data_7TGQ # _entry.id 7TGQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7TGQ pdb_00007tgq 10.2210/pdb7tgq/pdb WWPDB D_1000262266 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'Unbound structure' _pdbx_database_related.db_id 7KZH _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7TGQ _pdbx_database_status.recvd_initial_deposition_date 2022-01-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _audit_author.name 'Pornillos, O.P.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Plos Pathog.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1553-7374 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 18 _citation.language ? _citation.page_first e1009202 _citation.page_last e1009202 _citation.title 'Poly(ADP-ribose) potentiates ZAP antiviral activity.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1371/journal.ppat.1009202 _citation.pdbx_database_id_PubMed 35130321 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Xue, G.' 1 ? primary 'Braczyk, K.' 2 0000-0003-3574-8644 primary 'Goncalves-Carneiro, D.' 3 ? primary 'Dawidziak, D.M.' 4 0000-0001-7468-5346 primary 'Sanchez, K.' 5 ? primary 'Ong, H.' 6 0000-0002-9651-3892 primary 'Wan, Y.' 7 ? primary 'Zadrozny, K.K.' 8 ? primary 'Ganser-Pornillos, B.K.' 9 ? primary 'Bieniasz, P.D.' 10 ? primary 'Pornillos, O.' 11 0000-0001-9056-5002 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7TGQ _cell.details ? _cell.formula_units_Z ? _cell.length_a 89.958 _cell.length_a_esd ? _cell.length_b 89.958 _cell.length_b_esd ? _cell.length_c 52.807 _cell.length_c_esd ? _cell.volume 370085.194 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7TGQ _symmetry.cell_setting ? _symmetry.Int_Tables_number 150 _symmetry.space_group_name_Hall ;P 3 2" ; _symmetry.space_group_name_H-M 'P 3 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zinc finger CCCH-type antiviral protein 1' 23386.410 1 ? ? 'central domain' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn ADENOSINE-5-DIPHOSPHORIBOSE 559.316 1 ? ? ? ? 4 non-polymer syn 'ACETATE ION' 59.044 2 ? ? ? ? 5 water nat water 18.015 75 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;ADP-ribosyltransferase diphtheria toxin-like 13,ARTD13,Inactive Poly [ADP-ribose] polymerase 13,PARP13,Zinc finger CCCH domain-containing protein 2,Zinc finger antiviral protein,ZAP ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;STTSSRVDDHDSEEICLDHLCKGCPLNGSCSKVHFHLPYRWQMLIGKTWTDFEHMETIEKGYCNPGIHLCSVGSYTINFR VMSCDSFPIRRLSTPSSVTKPANSVFTTKWIWYWKNESGTWIQYGEEKDKRKNSNVDSSYLESLYQSCPRGVVPFQAGSR NYELSFQGMIQTNIASKTQKDVIRRPTFVPQWYVQQMKRGPD ; _entity_poly.pdbx_seq_one_letter_code_can ;STTSSRVDDHDSEEICLDHLCKGCPLNGSCSKVHFHLPYRWQMLIGKTWTDFEHMETIEKGYCNPGIHLCSVGSYTINFR VMSCDSFPIRRLSTPSSVTKPANSVFTTKWIWYWKNESGTWIQYGEEKDKRKNSNVDSSYLESLYQSCPRGVVPFQAGSR NYELSFQGMIQTNIASKTQKDVIRRPTFVPQWYVQQMKRGPD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 THR n 1 3 THR n 1 4 SER n 1 5 SER n 1 6 ARG n 1 7 VAL n 1 8 ASP n 1 9 ASP n 1 10 HIS n 1 11 ASP n 1 12 SER n 1 13 GLU n 1 14 GLU n 1 15 ILE n 1 16 CYS n 1 17 LEU n 1 18 ASP n 1 19 HIS n 1 20 LEU n 1 21 CYS n 1 22 LYS n 1 23 GLY n 1 24 CYS n 1 25 PRO n 1 26 LEU n 1 27 ASN n 1 28 GLY n 1 29 SER n 1 30 CYS n 1 31 SER n 1 32 LYS n 1 33 VAL n 1 34 HIS n 1 35 PHE n 1 36 HIS n 1 37 LEU n 1 38 PRO n 1 39 TYR n 1 40 ARG n 1 41 TRP n 1 42 GLN n 1 43 MET n 1 44 LEU n 1 45 ILE n 1 46 GLY n 1 47 LYS n 1 48 THR n 1 49 TRP n 1 50 THR n 1 51 ASP n 1 52 PHE n 1 53 GLU n 1 54 HIS n 1 55 MET n 1 56 GLU n 1 57 THR n 1 58 ILE n 1 59 GLU n 1 60 LYS n 1 61 GLY n 1 62 TYR n 1 63 CYS n 1 64 ASN n 1 65 PRO n 1 66 GLY n 1 67 ILE n 1 68 HIS n 1 69 LEU n 1 70 CYS n 1 71 SER n 1 72 VAL n 1 73 GLY n 1 74 SER n 1 75 TYR n 1 76 THR n 1 77 ILE n 1 78 ASN n 1 79 PHE n 1 80 ARG n 1 81 VAL n 1 82 MET n 1 83 SER n 1 84 CYS n 1 85 ASP n 1 86 SER n 1 87 PHE n 1 88 PRO n 1 89 ILE n 1 90 ARG n 1 91 ARG n 1 92 LEU n 1 93 SER n 1 94 THR n 1 95 PRO n 1 96 SER n 1 97 SER n 1 98 VAL n 1 99 THR n 1 100 LYS n 1 101 PRO n 1 102 ALA n 1 103 ASN n 1 104 SER n 1 105 VAL n 1 106 PHE n 1 107 THR n 1 108 THR n 1 109 LYS n 1 110 TRP n 1 111 ILE n 1 112 TRP n 1 113 TYR n 1 114 TRP n 1 115 LYS n 1 116 ASN n 1 117 GLU n 1 118 SER n 1 119 GLY n 1 120 THR n 1 121 TRP n 1 122 ILE n 1 123 GLN n 1 124 TYR n 1 125 GLY n 1 126 GLU n 1 127 GLU n 1 128 LYS n 1 129 ASP n 1 130 LYS n 1 131 ARG n 1 132 LYS n 1 133 ASN n 1 134 SER n 1 135 ASN n 1 136 VAL n 1 137 ASP n 1 138 SER n 1 139 SER n 1 140 TYR n 1 141 LEU n 1 142 GLU n 1 143 SER n 1 144 LEU n 1 145 TYR n 1 146 GLN n 1 147 SER n 1 148 CYS n 1 149 PRO n 1 150 ARG n 1 151 GLY n 1 152 VAL n 1 153 VAL n 1 154 PRO n 1 155 PHE n 1 156 GLN n 1 157 ALA n 1 158 GLY n 1 159 SER n 1 160 ARG n 1 161 ASN n 1 162 TYR n 1 163 GLU n 1 164 LEU n 1 165 SER n 1 166 PHE n 1 167 GLN n 1 168 GLY n 1 169 MET n 1 170 ILE n 1 171 GLN n 1 172 THR n 1 173 ASN n 1 174 ILE n 1 175 ALA n 1 176 SER n 1 177 LYS n 1 178 THR n 1 179 GLN n 1 180 LYS n 1 181 ASP n 1 182 VAL n 1 183 ILE n 1 184 ARG n 1 185 ARG n 1 186 PRO n 1 187 THR n 1 188 PHE n 1 189 VAL n 1 190 PRO n 1 191 GLN n 1 192 TRP n 1 193 TYR n 1 194 VAL n 1 195 GLN n 1 196 GLN n 1 197 MET n 1 198 LYS n 1 199 ARG n 1 200 GLY n 1 201 PRO n 1 202 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 202 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ZC3HAV1, ZC3HDC2, PRO1677' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZCCHV_HUMAN _struct_ref.pdbx_db_accession Q7Z2W4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;STTSSRVDDHDSEEICLDHLCKGCPLNGSCSKVHFHLPYRWQMLIGKTWTDFEHMETIEKGYCNPGIHLCSVGSYTINFR VMSCDSFPIRRLSTPSSVTKPANSVFTTKWIWYWKNESGTWIQYGEEKDKRKNSNVDSSYLESLYQSCPRGVVPFQAGSR NYELSFQGMIQTNIASKTQKDVIRRPTFVPQWYVQQMKRGPD ; _struct_ref.pdbx_align_begin 498 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7TGQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 202 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q7Z2W4 _struct_ref_seq.db_align_beg 498 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 699 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 498 _struct_ref_seq.pdbx_auth_seq_align_end 699 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACT non-polymer . 