188 PRO PRO A . n A 1 189 LEU 189 189 189 LEU LEU A . n A 1 190 PHE 190 190 190 PHE PHE A . n A 1 191 LYS 191 191 191 LYS LYS A . n A 1 192 SER 192 192 192 SER SER A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 ARG 194 194 194 ARG ARG A . n A 1 195 GLY 195 195 195 GLY GLY A . n A 1 196 ALA 196 196 196 ALA ALA A . n A 1 197 THR 197 197 197 THR THR A . n A 1 198 THR 198 198 198 THR THR A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 GLU 200 200 200 GLU GLU A . n A 1 201 CYS 201 201 201 CYS CYS A . n A 1 202 GLY 202 202 202 GLY GLY A . n A 1 203 SER 203 203 203 SER SER A . n A 1 204 CYS 204 204 204 CYS CYS A . n A 1 205 HIS 205 205 205 HIS HIS A . n A 1 206 LYS 206 206 206 LYS LYS A . n A 1 207 VAL 207 207 207 VAL VAL A . n A 1 208 HIS 208 208 208 HIS HIS A . n A 1 209 ASP 209 209 209 ASP ASP A . n A 1 210 ASN 210 210 210 ASN ASN A . n A 1 211 THR 211 211 211 THR THR A . n A 1 212 ASP 212 212 212 ASP ASP A . n A 1 213 ALA 213 213 213 ALA ALA A . n A 1 214 PRO 214 214 214 PRO PRO A . n A 1 215 PHE 215 215 215 PHE PHE A . n A 1 216 LEU 216 216 216 LEU LEU A . n A 1 217 ARG 217 217 217 ARG ARG A . n A 1 218 THR 218 218 218 THR THR A . n A 1 219 THR 219 219 219 THR THR A . n A 1 220 MET 220 220 220 MET MET A . n A 1 221 ALA 221 221 221 ALA ALA A . n A 1 222 GLY 222 222 222 GLY GLY A . n A 1 223 SER 223 223 223 SER SER A . n A 1 224 LYS 224 224 224 LYS LYS A . n A 1 225 LEU 225 225 225 LEU LEU A . n A 1 226 CYS 226 226 226 CYS CYS A . n A 1 227 LEU 227 227 227 LEU LEU A . n A 1 228 GLY 228 228 228 GLY GLY A . n A 1 229 CYS 229 229 229 CYS CYS A . n A 1 230 HIS 230 230 230 HIS HIS A . n A 1 231 LYS 231 231 231 LYS LYS A . n A 1 232 LYS 232 232 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id HEC _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id HEC _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HEC 1 301 301 HEC HEC A . C 2 HEC 1 302 302 HEC HEC A . D 2 HEC 1 303 303 HEC HEC A . E 2 HEC 1 304 304 HEC HEC A . # _software.citation_id ? _software.classification refinement _software.compiler_name ? _software.compiler_version ? _software.contact_author ? _software.contact_author_email ? _software.date ? _software.description ? _software.dependencies ? _software.hardware ? _software.language ? _software.location ? _software.mods ? _software.name PHENIX _software.os ? _software.os_version ? _software.type ? _software.version 1.19.2_4158: _software.pdbx_ordinal 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7TFS _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _refine.pdbx_refine_id 'ELECTRON MICROSCOPY' _refine.entry_id 7TFS _refine.pdbx_diffrn_id ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low ? _refine.ls_d_res_high . _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'ELECTRON MICROSCOPY' ? 0.004 ? 5052 ? f_bond_d ? ? 'ELECTRON MICROSCOPY' ? 0.931 ? 7047 ? f_angle_d ? ? 'ELECTRON MICROSCOPY' ? 16.553 ? 711 ? f_dihedral_angle_d ? ? 'ELECTRON MICROSCOPY' ? 0.043 ? 699 ? f_chiral_restr ? ? 'ELECTRON MICROSCOPY' ? 0.009 ? 885 ? f_plane_restr ? ? # _struct.entry_id 7TFS _struct.title 'Cryo-EM of the OmcE nanowires from Geobacter sulfurreducens' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7TFS _struct_keywords.text 'helical symmetry, cytochrome nanowire, filament, ELECTRON TRANSPORT, PROTEIN FIBRIL' _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT, PROTEIN FIBRIL' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q74FJ0_GEOSL _struct_ref.pdbx_db_accession Q74FJ0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MRSEVKIGLALTALLVAVTAAGAASIKNTKHDLSSGSTGATFKATNTDQICVFCHTPHNAQQDIPLWNRGNPTASTFTLY SSSSMNNVPVKQGFTADSISLFCMSCHDGATGLGGAVHNDPNGAAIAMVGGNDLITGEANLGTDLSNDHPVNFEVTPAGI AADGNLGALDTGTNPPTMKTGDVTNGLPLFKSARGATTLECGSCHKVHDNTDAPFLRTTMAGSKLCLGCHKK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7TFS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 232 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q74FJ0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 232 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 232 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 'representative helical assembly' ? heptameric 7 2 'helical asymmetric unit' ? monomeric 1 3 'helical asymmetric unit, std helical frame' ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 '(1-7)' A,B,C,D,E 2 4 A,B,C,D,E 3 H A,B,C,D,E # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'electron microscopy' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] H 'identity operation' 1_555 x,y,z 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 1 'helical symmetry operation' ? ? -0.99806598 0.06216343 0.00000000 0.00000 -0.06216343 -0.99806598 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -101.70000 2 'helical symmetry operation' ? ? -0.46366721 0.88600944 0.00000000 0.00000 -0.88600944 -0.46366721 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -67.80000 3 'helical symmetry operation' ? ? 