data_7TN6 # _entry.id 7TN6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7TN6 pdb_00007tn6 10.2210/pdb7tn6/pdb WWPDB D_1000262564 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-06-15 2 'Structure model' 1 1 2024-02-21 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7TN6 _pdbx_database_status.recvd_initial_deposition_date 2022-01-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 huanchen.wang@nih.gov Huanchen Wang ? 'principal investigator/group leader' 0000-0003-2701-7155 3 shears@niehs.nih.gov Stephen Shears B 'principal investigator/group leader' 0000-0001-7309-8916 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zong, G.' 1 0000-0001-6019-5741 'Wang, H.' 2 0000-0003-2701-7155 'Shears, S.B.' 3 0000-0001-7309-8916 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Faseb J.' _citation.journal_id_ASTM FAJOEC _citation.journal_id_CSD 2074 _citation.journal_id_ISSN 1530-6860 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 36 _citation.language ? _citation.page_first e22380 _citation.page_last e22380 _citation.title 'Structural and catalytic analyses of the InsP 6 kinase activities of higher plant ITPKs.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1096/fj.202200393R _citation.pdbx_database_id_PubMed 35635723 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zong, G.' 1 ? primary 'Shears, S.B.' 2 ? primary 'Wang, H.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Inositol-tetrakisphosphate 1-kinase 1' 37289.387 1 2.7.1.134,2.7.1.159 H192A ? ? 2 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 3 water nat water 18.015 16 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Inositol 1,3,4-trisphosphate 5/6-kinase 1,Inositol-triphosphate 5/6-kinase 1,Ins(1,4)P(3) 5/6-kinase 1,Low phytic acid protein 2,ZmIpk ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MASDAAAEPSSGVTHPPRYVIGYALAPKKQQSFIQPSLVAQAASRGMDLVPVDASQPLAEQGPFHLLIHKLYGDDWRAQL VAFAARHPAVPIVDPPHAIDRLHNRISMLQVVSELDHAADQDSTFGIPSQVVVYDAAALADFGLLAALRFPLIAKPLVAD GTAKSHKMSLVYHREGLGKLRPPLVLQEFVNAGGVIFKVYVVGGHVTCVKRRSLPDVSPEDDASAQGSVSFSQVSNLPTE RTAEEYYGEKSLEDAVVPPAAFINQIAGGLRRALGLQLFNFDMIRDVRAGDRYLVIDINYFPGYAKMPGYETVLTDFFWE MVHKDGVGNQQEEKGANHVVVK ; _entity_poly.pdbx_seq_one_letter_code_can ;MASDAAAEPSSGVTHPPRYVIGYALAPKKQQSFIQPSLVAQAASRGMDLVPVDASQPLAEQGPFHLLIHKLYGDDWRAQL VAFAARHPAVPIVDPPHAIDRLHNRISMLQVVSELDHAADQDSTFGIPSQVVVYDAAALADFGLLAALRFPLIAKPLVAD GTAKSHKMSLVYHREGLGKLRPPLVLQEFVNAGGVIFKVYVVGGHVTCVKRRSLPDVSPEDDASAQGSVSFSQVSNLPTE RTAEEYYGEKSLEDAVVPPAAFINQIAGGLRRALGLQLFNFDMIRDVRAGDRYLVIDINYFPGYAKMPGYETVLTDFFWE MVHKDGVGNQQEEKGANHVVVK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ALA n 1 3 SER n 1 4 ASP n 1 5 ALA n 1 6 