'ACETATE ION' ? 'C2 H3 O2 -1' 59.044 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 APR non-polymer . ADENOSINE-5-DIPHOSPHORIBOSE ? 'C15 H23 N5 O14 P2' 559.316 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7TGQ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.64 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.36 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.8-1.1 M sodium nitrate, 0.1 M sodium acetate' _exptl_crystal_grow.pdbx_pH_range 4.8-6.0 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-11-17 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-BM' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-BM _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 24.12 _reflns.entry_id 7TGQ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.97 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17745 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 21.2 _reflns.pdbx_Rmerge_I_obs 0.111 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 25.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.114 _reflns.pdbx_Rpim_I_all 0.025 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.987 _reflns.pdbx_CC_star 0.997 _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.97 _reflns_shell.d_res_low 2.00 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.1 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 875 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1 _reflns_shell.pdbx_Rpim_I_all 0.592 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.458 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 33.42 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7TGQ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.00 _refine.ls_d_res_low 43.71 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15999 _refine.ls_number_reflns_R_free 843 _refine.ls_number_reflns_R_work 15156 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 90.86 _refine.ls_percent_reflns_R_free 5.27 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2399 _refine.ls_R_factor_R_free 0.2728 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2381 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7KZH _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.6226 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2644 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.00 _refine_hist.d_res_low 43.71 _refine_hist.number_atoms_solvent 75 _refine_hist.number_atoms_total 1566 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1446 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 45 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0141 ? 1534 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.0391 ? 2091 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0626 ? 223 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0078 ? 258 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 6.0240 ? 197 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.00 2.10 . . 82 1218 44.84 . . . 0.3214 . 0.2937 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.10 2.26 . . 132 2746 99.93 . . . 0.2895 . 0.2612 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.26 2.49 . . 145 2774 100.00 . . . 0.3479 . 0.2977 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.49 2.85 . . 165 2738 100.00 . . . 0.3281 . 0.2772 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.85 3.59 . . 168 2780 100.00 . . . 0.2969 . 0.2353 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.59 43.71 . . 151 2900 99.87 . . . 0.2008 . 0.1966 . . . . . . . . . . . # _struct.entry_id 7TGQ _struct.title 'Zinc finger antiviral protein (ZAP) central domain bound to ADP-ribose' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7TGQ _struct_keywords.text 'restriction factor, ANTIVIRAL PROTEIN' _struct_keywords.pdbx_keywords 'ANTIVIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 CYS A 16 ? CYS A 21 ? CYS A 513 CYS A 518 1 ? 6 HELX_P HELX_P2 AA2 LEU A 26 ? CYS A 30 ? LEU A 523 CYS A 527 5 ? 5 HELX_P HELX_P3 AA3 HIS A 54 ? CYS A 63 ? HIS A 551 CYS A 560 1 ? 10 HELX_P HELX_P4 AA4 SER A 96 ? LYS A 100 ? SER A 593 LYS A 597 5 ? 5 HELX_P HELX_P5 AA5 ASP A 137 ? CYS A 148 ? ASP A 634 CYS A 645 1 ? 12 HELX_P HELX_P6 AA6 PRO A 190 ? ARG A 199 ? PRO A 687 ARG A 696 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 16 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 513 A ZN 701 1_555 ? ? ? ? ? ? ? 2.428 ? ? metalc2 metalc ? ? A CYS 24 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 521 A ZN 701 1_555 ? ? ? ? ? ? ? 2.297 ? ? metalc3 metalc ? ? A CYS 30 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 527 A ZN 701 1_555 ? ? ? ? ? ? ? 2.336 ? ? metalc4 metalc ? ? A HIS 34 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 531 A ZN 701 1_555 ? ? ? ? ? ? ? 