0.51784785 0.85547274 0.00000000 0.00000 -0.85547274 0.51784785 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -33.90000 4 'identity operation' 1_555 x,y,z 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 5 'helical symmetry operation' ? ? 0.51784785 -0.85547274 0.00000000 0.00000 0.85547274 0.51784785 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 33.90000 6 'helical symmetry operation' ? ? -0.46366721 -0.88600944 0.00000000 0.00000 0.88600944 -0.46366721 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 67.80000 7 'helical symmetry operation' ? ? -0.99806598 -0.06216343 0.00000000 0.00000 0.06216343 -0.99806598 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 101.70000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ILE A 50 ? CYS A 54 ? ILE A 50 CYS A 54 5 ? 5 HELX_P HELX_P2 AA2 THR A 73 ? PHE A 77 ? THR A 73 PHE A 77 5 ? 5 HELX_P HELX_P3 AA3 ASN A 87 ? LYS A 91 ? ASN A 87 LYS A 91 5 ? 5 HELX_P HELX_P4 AA4 SER A 98 ? HIS A 107 ? SER A 98 HIS A 107 1 ? 10 HELX_P HELX_P5 AA5 MET A 128 ? ASN A 132 ? MET A 128 ASN A 132 5 ? 5 HELX_P HELX_P6 AA6 THR A 156 ? GLY A 164 ? THR A 156 GLY A 164 1 ? 9 HELX_P HELX_P7 AA7 SER A 223 ? HIS A 230 ? SER A 223 HIS A 230 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A CYS 54 SG ? ? ? 1_555 B HEC . CAC ? ? A CYS 54 A HEC 301 1_555 ? ? ? ? ? ? ? 1.845 ? ? covale2 covale none ? A CYS 103 SG ? ? ? 1_555 C HEC . CAB ? ? A CYS 103 A HEC 302 1_555 ? ? ? ? ? ? ? 1.857 ? ? covale3 covale none ? A CYS 201 SG ? ? ? 1_555 D HEC . CAB ? ? A CYS 201 A HEC 303 1_555 ? ? ? ? ? ? ? 1.868 ? ? covale4 covale none ? A CYS 226 SG ? ? ? 1_555 E HEC . CAB ? ? A CYS 226 A HEC 304 1_555 ? ? ? ? ? ? ? 1.876 ? ? covale5 covale none ? A CYS 229 SG ? ? ? 1_555 E HEC . CAC ? ? A CYS 229 A HEC 304 1_555 ? ? ? ? ? ? ? 1.949 ? ? metalc1 metalc ? ? A HIS 31 NE2 ? ? ? 1_555 C HEC . FE ? ? A HIS 31 A HEC 302 1_555 ? ? ? ? ? ? ? 2.080 ? ? metalc2 metalc ? ? A HIS 55 NE2 ? ? ? 1_555 B HEC . FE ? ? A HIS 55 A HEC 301 1_555 ? ? ? ? ? ? ? 2.001 ? ? metalc3 metalc ? ? A HIS 107 NE2 ? ? ? 1_555 C HEC . FE ? ? A HIS 107 A HEC 302 1_555 ? ? ? ? ? ? ? 2.014 ? ? metalc4 metalc ? ? A HIS 149 NE2 ? ? ? 1_555 E HEC . FE ? ? A HIS 149 A HEC 304 1_555 ? ? ? ? ? ? ? 2.055 ? ? metalc5 metalc ? ? A HIS 205 NE2 ? ? ? 1_555 D HEC . FE ? ? A HIS 205 A HEC 303 1_555 ? ? ? ? ? ? ? 2.048 ? ? metalc6 metalc ? ? A HIS 208 NE2 ? ? ? 1_555 B HEC . FE ? ? A HIS 208 A HEC 301 1_555 ? ? ? ? ? ? ? 1.966 ? ? metalc7 metalc ? ? A HIS 230 NE2 ? ? ? 1_555 E HEC . FE ? ? A HIS 230 A HEC 304 1_555 ? ? ? ? ? ? ? 2.094 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 31 ? A HIS 31 ? 1_555 FE ? C HEC . ? A HEC 302 ? 1_555 NA ? C HEC . ? A HEC 302 ? 1_555 94.2 ? 2 NE2 ? A HIS 31 ? A HIS 31 ? 1_555 FE ? C HEC . ? A HEC 302 ? 1_555 NB ? C HEC . ? A HEC 302 ? 1_555 85.9 ? 3 NA ? C HEC . ? A HEC 302 ? 1_555 FE ? C HEC . ? A HEC 302 ? 1_555 NB ? C HEC . ? A HEC 302 ? 1_555 89.3 ? 4 NE2 ? A HIS 31 ? A HIS 31 ? 1_555 FE ? C HEC . ? A HEC 302 ? 1_555 NC ? C HEC . ? A HEC 302 ? 1_555 83.4 ? 5 NA ? C HEC . ? A HEC 302 ? 1_555 FE ? C HEC . ? A HEC 302 ? 1_555 NC ? C HEC . ? A HEC 302 ? 1_555 177.2 ? 6 NB ? C HEC . ? A HEC 302 ? 1_555 FE ? C HEC . ? A HEC 302 ? 1_555 NC ? C HEC . ? A HEC 302 ? 1_555 89.0 ? 7 NE2 ? A HIS 31 ? A HIS 31 ? 1_555 FE ? C HEC . ? A HEC 302 ? 1_555 ND ? C HEC . ? A HEC 302 ? 1_555 92.2 ? 8 NA ? C HEC . ? A HEC 302 ? 1_555 FE ? C HEC . ? A HEC 302 ? 1_555 ND ? C HEC . ? A HEC 302 ? 1_555 91.1 ? 9 NB ? C HEC . ? A HEC 302 ? 1_555 FE ? C HEC . ? A HEC 302 ? 1_555 ND ? C HEC . ? A HEC 302 ? 1_555 178.1 ? 10 NC ? C HEC . ? A HEC 302 ? 1_555 FE ? C HEC . ? A HEC 302 ? 1_555 ND ? C HEC . ? A HEC 302 ? 1_555 90.5 ? 11 NE2 ? A HIS 31 ? A HIS 31 ? 1_555 FE ? C HEC . ? A HEC 302 ? 1_555 NE2 ? A HIS 107 ? A HIS 107 ? 1_555 175.1 ? 12 NA ? C HEC . ? A HEC 302 ? 1_555 FE ? C HEC . ? A HEC 302 ? 1_555 NE2 ? A HIS 107 ? A HIS 107 ? 1_555 90.5 ? 13 NB ? C HEC . ? A HEC 302 ? 1_555 FE ? C HEC . ? A HEC 302 ? 1_555 NE2 ? A HIS 107 ? A HIS 107 ? 1_555 95.4 ? 14 NC ? C HEC . ? A HEC 302 ? 1_555 FE ? C HEC . ? A HEC 302 ? 1_555 NE2 ? A HIS 107 ? A HIS 107 ? 1_555 91.9 ? 