ALA n 1 7 ALA n 1 8 GLU n 1 9 PRO n 1 10 SER n 1 11 SER n 1 12 GLY n 1 13 VAL n 1 14 THR n 1 15 HIS n 1 16 PRO n 1 17 PRO n 1 18 ARG n 1 19 TYR n 1 20 VAL n 1 21 ILE n 1 22 GLY n 1 23 TYR n 1 24 ALA n 1 25 LEU n 1 26 ALA n 1 27 PRO n 1 28 LYS n 1 29 LYS n 1 30 GLN n 1 31 GLN n 1 32 SER n 1 33 PHE n 1 34 ILE n 1 35 GLN n 1 36 PRO n 1 37 SER n 1 38 LEU n 1 39 VAL n 1 40 ALA n 1 41 GLN n 1 42 ALA n 1 43 ALA n 1 44 SER n 1 45 ARG n 1 46 GLY n 1 47 MET n 1 48 ASP n 1 49 LEU n 1 50 VAL n 1 51 PRO n 1 52 VAL n 1 53 ASP n 1 54 ALA n 1 55 SER n 1 56 GLN n 1 57 PRO n 1 58 LEU n 1 59 ALA n 1 60 GLU n 1 61 GLN n 1 62 GLY n 1 63 PRO n 1 64 PHE n 1 65 HIS n 1 66 LEU n 1 67 LEU n 1 68 ILE n 1 69 HIS n 1 70 LYS n 1 71 LEU n 1 72 TYR n 1 73 GLY n 1 74 ASP n 1 75 ASP n 1 76 TRP n 1 77 ARG n 1 78 ALA n 1 79 GLN n 1 80 LEU n 1 81 VAL n 1 82 ALA n 1 83 PHE n 1 84 ALA n 1 85 ALA n 1 86 ARG n 1 87 HIS n 1 88 PRO n 1 89 ALA n 1 90 VAL n 1 91 PRO n 1 92 ILE n 1 93 VAL n 1 94 ASP n 1 95 PRO n 1 96 PRO n 1 97 HIS n 1 98 ALA n 1 99 ILE n 1 100 ASP n 1 101 ARG n 1 102 LEU n 1 103 HIS n 1 104 ASN n 1 105 ARG n 1 106 ILE n 1 107 SER n 1 108 MET n 1 109 LEU n 1 110 GLN n 1 111 VAL n 1 112 VAL n 1 113 SER n 1 114 GLU n 1 115 LEU n 1 116 ASP n 1 117 HIS n 1 118 ALA n 1 119 ALA n 1 120 ASP n 1 121 GLN n 1 122 ASP n 1 123 SER n 1 124 THR n 1 125 PHE n 1 126 GLY n 1 127 ILE n 1 128 PRO n 1 129 SER n 1 130 GLN n 1 131 VAL n 1 132 VAL n 1 133 VAL n 1 134 TYR n 1 135 ASP n 1 136 ALA n 1 137 ALA n 1 138 ALA n 1 139 LEU n 1 140 ALA n 1 141 ASP n 1 142 PHE n 1 143 GLY n 1 144 LEU n 1 145 LEU n 1 146 ALA n 1 147 ALA n 1 148 LEU n 1 149 ARG n 1 150 PHE n 1 151 PRO n 1 152 LEU n 1 153 ILE n 1 154 ALA n 1 155 LYS n 1 156 PRO n 1 157 LEU n 1 158 VAL n 1 159 ALA n 1 160 ASP n 1 161 GLY n 1 162 THR n 1 163 ALA n 1 164 LYS n 1 165 SER n 1 166 HIS n 1 167 LYS n 1 168 MET n 1 169 SER n 1 170 LEU n 1 171 VAL n 1 172 TYR n 1 173 HIS n 1 174 ARG n 1 175 GLU n 1 176 GLY n 1 177 LEU n 1 178 GLY n 1 179 LYS n 1 180 LEU n 1 181 ARG n 1 182 PRO n 1 183 PRO n 1 184 LEU n 1 185 VAL n 1 186 LEU n 1 187 GLN n 1 188 GLU n 1 189 PHE n 1 190 VAL n 1 191 ASN n 1 192 ALA n 1 193 GLY n 1 194 GLY n 1 195 VAL n 1 196 ILE n 1 197 PHE n 1 198 LYS n 1 199 VAL n 1 200 TYR n 1 201 VAL n 1 202 VAL n 1 203 GLY n 1 204 GLY n 1 205 HIS n 1 206 VAL n 1 207 THR n 1 208 CYS n 1 209 VAL n 1 210 LYS n 1 211 ARG n 1 212 ARG n 1 213 SER n 1 214 LEU n 1 215 PRO n 1 216 ASP n 1 217 VAL n 1 218 SER n 1 219 PRO n 1 220 GLU n 1 221 ASP n 1 222 ASP n 1 223 ALA n 1 224 SER n 1 225 ALA n 1 226 GLN n 1 227 GLY n 1 228 SER n 1 229 VAL n 1 230 SER n 1 231 PHE n 1 232 SER n 1 233 GLN n 1 234 VAL n 1 235 SER n 1 236 ASN