1.934 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 48 ? ASP A 51 ? THR A 545 ASP A 548 AA1 2 TYR A 39 ? ILE A 45 ? TYR A 536 ILE A 542 AA1 3 PHE A 87 ? SER A 93 ? PHE A 584 SER A 590 AA1 4 SER A 83 ? CYS A 84 ? SER A 580 CYS A 581 AA1 5 TYR A 75 ? ASN A 78 ? TYR A 572 ASN A 575 AA1 6 LEU A 69 ? VAL A 72 ? LEU A 566 VAL A 569 AA2 1 TRP A 121 ? GLN A 123 ? TRP A 618 GLN A 620 AA2 2 TRP A 110 ? LYS A 115 ? TRP A 607 LYS A 612 AA2 3 GLN A 179 ? PRO A 186 ? GLN A 676 PRO A 683 AA2 4 ILE A 170 ? ASN A 173 ? ILE A 667 ASN A 670 AA2 5 ARG A 160 ? SER A 165 ? ARG A 657 SER A 662 AA2 6 VAL A 152 ? ALA A 157 ? VAL A 649 ALA A 654 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O THR A 50 ? O THR A 547 N MET A 43 ? N MET A 540 AA1 2 3 N ARG A 40 ? N ARG A 537 O LEU A 92 ? O LEU A 589 AA1 3 4 O PHE A 87 ? O PHE A 584 N CYS A 84 ? N CYS A 581 AA1 4 5 O SER A 83 ? O SER A 580 N ASN A 78 ? N ASN A 575 AA1 5 6 O ILE A 77 ? O ILE A 574 N CYS A 70 ? N CYS A 567 AA2 1 2 O ILE A 122 ? O ILE A 619 N TRP A 114 ? N TRP A 611 AA2 2 3 N ILE A 111 ? N ILE A 608 O ARG A 185 ? O ARG A 682 AA2 3 4 O LYS A 180 ? O LYS A 677 N GLN A 171 ? N GLN A 668 AA2 4 5 O ILE A 170 ? O ILE A 667 N SER A 165 ? N SER A 662 AA2 5 6 O TYR A 162 ? O TYR A 659 N PHE A 155 ? N PHE A 652 # _atom_sites.entry_id 7TGQ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011116 _atom_sites.fract_transf_matrix[1][2] 0.006418 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012836 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018937 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O1- ? ? 5.12366 3.84317 ? ? 3.49406 27.47979 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? ZN ? ? 24.64596 5.25405 ? ? 2.14387 29.76375 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 498 ? ? ? A . n A 1 2 THR 2 499 ? ? ? A . n A 1 3 THR 3 500 ? ? ? A . n A 1 4 SER 4 501 ? ? ? A . n A 1 5 SER 5 502 ? ? ? A . n A 1 6 ARG 6 503 ? ? ? A . n A 1 7 VAL 7 504 ? ? ? A . n A 1 8 ASP 8 505 ? ? ? A . n A 1 9 ASP 9 506 ? ? ? A . n A 1 10 HIS 10 507 ? ? ? A . n A 1 11 ASP 11 508 ? ? ? A . n A 1 12 SER 12 509 509 SER SER A . n A 1 13 GLU 13 510 510 GLU GLU A . n A 1 14 GLU 14 511 511 GLU GLU A . n A 1 15 ILE 15 512 512 ILE ILE A . n A 1 16 CYS 16 513 513 CYS CYS A . n A 1 17 LEU 17 514 514 LEU LEU A . n A 1 18 ASP 18 515 515 ASP ASP A . n A 1 19 HIS 19 516 516 HIS HIS A . n A 1 20 LEU 20 517 517 LEU LEU A . n A 1 21 CYS 21 518 518 CYS CYS A . n A 1 22 LYS 22 519 519 LYS LYS A . n A 1 23 GLY 23 520 520 GLY GLY A . n A 1 24 CYS 24 521 521 CYS CYS A . n A 1 25 PRO 25 522 522 PRO PRO A . n A 1 26 LEU 26 523 523 LEU LEU A . n A 1 27 ASN 27 524 524 ASN ASN A . n A 1 28 GLY 28 525 525 GLY GLY A . n A 1 29 SER 29 526 526 SER SER A . n A 1 30 CYS 30 527 527 CYS CYS A . n A 1 31 SER 31 528 528 SER SER A . n A 1 32 LYS 32 529 529 LYS LYS A . n A 1 33 VAL 33 530 530 VAL VAL A . n A 1 34 HIS 34 531 531 HIS HIS A . n A 1 35 PHE 35 532 532 PHE PHE A . n A 1 36 HIS 36 533 533 HIS HIS A . n A 1 37 LEU 37 534 534 LEU LEU A . n A 1 38 PRO 38 535 535 PRO PRO A . n A 1 39 TYR 39 536 536 TYR TYR A . n A 1 40 ARG 40 537 537 ARG ARG A . n A 1 41 TRP 41 538 538 TRP TRP A . n A 1 42 GLN 42 539 539 GLN GLN A . n A 1 43 MET 43 540 540 MET MET A . n A 1 44 LEU 44 541 541 LEU LEU A . n A 1 45 ILE 45 542 542 ILE ILE A . n A 1 46 GLY 46 543 543 GLY GLY A . n A 1 47 LYS 47 544 544 LYS LYS A . n A 1 48 THR 48 545 545 THR THR A . n A 1 49 TRP 49 546 546 TRP TRP A . n A 1 50 THR 50 547 547 THR THR A . n A 1 51 ASP 51 548 548 ASP ASP A . n A 1 52 PHE 52 549 549 PHE PHE A . n A 1 53 GLU 53 550 550 GLU GLU A . n A 1 54 HIS 54 551 551 HIS HIS A . n A 1 55 MET 55 552 552 MET MET A . n A 1 56 GLU 56 553 553 GLU GLU A . n A 1 57 THR 57 554 554 THR THR A . n A 1 58 ILE 58 555 555 ILE ILE A . n A 1 59 GLU 59 556 556 GLU GLU A . n A 1 60 LYS 60 557 557 LYS LYS A . n A 1 61 GLY 61 558 558 GLY GLY A . n A 1 62 TYR 62 559 559 TYR TYR A . n A 1 63 CYS 63 560 560 CYS CYS A . n A 1 64 ASN 64 561 561 ASN ASN A . n A 1 65 PRO 65 562 562 PRO PRO A . n A 1 66 GLY 66 563 563 GLY GLY A . n A 1 67 ILE 67 564 564 ILE ILE A . n A 1 68 HIS 68 565 565 HIS HIS A . n A 1 69 LEU 69 566 566 LEU LEU A . n A 1 70 CYS 70 567 567 CYS CYS A . n A 1 71 SER 71 568 568 SER SER A . n A 1 72 VAL 72 569 569 VAL VAL A . n A 1 73 GLY 73 570 570 GLY GLY A . n A 1 74 SER 74 571 571 SER SER A . n A 1 75 TYR 75 572 572 TYR TYR A . n A 1 76 THR 76 573 573 THR THR A . n A 1 77 ILE 77 574 574 ILE ILE A . n A 1 78 ASN 78 575 575 ASN ASN A . n A 1 79 PHE 79 576 576 PHE PHE A . n A 1 80 ARG 80 577 577 ARG ARG A . n A 1 81 VAL 81 578 578 VAL VAL A . n A 1 82 MET 82 579 579 MET MET A . n A 1 83 SER 83 580 580 SER SER A . n A 1 84 CYS 84 581 581 CYS CYS A . n A 1 85 ASP 85 582 582 ASP ASP A . n A 1 86 SER 86 583 583 SER SER A . n A 1 87 PHE 87 584 584 PHE PHE A . n A 1 88 PRO 88 585 585 PRO PRO A . n A 1 89 ILE 89 586 586 ILE ILE A . n A 1 90 ARG 90 587 587 ARG ARG A . n A 1 91 ARG 91 588 588 ARG ARG A . n A 1 92 LEU 92 589 589 LEU LEU A . n A 1 93 SER 93 590 590 SER SER A . n A 1 94 THR 94 591 591 THR THR A . n A 1 95 PRO 95 592 592 PRO PRO A . n A 1 96 SER 96 593 593 SER SER A . n A 1 97 SER 97 594 594 SER SER A . n A 1 98 VAL 98 595 595 VAL VAL A . n A 1 99 THR 99 596 596 THR THR A . n A 1 100 LYS 100 597 597 LYS LYS A . n A 1 101 PRO 101 598 598 PRO PRO A . n A 1 102 ALA 102 599 599 ALA ALA A . n A 1 103 ASN 103 600 600 ASN ASN A . n A 1 104 SER 104 601 601 SER SER A . n A 1 105 VAL 105 602 602 VAL VAL A . n A 1 106 PHE 106 603 603 PHE PHE A . n A 1 107 THR 107 604 604 THR THR A . n A 1 108 THR 108 605 605 THR THR A . n A 1 109 LYS 109 606 606 LYS LYS A . n A 1 110 TRP 110 607 607 TRP TRP A . n A 1 111 ILE 111 608 608 ILE ILE A . n A 1 112 TRP 112 609 609 TRP TRP A . n A 1 113 TYR 113 610 610 TYR TYR A . n A 1 114 TRP 114 611 611 TRP TRP A . n A 1 115 LYS 115 612 612 LYS LYS A . n A 1 116 ASN 116 613 613 ASN ASN A . n A 1 117 GLU 117 614 614 GLU GLU A . n A 1 118 SER 118 615 615 SER SER A . n A 1 119 GLY 119 616 616 