15 ND ? C HEC . ? A HEC 302 ? 1_555 FE ? C HEC . ? A HEC 302 ? 1_555 NE2 ? A HIS 107 ? A HIS 107 ? 1_555 86.4 ? 16 NE2 ? A HIS 55 ? A HIS 55 ? 1_555 FE ? B HEC . ? A HEC 301 ? 1_555 NA ? B HEC . ? A HEC 301 ? 1_555 89.4 ? 17 NE2 ? A HIS 55 ? A HIS 55 ? 1_555 FE ? B HEC . ? A HEC 301 ? 1_555 NB ? B HEC . ? A HEC 301 ? 1_555 108.2 ? 18 NA ? B HEC . ? A HEC 301 ? 1_555 FE ? B HEC . ? A HEC 301 ? 1_555 NB ? B HEC . ? A HEC 301 ? 1_555 91.1 ? 19 NE2 ? A HIS 55 ? A HIS 55 ? 1_555 FE ? B HEC . ? A HEC 301 ? 1_555 NC ? B HEC . ? A HEC 301 ? 1_555 90.1 ? 20 NA ? B HEC . ? A HEC 301 ? 1_555 FE ? B HEC . ? A HEC 301 ? 1_555 NC ? B HEC . ? A HEC 301 ? 1_555 178.2 ? 21 NB ? B HEC . ? A HEC 301 ? 1_555 FE ? B HEC . ? A HEC 301 ? 1_555 NC ? B HEC . ? A HEC 301 ? 1_555 87.4 ? 22 NE2 ? A HIS 55 ? A HIS 55 ? 1_555 FE ? B HEC . ? A HEC 301 ? 1_555 ND ? B HEC . ? A HEC 301 ? 1_555 70.4 ? 23 NA ? B HEC . ? A HEC 301 ? 1_555 FE ? B HEC . ? A HEC 301 ? 1_555 ND ? B HEC . ? A HEC 301 ? 1_555 89.5 ? 24 NB ? B HEC . ? A HEC 301 ? 1_555 FE ? B HEC . ? A HEC 301 ? 1_555 ND ? B HEC . ? A HEC 301 ? 1_555 178.4 ? 25 NC ? B HEC . ? A HEC 301 ? 1_555 FE ? B HEC . ? A HEC 301 ? 1_555 ND ? B HEC . ? A HEC 301 ? 1_555 91.9 ? 26 NE2 ? A HIS 55 ? A HIS 55 ? 1_555 FE ? B HEC . ? A HEC 301 ? 1_555 NE2 ? A HIS 208 ? A HIS 208 ? 1_555 150.8 ? 27 NA ? B HEC . ? A HEC 301 ? 1_555 FE ? B HEC . ? A HEC 301 ? 1_555 NE2 ? A HIS 208 ? A HIS 208 ? 1_555 95.5 ? 28 NB ? B HEC . ? A HEC 301 ? 1_555 FE ? B HEC . ? A HEC 301 ? 1_555 NE2 ? A HIS 208 ? A HIS 208 ? 1_555 100.5 ? 29 NC ? B HEC . ? A HEC 301 ? 1_555 FE ? B HEC . ? A HEC 301 ? 1_555 NE2 ? A HIS 208 ? A HIS 208 ? 1_555 85.7 ? 30 ND ? B HEC . ? A HEC 301 ? 1_555 FE ? B HEC . ? A HEC 301 ? 1_555 NE2 ? A HIS 208 ? A HIS 208 ? 1_555 80.9 ? 31 NE2 ? A HIS 149 ? A HIS 149 ? 1_555 FE ? E HEC . ? A HEC 304 ? 1_555 NA ? E HEC . ? A HEC 304 ? 1_555 69.7 ? 32 NE2 ? A HIS 149 ? A HIS 149 ? 1_555 FE ? E HEC . ? A HEC 304 ? 1_555 NB ? E HEC . ? A HEC 304 ? 1_555 85.9 ? 33 NA ? E HEC . ? A HEC 304 ? 1_555 FE ? E HEC . ? A HEC 304 ? 1_555 NB ? E HEC . ? A HEC 304 ? 1_555 90.0 ? 34 NE2 ? A HIS 149 ? A HIS 149 ? 1_555 FE ? E HEC . ? A HEC 304 ? 1_555 NC ? E HEC . ? A HEC 304 ? 1_555 106.8 ? 35 NA ? E HEC . ? A HEC 304 ? 1_555 FE ? E HEC . ? A HEC 304 ? 1_555 NC ? E HEC . ? A HEC 304 ? 1_555 176.0 ? 36 NB ? E HEC . ? A HEC 304 ? 1_555 FE ? E HEC . ? A HEC 304 ? 1_555 NC ? E HEC . ? A HEC 304 ? 1_555 87.9 ? 37 NE2 ? A HIS 149 ? A HIS 149 ? 1_555 FE ? E HEC . ? A HEC 304 ? 1_555 ND ? E HEC . ? A HEC 304 ? 1_555 91.5 ? 38 NA ? E HEC . ? A HEC 304 ? 1_555 FE ? E HEC . ? A HEC 304 ? 1_555 ND ? E HEC . ? A HEC 304 ? 1_555 91.6 ? 39 NB ? E HEC . ? A HEC 304 ? 1_555 FE ? E HEC . ? A HEC 304 ? 1_555 ND ? E HEC . ? A HEC 304 ? 1_555 176.3 ? 40 NC ? E HEC . ? A HEC 304 ? 1_555 FE ? E HEC . ? A HEC 304 ? 1_555 ND ? E HEC . ? A HEC 304 ? 1_555 90.3 ? 41 NE2 ? A HIS 149 ? A HIS 149 ? 1_555 FE ? E HEC . ? A HEC 304 ? 1_555 NE2 ? A HIS 230 ? A HIS 230 ? 1_555 154.1 ? 42 NA ? E HEC . ? A HEC 304 ? 1_555 FE ? E HEC . ? A HEC 304 ? 1_555 NE2 ? A HIS 230 ? A HIS 230 ? 1_555 85.3 ? 43 NB ? E HEC . ? A HEC 304 ? 1_555 FE ? E HEC . ? A HEC 304 ? 1_555 NE2 ? A HIS 230 ? A HIS 230 ? 1_555 101.2 ? 44 NC ? E HEC . ? A HEC 304 ? 1_555 FE ? E HEC . ? A HEC 304 ? 1_555 NE2 ? A HIS 230 ? A HIS 230 ? 1_555 98.4 ? 45 ND ? E HEC . ? A HEC 304 ? 1_555 FE ? E HEC . ? A HEC 304 ? 1_555 NE2 ? A HIS 230 ? A HIS 230 ? 1_555 82.4 ? 46 NE2 ? A HIS 205 ? A HIS 205 ? 1_555 FE ? D HEC . ? A HEC 303 ? 1_555 NA ? D HEC . ? A HEC 303 ? 1_555 82.4 ? 47 NE2 ? A HIS 205 ? A HIS 205 ? 1_555 FE ? D HEC . ? A HEC 303 ? 1_555 NB ? D HEC . ? A HEC 303 ? 1_555 91.1 ? 48 NA ? D HEC . ? A HEC 303 ? 1_555 FE ? D HEC . ? A HEC 303 ? 1_555 NB ? D HEC . ? A HEC 303 ? 1_555 89.6 ? 49 NE2 ? A HIS 205 ? A HIS 205 ? 1_555 FE ? D HEC . ? A HEC 303 ? 1_555 NC ? D HEC . ? A HEC 303 ? 1_555 98.5 ? 50 NA ? D HEC . ? A HEC 303 ? 1_555 FE ? D HEC . ? A HEC 303 ? 1_555 NC ? D HEC . ? A HEC 303 ? 1_555 178.7 ? 51 NB ? D HEC . ? A HEC 303 ? 1_555 FE ? D HEC . ? A HEC 303 ? 1_555 NC ? D HEC . ? A HEC 303 ? 1_555 89.4 ? 52 NE2 ? A HIS 205 ? A HIS 205 ? 1_555 FE ? D HEC . ? A HEC 303 ? 1_555 ND ? D HEC . ? A HEC 303 ? 1_555 90.1 ? 53 NA ? D HEC . ? A HEC 303 ? 1_555 FE ? D HEC . ? A HEC 303 ? 1_555 ND ? D HEC . ? A HEC 303 ? 1_555 90.7 ? 54 NB ? D HEC . ? A HEC 303 ? 1_555 FE ? D HEC . ? A HEC 303 ? 1_555 ND ? D HEC . ? A HEC 303 ? 1_555 178.8 ? 55 NC ? D HEC . ? A HEC 303 ? 1_555 FE ? D HEC . ? A HEC 303 ? 1_555 ND ? D HEC . ? A HEC 303 ? 