n 1 237 LEU n 1 238 PRO n 1 239 THR n 1 240 GLU n 1 241 ARG n 1 242 THR n 1 243 ALA n 1 244 GLU n 1 245 GLU n 1 246 TYR n 1 247 TYR n 1 248 GLY n 1 249 GLU n 1 250 LYS n 1 251 SER n 1 252 LEU n 1 253 GLU n 1 254 ASP n 1 255 ALA n 1 256 VAL n 1 257 VAL n 1 258 PRO n 1 259 PRO n 1 260 ALA n 1 261 ALA n 1 262 PHE n 1 263 ILE n 1 264 ASN n 1 265 GLN n 1 266 ILE n 1 267 ALA n 1 268 GLY n 1 269 GLY n 1 270 LEU n 1 271 ARG n 1 272 ARG n 1 273 ALA n 1 274 LEU n 1 275 GLY n 1 276 LEU n 1 277 GLN n 1 278 LEU n 1 279 PHE n 1 280 ASN n 1 281 PHE n 1 282 ASP n 1 283 MET n 1 284 ILE n 1 285 ARG n 1 286 ASP n 1 287 VAL n 1 288 ARG n 1 289 ALA n 1 290 GLY n 1 291 ASP n 1 292 ARG n 1 293 TYR n 1 294 LEU n 1 295 VAL n 1 296 ILE n 1 297 ASP n 1 298 ILE n 1 299 ASN n 1 300 TYR n 1 301 PHE n 1 302 PRO n 1 303 GLY n 1 304 TYR n 1 305 ALA n 1 306 LYS n 1 307 MET n 1 308 PRO n 1 309 GLY n 1 310 TYR n 1 311 GLU n 1 312 THR n 1 313 VAL n 1 314 LEU n 1 315 THR n 1 316 ASP n 1 317 PHE n 1 318 PHE n 1 319 TRP n 1 320 GLU n 1 321 MET n 1 322 VAL n 1 323 HIS n 1 324 LYS n 1 325 ASP n 1 326 GLY n 1 327 VAL n 1 328 GLY n 1 329 ASN n 1 330 GLN n 1 331 GLN n 1 332 GLU n 1 333 GLU n 1 334 LYS n 1 335 GLY n 1 336 ALA n 1 337 ASN n 1 338 HIS n 1 339 VAL n 1 340 VAL n 1 341 VAL n 1 342 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 342 _entity_src_gen.gene_src_common_name Maize _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ITPK1, LPA2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Zea mays' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 4577 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 SER 3 3 ? ? ? A . n A 1 4 ASP 4 4 ? ? ? A . n A 1 5 ALA 5 5 ? ? ? A . n A 1 6 ALA 6 6 ? ? ? A . n A 1 7 ALA 7 7 ? ? ? A . n A 1 8 GLU 8 8 ? ? ? A . n A 1 9 PRO 9 9 ? ? ? A . n A 1 10 SER 10 10 ? ? ? A . n A 1 11 SER 11 11 ? ? ? A . n A 1 12 GLY 12 12 ? ? ? A . n A 1 13 VAL 13 13 ? ? ? A . n A 1 14 THR 14 14 ? ? ? A . n A 1 15 HIS 15 15 ? ? ? A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 PRO 17 17 17 PRO PRO A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 MET 47 47 47 MET MET A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 GLU 60 60 60 GLU GLU A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 TRP 76 76 76 TRP TRP A . n A 1 77 ARG 77 77 77 ARG ARG A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 PRO 91 91 91 PRO PRO A . n A 1 92 ILE 92 92 92 ILE ILE A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 PRO 95 95 95 PRO PRO A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 HIS 97 97 97 HIS HIS A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 HIS 103 103 103 HIS HIS A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 