GLY GLY A . n A 1 120 THR 120 617 617 THR THR A . n A 1 121 TRP 121 618 618 TRP TRP A . n A 1 122 ILE 122 619 619 ILE ILE A . n A 1 123 GLN 123 620 620 GLN GLN A . n A 1 124 TYR 124 621 621 TYR TYR A . n A 1 125 GLY 125 622 622 GLY GLY A . n A 1 126 GLU 126 623 623 GLU GLU A . n A 1 127 GLU 127 624 ? ? ? A . n A 1 128 LYS 128 625 ? ? ? A . n A 1 129 ASP 129 626 ? ? ? A . n A 1 130 LYS 130 627 ? ? ? A . n A 1 131 ARG 131 628 ? ? ? A . n A 1 132 LYS 132 629 ? ? ? A . n A 1 133 ASN 133 630 630 ASN ASN A . n A 1 134 SER 134 631 631 SER SER A . n A 1 135 ASN 135 632 632 ASN ASN A . n A 1 136 VAL 136 633 633 VAL VAL A . n A 1 137 ASP 137 634 634 ASP ASP A . n A 1 138 SER 138 635 635 SER SER A . n A 1 139 SER 139 636 636 SER SER A . n A 1 140 TYR 140 637 637 TYR TYR A . n A 1 141 LEU 141 638 638 LEU LEU A . n A 1 142 GLU 142 639 639 GLU GLU A . n A 1 143 SER 143 640 640 SER SER A . n A 1 144 LEU 144 641 641 LEU LEU A . n A 1 145 TYR 145 642 642 TYR TYR A . n A 1 146 GLN 146 643 643 GLN GLN A . n A 1 147 SER 147 644 644 SER SER A . n A 1 148 CYS 148 645 645 CYS CYS A . n A 1 149 PRO 149 646 646 PRO PRO A . n A 1 150 ARG 150 647 647 ARG ARG A . n A 1 151 GLY 151 648 648 GLY GLY A . n A 1 152 VAL 152 649 649 VAL VAL A . n A 1 153 VAL 153 650 650 VAL VAL A . n A 1 154 PRO 154 651 651 PRO PRO A . n A 1 155 PHE 155 652 652 PHE PHE A . n A 1 156 GLN 156 653 653 GLN GLN A . n A 1 157 ALA 157 654 654 ALA ALA A . n A 1 158 GLY 158 655 655 GLY GLY A . n A 1 159 SER 159 656 656 SER SER A . n A 1 160 ARG 160 657 657 ARG ARG A . n A 1 161 ASN 161 658 658 ASN ASN A . n A 1 162 TYR 162 659 659 TYR TYR A . n A 1 163 GLU 163 660 660 GLU GLU A . n A 1 164 LEU 164 661 661 LEU LEU A . n A 1 165 SER 165 662 662 SER SER A . n A 1 166 PHE 166 663 663 PHE PHE A . n A 1 167 GLN 167 664 664 GLN GLN A . n A 1 168 GLY 168 665 665 GLY GLY A . n A 1 169 MET 169 666 666 MET MET A . n A 1 170 ILE 170 667 667 ILE ILE A . n A 1 171 GLN 171 668 668 GLN GLN A . n A 1 172 THR 172 669 669 THR THR A . n A 1 173 ASN 173 670 670 ASN ASN A . n A 1 174 ILE 174 671 671 ILE ILE A . n A 1 175 ALA 175 672 672 ALA ALA A . n A 1 176 SER 176 673 673 SER SER A . n A 1 177 LYS 177 674 674 LYS LYS A . n A 1 178 THR 178 675 675 THR THR A . n A 1 179 GLN 179 676 676 GLN GLN A . n A 1 180 LYS 180 677 677 LYS LYS A . n A 1 181 ASP 181 678 678 ASP ASP A . n A 1 182 VAL 182 679 679 VAL VAL A . n A 1 183 ILE 183 680 680 ILE ILE A . n A 1 184 ARG 184 681 681 ARG ARG A . n A 1 185 ARG 185 682 682 ARG ARG A . n A 1 186 PRO 186 683 683 PRO PRO A . n A 1 187 THR 187 684 684 THR THR A . n A 1 188 PHE 188 685 685 PHE PHE A . n A 1 189 VAL 189 686 686 VAL VAL A . n A 1 190 PRO 190 687 687 PRO PRO A . n A 1 191 GLN 191 688 688 GLN GLN A . n A 1 192 TRP 192 689 689 TRP TRP A . n A 1 193 TYR 193 690 690 TYR TYR A . n A 1 194 VAL 194 691 691 VAL VAL A . n A 1 195 GLN 195 692 692 GLN GLN A . n A 1 196 GLN 196 693 693 GLN GLN A . n A 1 197 MET 197 694 694 MET MET A . n A 1 198 LYS 198 695 695 LYS LYS A . n A 1 199 ARG 199 696 696 ARG ARG A . n A 1 200 GLY 200 697 ? ? ? A . n A 1 201 PRO 201 698 ? ? ? A . n A 1 202 ASP 202 699 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email opornillos@virginia.edu _pdbx_contact_author.name_first Owen _pdbx_contact_author.name_last Pornillos _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-9056-5002 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 701 701 ZN ZN A . C 3 APR 1 702 1 APR APR A . D 4 ACT 1 703 1 ACT ACT A . E 4 ACT 1 704 2 ACT ACT A . F 5 HOH 1 801 92 HOH HOH A . F 5 HOH 2 802 36 HOH HOH A . F 5 HOH 3 803 52 HOH HOH A . F 5 HOH 4 804 27 HOH HOH A . F 5 HOH 5 805 35 HOH HOH A . F 5 HOH 6 806 16 HOH HOH A . F 5 HOH 7 807 88 HOH HOH A . F 5 HOH 8 808 60 HOH HOH A . F 5 HOH 9 809 3 HOH HOH A . F 5 HOH 10 810 65 HOH HOH A . F 5 HOH 11 811 41 HOH HOH A . F 5 HOH 12 812 81 HOH HOH A . F 5 HOH 13 813 14 HOH HOH A . F 5 HOH 14 814 7 HOH HOH A . F 5 HOH 15 815 66 HOH HOH A . F 5 HOH 16 816 18 HOH HOH A . F 5 HOH 17 817 39 HOH HOH A . F 5 HOH 18 818 90 HOH HOH A . F 5 HOH 19 819 50 HOH HOH A . F 5 HOH 20 820 23 HOH HOH A . F 5 HOH 21 821 82 HOH HOH A . F 5 HOH 22 822 5 HOH HOH A . F 5 HOH 23 823 47 HOH HOH A . F 5 HOH 24 824 25 HOH HOH A . F 5 HOH 25 825 43 HOH HOH A . F 5 HOH 26 826 2 HOH HOH A . F 5 HOH 27 827 64 HOH HOH A . F 5 HOH 28 828 34 HOH HOH A . F 5 HOH 29 829 12 HOH HOH A . F 5 HOH 30 830 54 HOH HOH A . F 5 HOH 31 831 31 HOH HOH A . F 5 HOH 32 832 42 HOH HOH A . F 5 HOH 33 833 75 HOH HOH A . F 5 HOH 34 834 13 HOH HOH A . F 5 HOH 35 835 29 HOH HOH A . F 5 HOH 36 836 69 HOH HOH A . F 5 HOH 37 837 10 HOH HOH A . F 5 HOH 38 838 22 HOH HOH A . F 5 HOH 39 839 76 HOH HOH A . F 5 HOH 40 840 28 HOH HOH A . F 5 HOH 41 841 11 HOH HOH A . F 5 HOH 42 842 51 HOH HOH A . F 5 HOH 43 843 80 HOH HOH A . F 5 HOH 44 844 83 HOH HOH A . F 5 HOH 45 845 77 HOH HOH A . F 5 HOH 46 846 55 HOH HOH A . F 5 HOH 47 847 1 HOH HOH A . F 5 HOH 48 848 91 HOH HOH A . F 5 HOH 49 849 86 HOH HOH A . F 5 HOH 50 850 53 HOH HOH A . F 5 HOH 51 851 57 HOH HOH A . F 5 HOH 52 852 17 HOH HOH A . F 5 HOH 53 853 19 HOH HOH A . F 5 HOH 54 854 6 HOH HOH A . F 5 HOH 55 855 33 HOH HOH A . F 5 HOH 56 856 21 HOH HOH A . F 5 HOH 57 857 49 HOH HOH A . F 5 HOH 58 858 68 HOH HOH A . F 5 HOH 59 859 63 HOH HOH A . F 5 HOH 60 860 38 HOH HOH A . F 5 HOH 61 861 62 HOH HOH A . F 5 HOH 62 862 24 HOH HOH A . F 5 HOH 63 863 79 HOH HOH A . F 5 HOH 64 864 89 HOH HOH A . F 5 HOH 65 865 40 HOH HOH A . F 5 HOH 66 866 58 HOH HOH A . F 5 HOH 67 867 48 HOH HOH A . F 5 HOH 68 868 44 HOH HOH A . F 5 HOH 69 869 85 HOH HOH A . F 5 HOH 70 870 56 HOH HOH A . F 5 HOH 71 871 9 HOH HOH A . F 5 HOH 72 872 37 HOH HOH A . F 5 HOH 73 873 30 HOH HOH A . F 5 HOH 74 874 72 HOH HOH A . F 5 HOH 75 875 59 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 857 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 16 ? A CYS 513 ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 SG ? A CYS 24 ? A CYS 521 ? 