1_555 90.3 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 HEC B . ? CYS A 54 ? HEC A 301 ? 1_555 CYS A 54 ? 1_555 CAC SG CYS 3 HEC None Heme/heme-like 2 HEC C . ? CYS A 103 ? HEC A 302 ? 1_555 CYS A 103 ? 1_555 CAB SG CYS 2 HEC None Heme/heme-like 3 HEC D . ? CYS A 201 ? HEC A 303 ? 1_555 CYS A 201 ? 1_555 CAB SG CYS 2 HEC None Heme/heme-like 4 HEC E . ? CYS A 226 ? HEC A 304 ? 1_555 CYS A 226 ? 1_555 CAB SG CYS 2 HEC None Heme/heme-like 5 HEC E . ? CYS A 229 ? HEC A 304 ? 1_555 CYS A 229 ? 1_555 CAC SG CYS 3 HEC None Heme/heme-like # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ASN 174 A . ? ASN 174 A PRO 175 A ? PRO 175 A 1 -3.32 2 ALA 213 A . ? ALA 213 A PRO 214 A ? PRO 214 A 1 3.61 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 153 ? GLU A 154 ? PHE A 153 GLU A 154 AA1 2 THR A 198 ? LEU A 199 ? THR A 198 LEU A 199 AA2 1 ALA A 168 ? ASP A 170 ? ALA A 168 ASP A 170 AA2 2 THR A 177 ? LYS A 179 ? THR A 177 LYS A 179 AA2 3 LEU A 187 ? PRO A 188 ? LEU A 187 PRO A 188 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 153 ? N PHE A 153 O LEU A 199 ? O LEU A 199 AA2 1 2 N ASP A 170 ? N ASP A 170 O THR A 177 ? O THR A 177 AA2 2 3 N MET A 178 ? N MET A 178 O LEU A 187 ? O LEU A 187 # _pdbx_entry_details.entry_id 7TFS _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 CD2 A LEU 166 ? ? O1D A HEC 304 ? ? 1.37 2 1 SG A CYS 54 ? ? C3C A HEC 301 ? ? 1.98 3 1 SG A CYS 204 ? ? CAC A HEC 303 ? ? 2.05 4 1 CD1 A LEU 187 ? ? CAC A HEC 304 ? ? 2.08 5 1 SG A CYS 106 ? ? CAC A HEC 302 ? ? 2.08 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 C _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ALA _pdbx_validate_rmsd_angle.auth_seq_id_1 213 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 N _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 PRO _pdbx_validate_rmsd_angle.auth_seq_id_2 214 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CD _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 PRO _pdbx_validate_rmsd_angle.auth_seq_id_3 214 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 104.12 _pdbx_validate_rmsd_angle.angle_target_value 120.60 _pdbx_validate_rmsd_angle.angle_deviation -16.48 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.20 _pdbx_validate_rmsd_angle.linker_flag Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 63 ? ? -87.92 48.71 2 1 PRO A 65 ? ? -50.08 109.65 3 1 LEU A 166 ? ? -91.76 50.61 4 1 ASN A 185 ? ? 70.22 -5.56 5 1 ASN A 210 ? ? -99.47 31.11 6 1 PHE A 215 ? ? 73.63 42.40 7 1 SER A 223 ? ? 59.62 17.79 8 1 HIS A 230 ? ? -94.14 59.78 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 ILE _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 64 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 PRO _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 65 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -143.18 # _pdbx_helical_symmetry.entry_id 7TFS _pdbx_helical_symmetry.number_of_operations 7 _pdbx_helical_symmetry.rotation_per_n_subunits 58.812000 _pdbx_helical_symmetry.rise_per_n_subunits 33.900000 _pdbx_helical_symmetry.n_subunits_divisor 1 _pdbx_helical_symmetry.dyad_axis no _pdbx_helical_symmetry.circular_symmetry 1 # _em_3d_fitting.entry_id 7TFS _em_3d_fitting.id 1 _em_3d_fitting.details ? _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_protocol ? _em_3d_fitting.ref_space ? _em_3d_fitting.target_criteria ? _em_3d_fitting.method ? # _em_3d_reconstruction.entry_id 7TFS _em_3d_reconstruction.id 1 _em_3d_reconstruction.algorithm ? _em_3d_reconstruction.details ? _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.num_particles 346826 _em_3d_reconstruction.resolution 4.3 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.symmetry_type HELICAL _em_3d_reconstruction.method ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.magnification_calibration ? # _em_buffer.id 1 _em_buffer.details ? _em_buffer.pH 6 _em_buffer.specimen_id 1 _em_buffer.name ? # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.details ? _em_entity_assembly.name 'Filament of OmcE protein' _em_entity_assembly.source NATURAL _em_entity_assembly.type COMPLEX _em_entity_assembly.entity_id_list 1 _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? # _em_imaging.id 1 _em_imaging.entry_id 7TFS _em_imaging.accelerating_voltage 300 _em_imaging.alignment_procedure ? _em_imaging.c2_aperture_diameter ? _em_imaging.calibrated_defocus_max ? _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_magnification ? _em_imaging.cryogen ? _em_imaging.details ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.microscope_model 