SER 107 107 107 SER SER A . n A 1 108 MET 108 108 108 MET MET A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 GLN 110 110 110 GLN GLN A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 GLU 114 114 114 GLU GLU A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ASP 116 116 116 ASP ASP A . n A 1 117 HIS 117 117 117 HIS HIS A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 ALA 119 119 ? ? ? A . n A 1 120 ASP 120 120 ? ? ? A . n A 1 121 GLN 121 121 121 GLN GLN A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 PRO 128 128 128 PRO PRO A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 GLN 130 130 130 GLN GLN A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 TYR 134 134 134 TYR TYR A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 ALA 137 137 137 ALA ALA A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 ASP 141 141 141 ASP ASP A . n A 1 142 PHE 142 142 142 PHE PHE A . n A 1 143 GLY 143 143 143 GLY GLY A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 ARG 149 149 149 ARG ARG A . n A 1 150 PHE 150 150 150 PHE PHE A . n A 1 151 PRO 151 151 151 PRO PRO A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 ILE 153 153 153 ILE ILE A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 LYS 155 155 155 LYS LYS A . n A 1 156 PRO 156 156 156 PRO PRO A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 ASP 160 160 160 ASP ASP A . n A 1 161 GLY 161 161 161 GLY GLY A . n A 1 162 THR 162 162 162 THR THR A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 LYS 164 164 164 LYS LYS A . n A 1 165 SER 165 165 165 SER SER A . n A 1 166 HIS 166 166 166 HIS HIS A . n A 1 167 LYS 167 167 167 LYS LYS A . n A 1 168 MET 168 168 168 MET MET A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 LEU 170 170 170 LEU LEU A . n A 1 171 VAL 171 171 171 VAL VAL A . n A 1 172 TYR 172 172 172 TYR TYR A . n A 1 173 HIS 173 173 173 HIS HIS A . n A 1 174 ARG 174 174 174 ARG ARG A . n A 1 175 GLU 175 175 175 GLU GLU A . n A 1 176 GLY 176 176 176 GLY GLY A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 LYS 179 179 179 LYS LYS A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 ARG 181 181 181 ARG ARG A . n A 1 182 PRO 182 182 182 PRO PRO A . n A 1 183 PRO 183 183 183 PRO PRO A . n A 1 184 LEU 184 184 184 LEU LEU A . n A 1 185 VAL 185 185 185 VAL VAL A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 GLN 187 187 187 GLN GLN A . n A 1 188 GLU 188 188 188 GLU GLU A . n A 1 189 PHE 189 189 189 PHE PHE A . n A 1 190 VAL 190 190 190 VAL VAL A . n A 1 191 ASN 191 191 191 ASN ASN A . n A 1 192 ALA 192 192 192 ALA ALA A . n A 1 193 GLY 193 193 193 GLY GLY A . n A 1 194 GLY 194 194 194 GLY GLY A . n A 1 195 VAL 195 195 195 VAL VAL A . n A 1 196 ILE 196 196 196 ILE ILE A . n A 1 197 PHE 197 197 197 PHE PHE A . n A 1 198 LYS 198 198 198 LYS LYS A . n A 1 199 VAL 199 199 199 VAL VAL A . n A 1 200 TYR 200 200 200 TYR TYR A . n A 1 201 VAL 201 201 201 VAL VAL A . n A 1 202 VAL 202 202 202 VAL VAL A . n A 1 203 GLY 203 203 203 GLY GLY A . n A 1 204 GLY 204 204 204 GLY GLY A . n A 1 205 HIS 205 205 205 HIS HIS A . n A 1 206 VAL 206 206 206 VAL VAL A . n A 1 207 THR 207 207 207 THR THR A . n A 1 208 CYS 208 208 208 CYS CYS A . n A 1 209 VAL 209 209 209 VAL VAL A . n A 1 210 LYS 210 210 210 LYS LYS A . n A 1 211 ARG 211 211 211 ARG ARG A . n A 1 212 ARG 212 212 212 ARG ARG A . n A 1 213 SER 213 213 213 SER SER A . n A 1 214 LEU 214 214 ? ? ? A . n A 1 215 PRO 215 215 ? ? ? A . n A 1 216 ASP 216 216 ? ? ? A . n A 1 217 VAL 217 217 ? ? ? A . n A 1 218 SER 218 218 ? ? ? A . n A 1 219 PRO 219 219 ? ? ? A . n A 1 220 GLU 220 220 ? ? ? A . n A 1 221 ASP 221 221 ? ? ? A . n A 1 222 ASP 222 222 ? ? ? A . n A 1 223 ALA 223 223 ? ? ? A . n A 1 224 SER 224 224 ? ? ? A . n A 1 225 ALA 225 225 ? ? ? A . n A 1 226 GLN 226 226 ? ? ? A . n A 1 227 GLY 227 227 ? ? ? A . n A 1 228 SER 228 228 ? ? ? A . n A 1 229 VAL 229 229 ? ? ? A . n A 1 230 SER 230 230 ? ? ? A . n A 1 231 PHE 231 231 ? ? ? A . n A 1 232 SER 232 232 ? ? ? A . n A 1 233 GLN 233 233 ? ? ? A . n A 1 234 VAL 234 234 ? ? ? A . n A 1 235 SER 235 235 ? ? ? A . n A 1 236 ASN 236 236 ? ? ? A . n A 1 237 LEU 237 237 ? ? ? A . n A 1 238 PRO 238 238 ? ? ? A . n A 1 239 THR 239 239 ? ? ? A . n A 1 240 GLU 240 240 ? ? ? A . n A 1 241 ARG 241 241 ? ? ? A . n A 1 242 THR 242 242 ? ? ? A . n A 1 243 ALA 243 243 ? ? ? A . n A 1 244 GLU 244 244 ? ? ? A . n A 1 245 GLU 245 245 ? ? ? A . n A 1 246 TYR 246 246 ? ? ? A . n A 1 247 TYR 247 247 ? ? ? A . n A 1 248 GLY 248 248 ? ? ? A . n A 1 249 GLU 249 249 ? ? ? A . n A 1 250 LYS 250 250 ? ? ? A . n A 1 251 SER 251 251 ? ? ? A . n A 1 252 LEU 252 252 ? ? ? A . n A 1 253 GLU 253 253 ? ? ? A . n A 1 254 ASP 254 254 ? ? ? A . n A 1 255 ALA 255 255 ? ? ? A . n A 1 256 VAL 256 256 256 VAL VAL A . n A 1 257 VAL 257 257 257 VAL VAL A . n A 1 258 PRO 258 258 258 PRO PRO A . n A 1 259 PRO 259 259 259 PRO PRO A . n A 1 260 ALA 260 260 260 ALA ALA A . n A 1 261 ALA 261 261 261 ALA ALA A . n A 1 262 PHE 262 262 262 PHE PHE A . n A 1 263 ILE 263 263 263 ILE ILE A . n A 1 264 ASN 264 264 264 ASN ASN A . n A 1 265 GLN 265 265 265 GLN GLN A . n A 1 266 ILE 266 266 266 ILE ILE A . n A 1 267 ALA 267 267 267 ALA ALA A . n A 1 268 GLY 268 268 268 GLY GLY A . n A 1 269 GLY 269 269 269 GLY GLY A . n A 1 270 LEU 270 270 270 LEU LEU A . n A 1 271 ARG 271 271 271 ARG