1_555 103.6 ? 2 SG ? A CYS 16 ? A CYS 513 ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 SG ? A CYS 30 ? A CYS 527 ? 1_555 114.8 ? 3 SG ? A CYS 24 ? A CYS 521 ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 SG ? A CYS 30 ? A CYS 527 ? 1_555 108.7 ? 4 SG ? A CYS 16 ? A CYS 513 ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 NE2 ? A HIS 34 ? A HIS 531 ? 1_555 107.6 ? 5 SG ? A CYS 24 ? A CYS 521 ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 NE2 ? A HIS 34 ? A HIS 531 ? 1_555 119.5 ? 6 SG ? A CYS 30 ? A CYS 527 ? 1_555 ZN ? B ZN . ? A ZN 701 ? 1_555 NE2 ? A HIS 34 ? A HIS 531 ? 1_555 103.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-02-02 2 'Structure model' 1 1 2023-01-11 3 'Structure model' 1 2 2023-10-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z 3 -x+y,-x,z 4 x-y,-y,-z 5 -x,-x+y,-z 6 y,x,-z # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 # _pdbx_entry_details.entry_id 7TGQ _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 518 ? ? -102.12 -112.11 2 1 ASN A 524 ? ? 55.14 -134.82 3 1 HIS A 551 ? ? -109.33 63.36 4 1 ASP A 582 ? ? 48.61 -103.09 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER 509 ? OG ? A SER 12 OG 2 1 Y 1 A GLU 510 ? CG ? A GLU 13 CG 3 1 Y 1 A GLU 510 ? CD ? A GLU 13 CD 4 1 Y 1 A GLU 510 ? OE1 ? A GLU 13 OE1 5 1 Y 1 A GLU 510 ? OE2 ? A GLU 13 OE2 6 1 Y 1 A ASN 524 ? CG ? A ASN 27 CG 7 1 Y 1 A ASN 524 ? OD1 ? A ASN 27 OD1 8 1 Y 1 A ASN 524 ? ND2 ? A ASN 27 ND2 9 1 Y 1 A MET 540 ? CG ? A MET 43 CG 10 1 Y 1 A MET 540 ? SD ? A MET 43 SD 11 1 Y 1 A MET 540 ? CE ? A MET 43 CE 12 1 Y 1 A LYS 544 ? CG ? A LYS 47 CG 13 1 Y 1 A LYS 544 ? CD ? A LYS 47 CD 14 1 Y 1 A LYS 544 ? CE ? A LYS 47 CE 15 1 Y 1 A LYS 544 ? NZ ? A LYS 47 NZ 16 1 Y 1 A SER 571 ? OG ? A SER 74 OG 17 1 Y 1 A ASP 582 ? CG ? A ASP 85 CG 18 1 Y 1 A ASP 582 ? OD1 ? A ASP 85 OD1 19 1 Y 1 A ASP 582 ? OD2 ? A ASP 85 OD2 20 1 Y 1 A SER 583 ? OG ? A SER 86 OG 21 1 Y 1 A PHE 584 ? CG ? A PHE 87 CG 22 1 Y 1 A PHE 584 ? CD1 ? A PHE 87 CD1 23 1 Y 1 A PHE 584 ? CD2 ? A PHE 87 CD2 24 1 Y 1 A PHE 584 ? CE1 ? A PHE 87 CE1 25 1 Y 1 A PHE 584 ? CE2 ? A PHE 87 CE2 26 1 Y 1 A PHE 584 ? CZ ? A PHE 87 CZ 27 1 Y 1 A GLU 614 ? CG ? A GLU 117 CG 28 1 Y 1 A GLU 614 ? CD ? A GLU 117 CD 29 1 Y 1 A GLU 614 ? OE1 ? A GLU 117 OE1 30 1 Y 1 A GLU 614 ? OE2 ? A GLU 117 OE2 31 1 Y 1 A ARG 647 ? CG ? A ARG 150 CG 32 1 Y 1 A ARG 647 ? CD ? A ARG 150 CD 33 1 Y 1 A ARG 647 ? NE ? A ARG 150 NE 34 1 Y 1 A ARG 647 ? CZ ? A ARG 150 CZ 35 1 Y 1 A ARG 647 ? NH1 ? A ARG 150 NH1 36 1 Y 1 A ARG 647 ? NH2 ? A ARG 150 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 498 ? A SER 1 2 1 Y 1 A THR 499 ? A THR 2 3 1 Y 1 A THR 500 ? A THR 3 4 1 Y 1 A SER 501 ? A SER 4 5 1 Y 1 A SER 502 ? A SER 5 6 1 Y 1 A ARG 503 ? A ARG 6 7 1 Y 1 A VAL 504 ? A VAL 7 8 1 Y 1 A ASP 505 ? A ASP 8 9 1 Y 1 A ASP 506 ? A ASP 9 10 1 Y 1 A HIS 507 ? A HIS 10 11 1 Y 1 A ASP 508 ? A ASP 11 12 1 Y 1 A GLU 624 ? A GLU 127 13 1 Y 1 A LYS 625 ? A LYS 128 14 1 Y 1 A ASP 626 ? A ASP 129 15 1 Y 1 A LYS 627 ? A LYS 130 16 1 Y 1 A ARG 628 ? A ARG 131 17 1 Y 1 A LYS 629 ? A LYS 132 18 1 Y 1 A GLY 697 ? A GLY 200 19 1 Y 1 A PRO 698 ? A PRO 201 20 1 Y 1 A ASP 699 ? A ASP 202 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ACT C C N N 1 ACT O O N N 2 ACT OXT O N N 3 ACT CH3 C N N 4 ACT H1 H N N 5 ACT H2 H N N 6 ACT H3 H N N 7 ALA N N N N 8 ALA CA C N S 9 ALA C C N N 10 ALA O O N N 11 ALA CB C N N 12 ALA OXT O N N 13 ALA H H N N 14 ALA H2 H N N 15 ALA HA H N N 16 ALA HB1 H N N 17 ALA HB2 H N N 18 ALA HB3 H N N 19 ALA HXT H N N 20 APR N1 N Y N 21 APR C2 C Y N 22 APR N3 N Y N 23 APR C4 C Y N 24 APR C5 C Y N 25 APR C6 C Y N 26 APR N6 N N N 27 APR N7 N Y N 28 APR C8 C Y N 29 APR N9 N Y N 30 APR "C1'" C N R 31 APR "C2'" C N R 32 APR "O2'" O N N 33 APR "C3'" C N S 34 APR "O3'" O N N 35 APR "O4'" O N N 36 APR "C4'" C N R 37 APR "C5'" C N N 38 APR "O5'" O N N 39 APR PA P N S 40 APR O1A O N N 41 APR O2A O N N 42 APR O3A O N N 43 APR PB P N R 44 APR O1B O N N 45 APR O2B O N N 46 APR O5D O N N 47 APR C5D C N N 48 APR O4D O N N 49 APR O1D O N N 50 APR C1D C N R 51 APR O2D O N N 52 APR C2D C N R 53 APR O3D O N N 54 APR C3D C N S 55 APR C4D C N R 56 APR H2 H N N 57 APR H61 H N N 58 APR H62 H N N 59 APR H8 H N N 60 APR "H'1" H N N 61 APR "H'2" H N N 62 APR "HO'2" H N N 63 APR "H'3" H N N 64 APR "HO'3" H N N 65 APR "H'4" H N N 66 APR "H5'1" H N N 67 APR "H5'2" H N N 68 APR HOA2 H N N 69 APR HOB2 H N N 70 APR H5R1 H N N 71 APR H5R2 H N N 72 APR HOR1 H N N 73 APR "HR'1" H N N 74 APR HOR2 H N N 75 APR "HR'2" H N N 76 APR HOR3 H N N 77 APR "HR'3" H N N 78 APR "HR'4" H N N 79 ARG N N N N 80 ARG CA C N S 81 ARG C C N N 82 ARG O O N N 83 ARG CB C N N 84 ARG CG C N N 85 ARG CD C N N 86 ARG NE N N N 87 ARG CZ C N N 88 ARG NH1 N N N 89 ARG NH2 N N N 90 ARG OXT O N N 91 ARG H H N N 92 ARG H2 H N N 93 ARG HA H N N 94 ARG HB2 H N N 95 ARG HB3 H N N 96 ARG HG2 H N N 97 ARG HG3 H N N 98 ARG HD2 H N N 99 ARG HD3 H N N 100 ARG HE H N N 101 ARG HH11 H N N 102 ARG HH12 H N N 103 ARG HH21 H N N 104 ARG HH22 H N N 105 ARG HXT H N N 106 ASN N N N N 107 ASN CA C N S 108 ASN C C N N 109 ASN O O N N 110 ASN CB C N N 111 ASN CG C N N 112 ASN OD1 O N N 113 ASN ND2 N N N 114 ASN OXT O N N 115 ASN H H N N 116 ASN H2 H N N 117 ASN HA H N N 118 ASN HB2 H N N 119 ASN HB3 H N N 120 ASN HD21 H N N 121 ASN HD22 H N N 122 ASN HXT H N N 123 ASP