'FEI TITAN KRIOS' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs ? _em_imaging.nominal_defocus_max 3000 _em_imaging.nominal_defocus_min 1000 _em_imaging.nominal_magnification ? _em_imaging.recording_temperature_maximum ? _em_imaging.recording_temperature_minimum ? _em_imaging.residual_tilt ? _em_imaging.specimen_holder_model ? _em_imaging.specimen_id 1 _em_imaging.citation_id ? _em_imaging.date ? _em_imaging.temperature ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.astigmatism ? _em_imaging.detector_distance ? _em_imaging.electron_beam_tilt_params ? _em_imaging.specimen_holder_type ? # _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.chamber_temperature ? _em_vitrification.cryogen_name ETHANE _em_vitrification.details ? _em_vitrification.humidity ? _em_vitrification.instrument ? _em_vitrification.entry_id 7TFS _em_vitrification.citation_id ? _em_vitrification.method ? _em_vitrification.temp ? _em_vitrification.time_resolved_state ? # _em_experiment.entry_id 7TFS _em_experiment.id 1 _em_experiment.aggregation_state FILAMENT _em_experiment.reconstruction_method HELICAL _em_experiment.entity_assembly_id 1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ARG 2 ? A ARG 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A GLU 4 ? A GLU 4 5 1 Y 1 A VAL 5 ? A VAL 5 6 1 Y 1 A LYS 6 ? A LYS 6 7 1 Y 1 A ILE 7 ? A ILE 7 8 1 Y 1 A GLY 8 ? A GLY 8 9 1 Y 1 A LEU 9 ? A LEU 9 10 1 Y 1 A ALA 10 ? A ALA 10 11 1 Y 1 A LEU 11 ? A LEU 11 12 1 Y 1 A THR 12 ? A THR 12 13 1 Y 1 A ALA 13 ? A ALA 13 14 1 Y 1 A LEU 14 ? A LEU 14 15 1 Y 1 A LEU 15 ? A LEU 15 16 1 Y 1 A VAL 16 ? A VAL 16 17 1 Y 1 A ALA 17 ? A ALA 17 18 1 Y 1 A VAL 18 ? A VAL 18 19 1 Y 1 A THR 19 ? A THR 19 20 1 Y 1 A ALA 20 ? A ALA 20 21 1 Y 1 A ALA 21 ? A ALA 21 22 1 Y 1 A GLY 22 ? A GLY 22 23 1 Y 1 A ALA 23 ? A ALA 23 24 1 Y 1 A ALA 24 ? A ALA 24 25 1 Y 1 A SER 25 ? A SER 25 26 1 Y 1 A ILE 26 ? A ILE 26 27 1 Y 1 A LYS 27 ? A LYS 27 28 1 Y 1 A ASN 28 ? A ASN 28 29 1 Y 1 A THR 29 ? A THR 29 30 1 Y 1 A LYS 232 ? A LYS 232 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HEC FE FE N N 137 HEC CHA C N N 138 HEC CHB C N N 139 HEC CHC C N N 140 HEC CHD C N N 141 HEC NA N Y N 142 HEC C1A C Y N 143 HEC C2A C Y N 144 HEC C3A C Y N 145 HEC C4A C Y N 146 HEC CMA C N N 147 HEC CAA C N N 148 HEC CBA C N N 149 HEC CGA C N N 150 HEC O1A O N N 151 HEC O2A O N N 152 HEC NB N Y N 153 HEC C1B C Y N 154 HEC C2B C Y N 155 HEC C3B C Y N 156 HEC C4B C Y N 157 HEC CMB C N N 158 HEC CAB C N N 159 HEC CBB C N N 160 HEC NC N Y N 161 HEC C1C C Y N 162 HEC C2C C Y N 163 HEC C3C C Y N 164 HEC C4C C Y N 165 HEC CMC C N N 166 HEC CAC C N N 167 HEC CBC C N N 168 HEC ND N Y N 169 HEC C1D C Y N 170 HEC C2D C Y N 171 HEC C3D C Y N 172 HEC C4D C Y N 173 HEC CMD C N N 174 HEC CAD C N N 175 HEC CBD C N N 176 HEC CGD C N N 177 HEC O1D O N N 178 HEC O2D O N N 179 HEC HHA H N N 180 HEC HHB H N N 181 HEC HHC H N N 182 HEC HHD H N N 183 HEC HMA1 H N N 184 HEC HMA2 H N N 185 HEC HMA3 H N N 186 HEC HAA1 H N N 187 HEC HAA2 H N N 188 HEC HBA1 H N N 189 HEC HBA2 H N N 190 HEC H2A H N N 191 HEC HMB1 H N N 192 HEC HMB2 H N N 193 HEC HMB3 H N N 194 HEC HAB H N N 195 HEC HBB1 H N N 196 HEC HBB2 H N N 197 HEC HBB3 H N N 198 HEC HMC1 H N N 199 HEC HMC2 H N N 200 HEC HMC3 H N N 201 HEC HAC H N N 202 HEC HBC1 H N N 203 HEC HBC2 H N N 204 HEC HBC3 H N N 205 HEC HMD1 H N N 206 HEC HMD2 H N N 207 HEC HMD3 H N N 208 HEC HAD1 H N N 209 HEC HAD2 H N N 210 HEC HBD1 H N N 211 HEC HBD2 H N N 212 HEC H2D H N N 213 HIS N N N N 214 HIS CA C N S 215 HIS C C N N 216 HIS O O N N 217 HIS CB C N N 218 HIS CG C Y N 219 HIS ND1 N Y N 220 HIS CD2 C Y N 221 HIS CE1 C Y N 222 HIS NE2 N Y N 223 HIS OXT O N N 224 HIS H H N N 225 HIS H2 H N N 226 HIS HA H N N 227 HIS HB2 H N N 228 HIS HB3 H N N 229 HIS HD1 H N N 230 HIS HD2 H N N 231 HIS HE1 H N N 232 HIS HE2 H N N 233 HIS HXT H N N 234 ILE N N N N 235 ILE CA C N S 236 ILE C C N N 237 ILE O O N N 238 ILE CB C N S 239 ILE CG1 C N N 240 ILE CG2 C N N 241 ILE CD1 C N N 242 ILE OXT O N N 243 ILE H H N N 244 ILE H2 H N N 245 ILE HA H N N 246 ILE HB H N N 247 ILE HG12 H N N 248 ILE HG13 H N N 249 ILE HG21 H N N 250 ILE HG22 H N N 251 ILE HG23 H N N 252 ILE HD11 H N N 253 ILE HD12 H N N 254 ILE HD13 H N N 255 ILE HXT H N N 256 LEU N N N N 257 LEU CA C N S 258 LEU C C N N 259 LEU O O N N 260 LEU CB C N N 261 LEU CG C N N 262 LEU CD1 C N N 263 LEU CD2 C N N 264 LEU OXT O N N 265 LEU H H N N 266 LEU H2 H N N 267 LEU HA H N N 268 LEU HB2 H N N 269 LEU HB3 H N N 270 LEU HG H N N 271 LEU HD11 H N N 272 LEU HD12 H N N 273 