N N N N 124 ASP CA C N S 125 ASP C C N N 126 ASP O O N N 127 ASP CB C N N 128 ASP CG C N N 129 ASP OD1 O N N 130 ASP OD2 O N N 131 ASP OXT O N N 132 ASP H H N N 133 ASP H2 H N N 134 ASP HA H N N 135 ASP HB2 H N N 136 ASP HB3 H N N 137 ASP HD2 H N N 138 ASP HXT H N N 139 CYS N N N N 140 CYS CA C N R 141 CYS C C N N 142 CYS O O N N 143 CYS CB C N N 144 CYS SG S N N 145 CYS OXT O N N 146 CYS H H N N 147 CYS H2 H N N 148 CYS HA H N N 149 CYS HB2 H N N 150 CYS HB3 H N N 151 CYS HG H N N 152 CYS HXT H N N 153 GLN N N N N 154 GLN CA C N S 155 GLN C C N N 156 GLN O O N N 157 GLN CB C N N 158 GLN CG C N N 159 GLN CD C N N 160 GLN OE1 O N N 161 GLN NE2 N N N 162 GLN OXT O N N 163 GLN H H N N 164 GLN H2 H N N 165 GLN HA H N N 166 GLN HB2 H N N 167 GLN HB3 H N N 168 GLN HG2 H N N 169 GLN HG3 H N N 170 GLN HE21 H N N 171 GLN HE22 H N N 172 GLN HXT H N N 173 GLU N N N N 174 GLU CA C N S 175 GLU C C N N 176 GLU O O N N 177 GLU CB C N N 178 GLU CG C N N 179 GLU CD C N N 180 GLU OE1 O N N 181 GLU OE2 O N N 182 GLU OXT O N N 183 GLU H H N N 184 GLU H2 H N N 185 GLU HA H N N 186 GLU HB2 H N N 187 GLU HB3 H N N 188 GLU HG2 H N N 189 GLU HG3 H N N 190 GLU HE2 H N N 191 GLU HXT H N N 192 GLY N N N N 193 GLY CA C N N 194 GLY C C N N 195 GLY O O N N 196 GLY OXT O N N 197 GLY H H N N 198 GLY H2 H N N 199 GLY HA2 H N N 200 GLY HA3 H N N 201 GLY HXT H N N 202 HIS N N N N 203 HIS CA C N S 204 HIS C C N N 205 HIS O O N N 206 HIS CB C N N 207 HIS CG C Y N 208 HIS ND1 N Y N 209 HIS CD2 C Y N 210 HIS CE1 C Y N 211 HIS NE2 N Y N 212 HIS OXT O N N 213 HIS H H N N 214 HIS H2 H N N 215 HIS HA H N N 216 HIS HB2 H N N 217 HIS HB3 H N N 218 HIS HD1 H N N 219 HIS HD2 H N N 220 HIS HE1 H N N 221 HIS HE2 H N N 222 HIS HXT H N N 223 HOH O O N N 224 HOH H1 H N N 225 HOH H2 H N N 226 ILE N N N N 227 ILE CA C N S 228 ILE C C N N 229 ILE O O N N 230 ILE CB C N S 231 ILE CG1 C N N 232 ILE CG2 C N N 233 ILE CD1 C N N 234 ILE OXT O N N 235 ILE H H N N 236 ILE H2 H N N 237 ILE HA H N N 238 ILE HB H N N 239 ILE HG12 H N N 240 ILE HG13 H N N 241 ILE HG21 H N N 242 ILE HG22 H N N 243 ILE HG23 H N N 244 ILE HD11 H N N 245 ILE HD12 H N N 246 ILE HD13 H N N 247 ILE HXT H N N 248 LEU N N N N 249 LEU CA C N S 250 LEU C C N N 251 LEU O O N N 252 LEU CB C N N 253 LEU CG C N N 254 LEU CD1 C N N 255 LEU CD2 C N N 256 LEU OXT O N N 257 LEU H H N N 258 LEU H2 H N N 259 LEU HA H N N 260 LEU HB2 H N N 261 LEU HB3 H N N 262 LEU HG H N N 263 LEU HD11 H N N 264 LEU HD12 H N N 265 LEU HD13 H N N 266 LEU HD21 H N N 267 LEU HD22 H N N 268 LEU HD23 H N N 269 LEU HXT H N N 270 LYS N N N N 271 LYS CA C N S 272 LYS C C N N 273 LYS O O N N 274 LYS CB C N N 275 LYS CG C N N 276 LYS CD C N N 277 LYS CE C N N 278 LYS NZ N N N 279 LYS OXT O N N 280 LYS H H N N 281 LYS H2 H N N 282 LYS HA H N N 283 LYS HB2 H N N 284 LYS HB3 H N N 285 LYS HG2 H N N 286 LYS HG3 H N N 287 LYS HD2 H N N 288 LYS HD3 H N N 289 LYS HE2 H N N 290 LYS HE3 H N N 291 LYS HZ1 H N N 292 LYS HZ2 H N N 293 LYS HZ3 H N N 294 LYS HXT H N N 295 MET N N N N 296 MET CA C N S 297 MET C C N N 298 MET O O N N 299 MET CB C N N 300 MET CG C N N 301 MET SD S N N 302 MET CE C N N 303 MET OXT O N N 304 MET H H N N 305 MET H2 H N N 306 MET HA H N N 307 MET HB2 H N N 308 MET HB3 H N N 309 MET HG2 H N N 310 MET HG3 H N N 311 MET HE1 H N N 312 MET HE2 H N N 313 MET HE3 H N N 314 MET HXT H N N 315 PHE N N N N 316 PHE CA C N S 317 PHE C C N N 318 PHE O O N N 319 PHE CB C N N 320 PHE CG C Y N 321 PHE CD1 C Y N 322 PHE CD2 C Y N 323 PHE CE1 C Y N 324 PHE CE2 C Y N 325 PHE CZ C Y N 326 PHE OXT O N N 327 PHE H H N N 328 PHE H2 H N N 329 PHE HA H N N 330 PHE HB2 H N N 331 PHE HB3 H N N 332 PHE HD1 H N N 333 PHE HD2 H N N 334 PHE HE1 H N N 335 PHE HE2 H N N 336 PHE HZ H N N 337 PHE HXT H N N 338 PRO N N N N 339 PRO CA C N S 340 PRO C C N N 341 PRO O O N N 342 PRO CB C N N 343 PRO CG C N N 344 PRO CD C N N 345 PRO OXT O N N 346 PRO H H N N 347 PRO HA H N N 348 PRO HB2 H N N 349 PRO HB3 H N N 350 PRO HG2 H N N 351 PRO HG3 H N N 352 PRO HD2 H N N 353 PRO HD3 H N N 354 PRO HXT H N N 355 SER N N N N 356 SER CA C N S 357 SER C C N N 358 SER O O N N 359 SER CB C N N 360 SER OG O N N 361 SER OXT O N N 362 SER H H N N 363 SER H2 H N N 364 SER HA H N N 365 SER HB2 H N N 366 SER HB3 H N N 367 SER HG H N N 368 SER HXT H N N 369 THR N N N N 370 THR CA C N S 371 THR C C N N 372 THR O O N N 373 THR CB C N R 374 THR OG1 O N N 375 THR CG2 C N N 376 THR OXT O N N 377 THR H H N N 378 THR H2 H N N 379 THR HA H N N 380 THR HB H N N 381 THR HG1 H N N 382 THR HG21 H N N 383 THR HG22 H N N 384 THR HG23 H N N 385 THR HXT H N N 386 TRP N N N N 387 TRP CA C N S 388 TRP C C N N 389 TRP O O N N 390 TRP CB C N N 391 TRP CG C Y N 392 TRP CD1 C Y N 393 TRP CD2 C Y N 394 TRP NE1 N Y N 395 TRP CE2 C Y N 396 TRP CE3 C Y N 397 TRP CZ2 C Y N 398 TRP CZ3 C Y N 399 TRP CH2 C Y N 400 TRP OXT O N N 401 TRP H H N N 402 TRP H2 H N N 403 TRP HA H N N 404 TRP HB2 H N N 405 TRP HB3 H N N 406 TRP HD1 H N N 407 TRP HE1 H N N 408 TRP HE3 H N N 409 TRP HZ2 H N N 410 TRP HZ3 H N N 411 TRP HH2 H N N 412 TRP HXT H N N 413 TYR N N N N 414 TYR CA C N S 415 TYR C C N N 416 TYR O O N N 417 TYR CB C N N 418 TYR CG C Y N 419 TYR CD1 C Y N 420 TYR CD2 C Y N 421 TYR CE1 C Y N 422 TYR CE2 C Y N 423 TYR CZ C Y N 424 TYR OH O N N 425 TYR OXT O N N 426 TYR H H N N 427 TYR H2 H N N 428 TYR HA H N N 429 TYR HB2 H N N 430 TYR HB3 H N N 431 TYR HD1 H N N 432 TYR HD2 H N N 433 TYR HE1 H N N 434 TYR HE2 H N N 435 TYR HH H N N 436 TYR HXT H N N 437 VAL N N N N 438 VAL CA C N S 439 VAL C C N N 440 VAL O O N N 441 VAL CB C N N 442 VAL CG1 C N N 443 VAL CG2 C N N 444 VAL OXT O N N 445 VAL H H N N 446 VAL H2 H N N 447 VAL HA H N N 448 