LEU HD13 H N N 274 LEU HD21 H N N 275 LEU HD22 H N N 276 LEU HD23 H N N 277 LEU HXT H N N 278 LYS N N N N 279 LYS CA C N S 280 LYS C C N N 281 LYS O O N N 282 LYS CB C N N 283 LYS CG C N N 284 LYS CD C N N 285 LYS CE C N N 286 LYS NZ N N N 287 LYS OXT O N N 288 LYS H H N N 289 LYS H2 H N N 290 LYS HA H N N 291 LYS HB2 H N N 292 LYS HB3 H N N 293 LYS HG2 H N N 294 LYS HG3 H N N 295 LYS HD2 H N N 296 LYS HD3 H N N 297 LYS HE2 H N N 298 LYS HE3 H N N 299 LYS HZ1 H N N 300 LYS HZ2 H N N 301 LYS HZ3 H N N 302 LYS HXT H N N 303 MET N N N N 304 MET CA C N S 305 MET C C N N 306 MET O O N N 307 MET CB C N N 308 MET CG C N N 309 MET SD S N N 310 MET CE C N N 311 MET OXT O N N 312 MET H H N N 313 MET H2 H N N 314 MET HA H N N 315 MET HB2 H N N 316 MET HB3 H N N 317 MET HG2 H N N 318 MET HG3 H N N 319 MET HE1 H N N 320 MET HE2 H N N 321 MET HE3 H N N 322 MET HXT H N N 323 PHE N N N N 324 PHE CA C N S 325 PHE C C N N 326 PHE O O N N 327 PHE CB C N N 328 PHE CG C Y N 329 PHE CD1 C Y N 330 PHE CD2 C Y N 331 PHE CE1 C Y N 332 PHE CE2 C Y N 333 PHE CZ C Y N 334 PHE OXT O N N 335 PHE H H N N 336 PHE H2 H N N 337 PHE HA H N N 338 PHE HB2 H N N 339 PHE HB3 H N N 340 PHE HD1 H N N 341 PHE HD2 H N N 342 PHE HE1 H N N 343 PHE HE2 H N N 344 PHE HZ H N N 345 PHE HXT H N N 346 PRO N N N N 347 PRO CA C N S 348 PRO C C N N 349 PRO O O N N 350 PRO CB C N N 351 PRO CG C N N 352 PRO CD C N N 353 PRO OXT O N N 354 PRO H H N N 355 PRO HA H N N 356 PRO HB2 H N N 357 PRO HB3 H N N 358 PRO HG2 H N N 359 PRO HG3 H N N 360 PRO HD2 H N N 361 PRO HD3 H N N 362 PRO HXT H N N 363 SER N N N N 364 SER CA C N S 365 SER C C N N 366 SER O O N N 367 SER CB C N N 368 SER OG O N N 369 SER OXT O N N 370 SER H H N N 371 SER H2 H N N 372 SER HA H N N 373 SER HB2 H N N 374 SER HB3 H N N 375 SER HG H N N 376 SER HXT H N N 377 THR N N N N 378 THR CA C N S 379 THR C C N N 380 THR O O N N 381 THR CB C N R 382 THR OG1 O N N 383 THR CG2 C N N 384 THR OXT O N N 385 THR H H N N 386 THR H2 H N N 387 THR HA H N N 388 THR HB H N N 389 THR HG1 H N N 390 THR HG21 H N N 391 THR HG22 H N N 392 THR HG23 H N N 393 THR HXT H N N 394 TRP N N N N 395 TRP CA C N S 396 TRP C C N N 397 TRP O O N N 398 TRP CB C N N 399 TRP CG C Y N 400 TRP CD1 C Y N 401 TRP CD2 C Y N 402 TRP NE1 N Y N 403 TRP CE2 C Y N 404 TRP CE3 C Y N 405 TRP CZ2 C Y N 406 TRP CZ3 C Y N 407 TRP CH2 C Y N 408 TRP OXT O N N 409 TRP H H N N 410 TRP H2 H N N 411 TRP HA H N N 412 TRP HB2 H N N 413 TRP HB3 H N N 414 TRP HD1 H N N 415 TRP HE1 H N N 416 TRP HE3 H N N 417 TRP HZ2 H N N 418 TRP HZ3 H N N 419 TRP HH2 H N N 420 TRP HXT H N N 421 TYR N N N N 422 TYR CA C N S 423 TYR C C N N 424 TYR O O N N 425 TYR CB C N N 426 TYR CG C Y N 427 TYR CD1 C Y N 428 TYR CD2 C Y N 429 TYR CE1 C Y N 430 TYR CE2 C Y N 431 TYR CZ C Y N 432 TYR OH O N N 433 TYR OXT O N N 434 TYR H H N N 435 TYR H2 H N N 436 TYR HA H N N 437 TYR HB2 H N N 438 TYR HB3 H N N 439 TYR HD1 H N N 440 TYR HD2 H N N 441 TYR HE1 H N N 442 TYR HE2 H N N 443 TYR HH H N N 444 TYR HXT H N N 445 VAL N N N N 446 VAL CA C N S 447 VAL C C N N 448 VAL O O N N 449 VAL CB C N N 450 VAL CG1 C N N 451 VAL CG2 C N N 452 VAL OXT O N N 453 VAL H H N N 454 VAL H2 H N N 455 VAL HA H N N 456 VAL HB H N N 457 VAL HG11 H N N 458 VAL HG12 H N N 459 VAL HG13 H N N 460 VAL HG21 H N N 461 VAL HG22 H N N 462 VAL HG23 H N N 463 VAL HXT H N N 464 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HEC FE NA sing N N 129 HEC FE NB sing N N 130 HEC FE NC sing N N 131 HEC FE ND sing N N 132 HEC CHA C1A doub N N 133 HEC CHA C4D sing N N 134 HEC CHA HHA sing N N 135 HEC CHB C4A doub N N 136 HEC CHB C1B sing N N 137 HEC CHB HHB sing N N 138 HEC CHC C4B doub N N 139 HEC CHC C1C sing N N 140 HEC CHC HHC sing N N 141 HEC CHD C4C doub N N 142 HEC CHD C1D sing N N 143 HEC CHD HHD sing N N 144 HEC NA C1A sing Y N 145 HEC NA C4A sing Y N 146 HEC C1A C2A sing Y N 147 HEC C2A C3A doub Y N 148 HEC C2A CAA sing N N 149 HEC C3A C4A sing Y N 150 HEC C3A CMA sing N N 151 HEC CMA HMA1 sing N N 152 HEC CMA HMA2 sing N N 153 HEC CMA HMA3 sing N N 154 HEC CAA CBA sing N N 155 HEC CAA HAA1 sing N N 156 HEC CAA HAA2 sing N N 157 HEC CBA CGA sing N N 158 HEC CBA HBA1 sing N N 159 HEC CBA HBA2 sing N N 160 HEC CGA O1A doub N N 161 HEC CGA O2A sing N N 162 HEC O2A H2A sing N N 163 HEC NB C1B sing Y N 164 HEC NB C4B sing Y N 165 HEC C1B C2B doub Y N 166 HEC C2B C3B sing Y N 167 HEC C2B CMB sing N N 168 HEC C3B C4B sing Y N 169 HEC C3B CAB doub N E 170 HEC CMB HMB1 sing N N 171 HEC CMB HMB2 sing N N 172 HEC CMB HMB3 sing N N 173 HEC CAB CBB sing N N 174 HEC CAB HAB