VAL HB H N N 449 VAL HG11 H N N 450 VAL HG12 H N N 451 VAL HG13 H N N 452 VAL HG21 H N N 453 VAL HG22 H N N 454 VAL HG23 H N N 455 VAL HXT H N N 456 ZN ZN ZN N N 457 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ACT C O doub N N 1 ACT C OXT sing N N 2 ACT C CH3 sing N N 3 ACT CH3 H1 sing N N 4 ACT CH3 H2 sing N N 5 ACT CH3 H3 sing N N 6 ALA N CA sing N N 7 ALA N H sing N N 8 ALA N H2 sing N N 9 ALA CA C sing N N 10 ALA CA CB sing N N 11 ALA CA HA sing N N 12 ALA C O doub N N 13 ALA C OXT sing N N 14 ALA CB HB1 sing N N 15 ALA CB HB2 sing N N 16 ALA CB HB3 sing N N 17 ALA OXT HXT sing N N 18 APR N1 C2 sing Y N 19 APR N1 C6 doub Y N 20 APR C2 N3 doub Y N 21 APR C2 H2 sing N N 22 APR N3 C4 sing Y N 23 APR C4 C5 doub Y N 24 APR C4 N9 sing Y N 25 APR C5 C6 sing Y N 26 APR C5 N7 sing Y N 27 APR C6 N6 sing N N 28 APR N6 H61 sing N N 29 APR N6 H62 sing N N 30 APR N7 C8 doub Y N 31 APR C8 N9 sing Y N 32 APR C8 H8 sing N N 33 APR N9 "C1'" sing N N 34 APR "C1'" "C2'" sing N N 35 APR "C1'" "O4'" sing N N 36 APR "C1'" "H'1" sing N N 37 APR "C2'" "O2'" sing N N 38 APR "C2'" "C3'" sing N N 39 APR "C2'" "H'2" sing N N 40 APR "O2'" "HO'2" sing N N 41 APR "C3'" "O3'" sing N N 42 APR "C3'" "C4'" sing N N 43 APR "C3'" "H'3" sing N N 44 APR "O3'" "HO'3" sing N N 45 APR "O4'" "C4'" sing N N 46 APR "C4'" "C5'" sing N N 47 APR "C4'" "H'4" sing N N 48 APR "C5'" "O5'" sing N N 49 APR "C5'" "H5'1" sing N N 50 APR "C5'" "H5'2" sing N N 51 APR "O5'" PA sing N N 52 APR PA O1A doub N N 53 APR PA O2A sing N N 54 APR PA O3A sing N N 55 APR O2A HOA2 sing N N 56 APR O3A PB sing N N 57 APR PB O1B doub N N 58 APR PB O2B sing N N 59 APR PB O5D sing N N 60 APR O2B HOB2 sing N N 61 APR O5D C5D sing N N 62 APR C5D C4D sing N N 63 APR C5D H5R1 sing N N 64 APR C5D H5R2 sing N N 65 APR O4D C1D sing N N 66 APR O4D C4D sing N N 67 APR O1D C1D sing N N 68 APR O1D HOR1 sing N N 69 APR C1D C2D sing N N 70 APR C1D "HR'1" sing N N 71 APR O2D C2D sing N N 72 APR O2D HOR2 sing N N 73 APR C2D C3D sing N N 74 APR C2D "HR'2" sing N N 75 APR O3D C3D sing N N 76 APR O3D HOR3 sing N N 77 APR C3D C4D sing N N 78 APR C3D "HR'3" sing N N 79 APR C4D "HR'4" sing N N 80 ARG N CA sing N N 81 ARG N H sing N N 82 ARG N H2 sing N N 83 ARG CA C sing N N 84 ARG CA CB sing N N 85 ARG CA HA sing N N 86 ARG C O doub N N 87 ARG C OXT sing N N 88 ARG CB CG sing N N 89 ARG CB HB2 sing N N 90 ARG CB HB3 sing N N 91 ARG CG CD sing N N 92 ARG CG HG2 sing N N 93 ARG CG HG3 sing N N 94 ARG CD NE sing N N 95 ARG CD HD2 sing N N 96 ARG CD HD3 sing N N 97 ARG NE CZ sing N N 98 ARG NE HE sing N N 99 ARG CZ NH1 sing N N 100 ARG CZ NH2 doub N N 101 ARG NH1 HH11 sing N N 102 ARG NH1 HH12 sing N N 103 ARG NH2 HH21 sing N N 104 ARG NH2 HH22 sing N N 105 ARG OXT HXT sing N N 106 ASN N CA sing N N 107 ASN N H sing N N 108 ASN N H2 sing N N 109 ASN CA C sing N N 110 ASN CA CB sing N N 111 ASN CA HA sing N N 112 ASN C O doub N N 113 ASN C OXT sing N N 114 ASN CB CG sing N N 115 ASN CB HB2 sing N N 116 ASN CB HB3 sing N N 117 ASN CG OD1 doub N N 118 ASN CG ND2 sing N N 119 ASN ND2 HD21 sing N N 120 ASN ND2 HD22 sing N N 121 ASN OXT HXT sing N N 122 ASP N CA sing N N 123 ASP N H sing N N 124 ASP N H2 sing N N 125 ASP CA C sing N N 126 ASP CA CB sing N N 127 ASP CA HA sing N N 128 ASP C O doub N N 129 ASP C OXT sing N N 130 ASP CB CG sing N N 131 ASP CB HB2 sing N N 132 ASP CB HB3 sing N N 133 ASP CG OD1 doub N N 134 ASP CG OD2 sing N N 135 ASP OD2 HD2 sing N N 136 ASP OXT HXT sing N N 137 CYS N CA sing N N 138 CYS N H sing N N 139 CYS N H2 sing N N 140 CYS CA C sing N N 141 CYS CA CB sing N N 142 CYS CA HA sing N N 143 CYS C O doub N N 144 CYS C OXT sing N N 145 CYS CB SG sing N N 146 CYS CB HB2 sing N N 147 CYS CB HB3 sing N N 148 CYS SG HG sing N N 149 CYS OXT HXT sing N N 150 GLN N CA sing N N 151 GLN N H sing N N 152 GLN N H2 sing N N 153 GLN CA C sing N N 154 GLN CA CB sing N N 155 GLN CA HA sing N N 156 GLN C O doub N N 157 GLN C OXT sing N N 158 GLN CB CG sing N N 159 GLN CB HB2 sing N N 160 GLN CB HB3 sing N N 161 GLN CG CD sing N N 162 GLN CG HG2 sing N N 163 GLN CG HG3 sing N N 164 GLN CD OE1 doub N N 165 GLN CD NE2 sing N N 166 GLN NE2 HE21 sing N N 167 GLN NE2 HE22 sing N N 168 GLN OXT HXT sing N N 169 GLU N CA sing N N 170 GLU N H sing N N 171 GLU N H2 sing N N 172 GLU CA C sing N N 173 GLU CA CB sing N N 174 GLU CA HA sing N N 175 GLU C O doub N N 176 GLU C OXT sing N N 177 GLU CB CG sing N N 178 GLU CB HB2 sing N N 179 GLU CB HB3 sing N N 180 GLU CG CD sing N N 181 GLU CG HG2 sing N N 182 GLU CG HG3 sing N N 183 GLU CD OE1 doub N N 184 GLU CD OE2 sing N N 185 GLU OE2 HE2 sing N N 186 GLU OXT HXT sing N N 187 GLY N CA sing N N 188 GLY N H sing N N 189 GLY N H2 sing N N 190 GLY CA C sing N N 191 GLY CA HA2 sing N N 192 GLY CA HA3 sing N N 193 GLY C O doub N N 194 GLY C OXT sing N N 195 GLY OXT HXT sing N N 196 HIS N CA sing N N 197 HIS N H sing N N 198 HIS N H2 sing N N 199 HIS CA C sing N N 200 HIS CA CB sing N N 201 HIS CA HA sing N N 202 HIS C O doub N N 203 HIS C OXT sing N N 204 HIS CB CG sing N N 205 HIS CB HB2 sing N N 206 HIS CB HB3 sing N N 207 HIS CG ND1 sing Y N 208 HIS CG CD2 doub Y N 209 HIS ND1 CE1 doub Y N 210 HIS ND1 HD1 sing N N 211 HIS CD2 NE2 sing Y N 212 HIS CD2 HD2 sing N N 213 HIS CE1 NE2 sing Y N 214 HIS CE1 HE1 sing N N 215 HIS NE2 HE2 sing N N 216 HIS OXT HXT sing N N 217 HOH O H1 sing N N 218 HOH O H2 sing N N 219 ILE N CA sing N N 220 ILE N H sing N N 221 ILE N H2 sing N N 222 ILE CA C sing N N 223 ILE CA CB sing N N 224 ILE CA HA sing N N 225 ILE C O doub N N 226 ILE C OXT sing N N 227 ILE CB CG1 sing N N 228 ILE CB CG2 sing N N 229 ILE CB HB sing N N 230 ILE CG1 CD1 sing