sing N N 175 HEC CBB HBB1 sing N N 176 HEC CBB HBB2 sing N N 177 HEC CBB HBB3 sing N N 178 HEC NC C1C sing Y N 179 HEC NC C4C sing Y N 180 HEC C1C C2C doub Y N 181 HEC C2C C3C sing Y N 182 HEC C2C CMC sing N N 183 HEC C3C C4C sing Y N 184 HEC C3C CAC doub N E 185 HEC CMC HMC1 sing N N 186 HEC CMC HMC2 sing N N 187 HEC CMC HMC3 sing N N 188 HEC CAC CBC sing N N 189 HEC CAC HAC sing N N 190 HEC CBC HBC1 sing N N 191 HEC CBC HBC2 sing N N 192 HEC CBC HBC3 sing N N 193 HEC ND C1D sing Y N 194 HEC ND C4D sing Y N 195 HEC C1D C2D doub Y N 196 HEC C2D C3D sing Y N 197 HEC C2D CMD sing N N 198 HEC C3D C4D doub Y N 199 HEC C3D CAD sing N N 200 HEC CMD HMD1 sing N N 201 HEC CMD HMD2 sing N N 202 HEC CMD HMD3 sing N N 203 HEC CAD CBD sing N N 204 HEC CAD HAD1 sing N N 205 HEC CAD HAD2 sing N N 206 HEC CBD CGD sing N N 207 HEC CBD HBD1 sing N N 208 HEC CBD HBD2 sing N N 209 HEC CGD O1D doub N N 210 HEC CGD O2D sing N N 211 HEC O2D H2D sing N N 212 HIS N CA sing N N 213 HIS N H sing N N 214 HIS N H2 sing N N 215 HIS CA C sing N N 216 HIS CA CB sing N N 217 HIS CA HA sing N N 218 HIS C O doub N N 219 HIS C OXT sing N N 220 HIS CB CG sing N N 221 HIS CB HB2 sing N N 222 HIS CB HB3 sing N N 223 HIS CG ND1 sing Y N 224 HIS CG CD2 doub Y N 225 HIS ND1 CE1 doub Y N 226 HIS ND1 HD1 sing N N 227 HIS CD2 NE2 sing Y N 228 HIS CD2 HD2 sing N N 229 HIS CE1 NE2 sing Y N 230 HIS CE1 HE1 sing N N 231 HIS NE2 HE2 sing N N 232 HIS OXT HXT sing N N 233 ILE N CA sing N N 234 ILE N H sing N N 235 ILE N H2 sing N N 236 ILE CA C sing N N 237 ILE CA CB sing N N 238 ILE CA HA sing N N 239 ILE C O doub N N 240 ILE C OXT sing N N 241 ILE CB CG1 sing N N 242 ILE CB CG2 sing N N 243 ILE CB HB sing N N 244 ILE CG1 CD1 sing N N 245 ILE CG1 HG12 sing N N 246 ILE CG1 HG13 sing N N 247 ILE CG2 HG21 sing N N 248 ILE CG2 HG22 sing N N 249 ILE CG2 HG23 sing N N 250 ILE CD1 HD11 sing N N 251 ILE CD1 HD12 sing N N 252 ILE CD1 HD13 sing N N 253 ILE OXT HXT sing N N 254 LEU N CA sing N N 255 LEU N H sing N N 256 LEU N H2 sing N N 257 LEU CA C sing N N 258 LEU CA CB sing N N 259 LEU CA HA sing N N 260 LEU C O doub N N 261 LEU C OXT sing N N 262 LEU CB CG sing N N 263 LEU CB HB2 sing N N 264 LEU CB HB3 sing N N 265 LEU CG CD1 sing N N 266 LEU CG CD2 sing N N 267 LEU CG HG sing N N 268 LEU CD1 HD11 sing N N 269 LEU CD1 HD12 sing N N 270 LEU CD1 HD13 sing N N 271 LEU CD2 HD21 sing N N 272 LEU CD2 HD22 sing N N 273 LEU CD2 HD23 sing N N 274 LEU OXT HXT sing N N 275 LYS N CA sing N N 276 LYS N H sing N N 277 LYS N H2 sing N N 278 LYS CA C sing N N 279 LYS CA CB sing N N 280 LYS CA HA sing N N 281 LYS C O doub N N 282 LYS C OXT sing N N 283 LYS CB CG sing N N 284 LYS CB HB2 sing N N 285 LYS CB HB3 sing N N 286 LYS CG CD sing N N 287 LYS CG HG2 sing N N 288 LYS CG HG3 sing N N 289 LYS CD CE sing N N 290 LYS CD HD2 sing N N 291 LYS CD HD3 sing N N 292 LYS CE NZ sing N N 293 LYS CE HE2 sing N N 294 LYS CE HE3 sing N N 295 LYS NZ HZ1 sing N N 296 LYS NZ HZ2 sing N N 297 LYS NZ HZ3 sing N N 298 LYS OXT HXT sing N N 299 MET N CA sing N N 300 MET N H sing N N 301 MET N H2 sing N N 302 MET CA C sing N N 303 MET CA CB sing N N 304 MET CA HA sing N N 305 MET C O doub N N 306 MET C OXT sing N N 307 MET CB CG sing N N 308 MET CB HB2 sing N N 309 MET CB HB3 sing N N 310 MET CG SD sing N N 311 MET CG HG2 sing N N 312 MET CG HG3 sing N N 313 MET SD CE sing N N 314 MET CE HE1 sing N N 315 MET CE HE2 sing N N 316 MET CE HE3 sing N N 317 MET OXT HXT sing N N 318 PHE N CA sing N N 319 PHE N H sing N N 320 PHE N H2 sing N N 321 PHE CA C sing N N 322 PHE CA CB sing N N 323 PHE CA HA sing N N 324 PHE C O doub N N 325 PHE C OXT sing N N 326 PHE CB CG sing N N 327 PHE CB HB2 sing N N 328 PHE CB HB3 sing N N 329 PHE CG CD1 doub Y N 330 PHE CG CD2 sing Y N 331 PHE CD1 CE1 sing Y N 332 PHE CD1 HD1 sing N N 333 PHE CD2 CE2 doub Y N 334 PHE CD2 HD2 sing N N 335 PHE CE1 CZ doub Y N 336 PHE CE1 HE1 sing N N 337 PHE CE2 CZ sing Y N 338 PHE CE2 HE2 sing N N 339 PHE CZ HZ sing N N 340 PHE OXT HXT sing N N 341 PRO N CA sing N N 342 PRO N CD sing N N 343 PRO N H sing N N 344 PRO CA C sing N N 345 PRO CA CB sing N N 346 PRO CA HA sing N N 347 PRO C O doub N N 348 PRO C OXT sing N N 349 PRO CB CG sing N N 350 PRO CB HB2 sing N N 351 PRO CB HB3 sing N N 352 PRO CG CD sing N N 353 PRO CG HG2 sing N N 354 PRO CG HG3 sing N N 355 PRO CD HD2 sing N N 356 PRO CD HD3 sing N N 357 PRO OXT HXT sing N N 358 SER N CA sing N N 359 SER N H sing N N 360 SER N H2 sing N N 361 SER CA C sing N N 362 SER CA CB sing N N 363 SER CA HA sing N N 364 SER C O doub N N 365 SER