N N 231 ILE CG1 HG12 sing N N 232 ILE CG1 HG13 sing N N 233 ILE CG2 HG21 sing N N 234 ILE CG2 HG22 sing N N 235 ILE CG2 HG23 sing N N 236 ILE CD1 HD11 sing N N 237 ILE CD1 HD12 sing N N 238 ILE CD1 HD13 sing N N 239 ILE OXT HXT sing N N 240 LEU N CA sing N N 241 LEU N H sing N N 242 LEU N H2 sing N N 243 LEU CA C sing N N 244 LEU CA CB sing N N 245 LEU CA HA sing N N 246 LEU C O doub N N 247 LEU C OXT sing N N 248 LEU CB CG sing N N 249 LEU CB HB2 sing N N 250 LEU CB HB3 sing N N 251 LEU CG CD1 sing N N 252 LEU CG CD2 sing N N 253 LEU CG HG sing N N 254 LEU CD1 HD11 sing N N 255 LEU CD1 HD12 sing N N 256 LEU CD1 HD13 sing N N 257 LEU CD2 HD21 sing N N 258 LEU CD2 HD22 sing N N 259 LEU CD2 HD23 sing N N 260 LEU OXT HXT sing N N 261 LYS N CA sing N N 262 LYS N H sing N N 263 LYS N H2 sing N N 264 LYS CA C sing N N 265 LYS CA CB sing N N 266 LYS CA HA sing N N 267 LYS C O doub N N 268 LYS C OXT sing N N 269 LYS CB CG sing N N 270 LYS CB HB2 sing N N 271 LYS CB HB3 sing N N 272 LYS CG CD sing N N 273 LYS CG HG2 sing N N 274 LYS CG HG3 sing N N 275 LYS CD CE sing N N 276 LYS CD HD2 sing N N 277 LYS CD HD3 sing N N 278 LYS CE NZ sing N N 279 LYS CE HE2 sing N N 280 LYS CE HE3 sing N N 281 LYS NZ HZ1 sing N N 282 LYS NZ HZ2 sing N N 283 LYS NZ HZ3 sing N N 284 LYS OXT HXT sing N N 285 MET N CA sing N N 286 MET N H sing N N 287 MET N H2 sing N N 288 MET CA C sing N N 289 MET CA CB sing N N 290 MET CA HA sing N N 291 MET C O doub N N 292 MET C OXT sing N N 293 MET CB CG sing N N 294 MET CB HB2 sing N N 295 MET CB HB3 sing N N 296 MET CG SD sing N N 297 MET CG HG2 sing N N 298 MET CG HG3 sing N N 299 MET SD CE sing N N 300 MET CE HE1 sing N N 301 MET CE HE2 sing N N 302 MET CE HE3 sing N N 303 MET OXT HXT sing N N 304 PHE N CA sing N N 305 PHE N H sing N N 306 PHE N H2 sing N N 307 PHE CA C sing N N 308 PHE CA CB sing N N 309 PHE CA HA sing N N 310 PHE C O doub N N 311 PHE C OXT sing N N 312 PHE CB CG sing N N 313 PHE CB HB2 sing N N 314 PHE CB HB3 sing N N 315 PHE CG CD1 doub Y N 316 PHE CG CD2 sing Y N 317 PHE CD1 CE1 sing Y N 318 PHE CD1 HD1 sing N N 319 PHE CD2 CE2 doub Y N 320 PHE CD2 HD2 sing N N 321 PHE CE1 CZ doub Y N 322 PHE CE1 HE1 sing N N 323 PHE CE2 CZ sing Y N 324 PHE CE2 HE2 sing N N 325 PHE CZ HZ sing N N 326 PHE OXT HXT sing N N 327 PRO N CA sing N N 328 PRO N CD sing N N 329 PRO N H sing N N 330 PRO CA C sing N N 331 PRO CA CB sing N N 332 PRO CA HA sing N N 333 PRO C O doub N N 334 PRO C OXT sing N N 335 PRO CB CG sing N N 336 PRO CB HB2 sing N N 337 PRO CB HB3 sing N N 338 PRO CG CD sing N N 339 PRO CG HG2 sing N N 340 PRO CG HG3 sing N N 341 PRO CD HD2 sing N N 342 PRO CD HD3 sing N N 343 PRO OXT HXT sing N N 344 SER N CA sing N N 345 SER N H sing N N 346 SER N H2 sing N N 347 SER CA C sing N N 348 SER CA CB sing N N 349 SER CA HA sing N N 350 SER C O doub N N 351 SER C OXT sing N N 352 SER CB OG sing N N 353 SER CB HB2 sing N N 354 SER CB HB3 sing N N 355 SER OG HG sing N N 356 SER OXT HXT sing N N 357 THR N CA sing N N 358 THR N H sing N N 359 THR N H2 sing N N 360 THR CA C sing N N 361 THR CA CB sing N N 362 THR CA HA sing N N 363 THR C O doub N N 364 THR C OXT sing N N 365 THR CB OG1 sing N N 366 THR CB CG2 sing N N 367 THR CB HB sing N N 368 THR OG1 HG1 sing N N 369 THR CG2 HG21 sing N N 370 THR CG2 HG22 sing N N 371 THR CG2 HG23 sing N N 372 THR OXT HXT sing N N 373 TRP N CA sing N N 374 TRP N H sing N N 375 TRP N H2 sing N N 376 TRP CA C sing N N 377 TRP CA CB sing N N 378 TRP CA HA sing N N 379 TRP C O doub N N 380 TRP C OXT sing N N 381 TRP CB CG sing N N 382 TRP CB HB2 sing N N 383 TRP CB HB3 sing N N 384 TRP CG CD1 doub Y N 385 TRP CG CD2 sing Y N 386 TRP CD1 NE1 sing Y N 387 TRP CD1 HD1 sing N N 388 TRP CD2 CE2 doub Y N 389 TRP CD2 CE3 sing Y N 390 TRP NE1 CE2 sing Y N 391 TRP NE1 HE1 sing N N 392 TRP CE2 CZ2 sing Y N 393 TRP CE3 CZ3 doub Y N 394 TRP CE3 HE3 sing N N 395 TRP CZ2 CH2 doub Y N 396 TRP CZ2 HZ2 sing N N 397 TRP CZ3 CH2 sing Y N 398 TRP CZ3 HZ3 sing N N 399 TRP CH2 HH2 sing N N 400 TRP OXT HXT sing N N 401 TYR N CA sing N N 402 TYR N H sing N N 403 TYR N H2 sing N N 404 TYR CA C sing N N 405 TYR CA CB sing N N 406 TYR CA HA sing N N 407 TYR C O doub N N 408 TYR C OXT sing N N 409 TYR CB CG sing N N 410 TYR CB HB2 sing N N 411 TYR CB HB3 sing N N 412 TYR CG CD1 doub Y N 413 TYR CG CD2 sing Y N 414 TYR CD1 CE1 sing Y N 415 TYR CD1 HD1 sing N N 416 TYR CD2 CE2 doub Y N 417 TYR CD2 HD2 sing N N 418 TYR CE1 CZ doub Y N 419 TYR CE1 HE1 sing N N 420 TYR CE2 CZ sing Y N 421 TYR CE2 HE2 sing N N 422 TYR CZ OH sing N N 423 TYR OH HH sing N N 424 TYR OXT HXT sing N N 425 VAL N CA sing N N 426 VAL N H sing N N 427 VAL N H2 sing N N 428 VAL CA C sing N N 429 VAL CA CB sing N N 430 VAL CA HA sing N N 431 VAL C O doub N N 432 VAL C OXT sing N N 433 VAL CB CG1 sing N N 434 VAL CB CG2 sing N N 435 VAL CB HB sing N N 436 VAL CG1 HG11 sing N N 437 VAL CG1 HG12 sing N N 438 VAL CG1 HG13 sing N N 439 VAL CG2 HG21 sing N N 440 VAL CG2 HG22 sing N N 441 VAL CG2 HG23 sing N N 442 VAL OXT HXT sing N N 443 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' R01-AI150479 1 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' 'United States' U54-AI150470 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id APR _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id APR _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 ADENOSINE-5-DIPHOSPHORIBOSE APR 4 'ACETATE ION' ACT 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7KZH _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 3 2 1' _space_group.name_Hall ;P 3 2" ; _space_group.IT_number 150 _space_group.crystal_system trigonal _space_group.id 1 #