C OXT sing N N 366 SER CB OG sing N N 367 SER CB HB2 sing N N 368 SER CB HB3 sing N N 369 SER OG HG sing N N 370 SER OXT HXT sing N N 371 THR N CA sing N N 372 THR N H sing N N 373 THR N H2 sing N N 374 THR CA C sing N N 375 THR CA CB sing N N 376 THR CA HA sing N N 377 THR C O doub N N 378 THR C OXT sing N N 379 THR CB OG1 sing N N 380 THR CB CG2 sing N N 381 THR CB HB sing N N 382 THR OG1 HG1 sing N N 383 THR CG2 HG21 sing N N 384 THR CG2 HG22 sing N N 385 THR CG2 HG23 sing N N 386 THR OXT HXT sing N N 387 TRP N CA sing N N 388 TRP N H sing N N 389 TRP N H2 sing N N 390 TRP CA C sing N N 391 TRP CA CB sing N N 392 TRP CA HA sing N N 393 TRP C O doub N N 394 TRP C OXT sing N N 395 TRP CB CG sing N N 396 TRP CB HB2 sing N N 397 TRP CB HB3 sing N N 398 TRP CG CD1 doub Y N 399 TRP CG CD2 sing Y N 400 TRP CD1 NE1 sing Y N 401 TRP CD1 HD1 sing N N 402 TRP CD2 CE2 doub Y N 403 TRP CD2 CE3 sing Y N 404 TRP NE1 CE2 sing Y N 405 TRP NE1 HE1 sing N N 406 TRP CE2 CZ2 sing Y N 407 TRP CE3 CZ3 doub Y N 408 TRP CE3 HE3 sing N N 409 TRP CZ2 CH2 doub Y N 410 TRP CZ2 HZ2 sing N N 411 TRP CZ3 CH2 sing Y N 412 TRP CZ3 HZ3 sing N N 413 TRP CH2 HH2 sing N N 414 TRP OXT HXT sing N N 415 TYR N CA sing N N 416 TYR N H sing N N 417 TYR N H2 sing N N 418 TYR CA C sing N N 419 TYR CA CB sing N N 420 TYR CA HA sing N N 421 TYR C O doub N N 422 TYR C OXT sing N N 423 TYR CB CG sing N N 424 TYR CB HB2 sing N N 425 TYR CB HB3 sing N N 426 TYR CG CD1 doub Y N 427 TYR CG CD2 sing Y N 428 TYR CD1 CE1 sing Y N 429 TYR CD1 HD1 sing N N 430 TYR CD2 CE2 doub Y N 431 TYR CD2 HD2 sing N N 432 TYR CE1 CZ doub Y N 433 TYR CE1 HE1 sing N N 434 TYR CE2 CZ sing Y N 435 TYR CE2 HE2 sing N N 436 TYR CZ OH sing N N 437 TYR OH HH sing N N 438 TYR OXT HXT sing N N 439 VAL N CA sing N N 440 VAL N H sing N N 441 VAL N H2 sing N N 442 VAL CA C sing N N 443 VAL CA CB sing N N 444 VAL CA HA sing N N 445 VAL C O doub N N 446 VAL C OXT sing N N 447 VAL CB CG1 sing N N 448 VAL CB CG2 sing N N 449 VAL CB HB sing N N 450 VAL CG1 HG11 sing N N 451 VAL CG1 HG12 sing N N 452 VAL CG1 HG13 sing N N 453 VAL CG2 HG21 sing N N 454 VAL CG2 HG22 sing N N 455 VAL CG2 HG23 sing N N 456 VAL OXT HXT sing N N 457 # _em_admin.entry_id 7TFS _em_admin.current_status REL _em_admin.deposition_date 2022-01-07 _em_admin.deposition_site RCSB _em_admin.last_update 2025-05-14 _em_admin.map_release_date 2022-05-04 _em_admin.title 'Cryo-EM of the OmcE nanowires from Geobacter sulfurreducens' # _em_ctf_correction.id 1 _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.type 'PHASE FLIPPING AND AMPLITUDE CORRECTION' _em_ctf_correction.details ? # _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.ncbi_tax_id 35554 _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organism 'Geobacter sulfurreducens' _em_entity_assembly_naturalsource.strain 'ATCC 51573 / DSM 12127 / PCA' _em_entity_assembly_naturalsource.tissue ? # _em_helical_entity.id 1 _em_helical_entity.image_processing_id 1 _em_helical_entity.angular_rotation_per_subunit 58.8 _em_helical_entity.axial_rise_per_subunit 33.9 _em_helical_entity.axial_symmetry C1 _em_helical_entity.details ? # _em_image_processing.id 1 _em_image_processing.image_recording_id 1 _em_image_processing.details ? # _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.avg_electron_dose_per_image 50 _em_image_recording.average_exposure_time ? _em_image_recording.details ? _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model 'GATAN K3 (6k x 4k)' _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? _em_image_recording.avg_electron_dose_per_subtomogram ? # loop_ _em_software.id _em_software.category _em_software.details _em_software.name _em_software.version _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id 1 'PARTICLE SELECTION' ? ? ? 1 ? ? 2 'IMAGE ACQUISITION' ? ? ? ? ? 1 3 MASKING ? ? ? ? ? ? 4 'CTF CORRECTION' ? ? ? 1 ? ? 5 'LAYERLINE INDEXING' ? ? ? ? ? ? 6 'DIFFRACTION INDEXING' ? ? ? ? ? ? 7 'MODEL FITTING' ? ? ? ? ? ? 8 'MODEL REFINEMENT' ? PHENIX ? ? ? ? 9 OTHER ? ? ? ? ? ? 10 'INITIAL EULER ASSIGNMENT' ? ? ? 1 ? ? 11 'FINAL EULER ASSIGNMENT' ? ? ? 1 ? ? 12 CLASSIFICATION ? ? ? 1 ? ? 13 RECONSTRUCTION ? ? ? 1 ? ? # _em_specimen.id 1 _em_specimen.experiment_id 1 _em_specimen.concentration ? _em_specimen.details ? _em_specimen.embedding_applied NO _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' R35GM122510 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' K99GM138756 2 # _atom_sites.entry_id 7TFS _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C FE N O S # loop_ #