ARG A . n A 1 272 ARG 272 272 272 ARG ARG A . n A 1 273 ALA 273 273 273 ALA ALA A . n A 1 274 LEU 274 274 274 LEU LEU A . n A 1 275 GLY 275 275 275 GLY GLY A . n A 1 276 LEU 276 276 276 LEU LEU A . n A 1 277 GLN 277 277 277 GLN GLN A . n A 1 278 LEU 278 278 278 LEU LEU A . n A 1 279 PHE 279 279 279 PHE PHE A . n A 1 280 ASN 280 280 280 ASN ASN A . n A 1 281 PHE 281 281 281 PHE PHE A . n A 1 282 ASP 282 282 282 ASP ASP A . n A 1 283 MET 283 283 283 MET MET A . n A 1 284 ILE 284 284 284 ILE ILE A . n A 1 285 ARG 285 285 285 ARG ARG A . n A 1 286 ASP 286 286 286 ASP ASP A . n A 1 287 VAL 287 287 287 VAL VAL A . n A 1 288 ARG 288 288 288 ARG ARG A . n A 1 289 ALA 289 289 289 ALA ALA A . n A 1 290 GLY 290 290 290 GLY GLY A . n A 1 291 ASP 291 291 291 ASP ASP A . n A 1 292 ARG 292 292 292 ARG ARG A . n A 1 293 TYR 293 293 293 TYR TYR A . n A 1 294 LEU 294 294 294 LEU LEU A . n A 1 295 VAL 295 295 295 VAL VAL A . n A 1 296 ILE 296 296 296 ILE ILE A . n A 1 297 ASP 297 297 297 ASP ASP A . n A 1 298 ILE 298 298 298 ILE ILE A . n A 1 299 ASN 299 299 299 ASN ASN A . n A 1 300 TYR 300 300 300 TYR TYR A . n A 1 301 PHE 301 301 301 PHE PHE A . n A 1 302 PRO 302 302 302 PRO PRO A . n A 1 303 GLY 303 303 303 GLY GLY A . n A 1 304 TYR 304 304 304 TYR TYR A . n A 1 305 ALA 305 305 305 ALA ALA A . n A 1 306 LYS 306 306 306 LYS LYS A . n A 1 307 MET 307 307 307 MET MET A . n A 1 308 PRO 308 308 308 PRO PRO A . n A 1 309 GLY 309 309 309 GLY GLY A . n A 1 310 TYR 310 310 310 TYR TYR A . n A 1 311 GLU 311 311 311 GLU GLU A . n A 1 312 THR 312 312 312 THR THR A . n A 1 313 VAL 313 313 313 VAL VAL A . n A 1 314 LEU 314 314 314 LEU LEU A . n A 1 315 THR 315 315 315 THR THR A . n A 1 316 ASP 316 316 316 ASP ASP A . n A 1 317 PHE 317 317 317 PHE PHE A . n A 1 318 PHE 318 318 318 PHE PHE A . n A 1 319 TRP 319 319 319 TRP TRP A . n A 1 320 GLU 320 320 320 GLU GLU A . n A 1 321 MET 321 321 321 MET MET A . n A 1 322 VAL 322 322 322 VAL VAL A . n A 1 323 HIS 323 323 323 HIS HIS A . n A 1 324 LYS 324 324 324 LYS LYS A . n A 1 325 ASP 325 325 ? ? ? A . n A 1 326 GLY 326 326 ? ? ? A . n A 1 327 VAL 327 327 ? ? ? A . n A 1 328 GLY 328 328 ? ? ? A . n A 1 329 ASN 329 329 ? ? ? A . n A 1 330 GLN 330 330 ? ? ? A . n A 1 331 GLN 331 331 ? ? ? A . n A 1 332 GLU 332 332 ? ? ? A . n A 1 333 GLU 333 333 ? ? ? A . n A 1 334 LYS 334 334 ? ? ? A . n A 1 335 GLY 335 335 ? ? ? A . n A 1 336 ALA 336 336 ? ? ? A . n A 1 337 ASN 337 337 ? ? ? A . n A 1 338 HIS 338 338 ? ? ? A . n A 1 339 VAL 339 339 ? ? ? A . n A 1 340 VAL 340 340 ? ? ? A . n A 1 341 VAL 341 341 ? ? ? A . n A 1 342 LYS 342 342 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 601 601 CL CL A . C 3 HOH 1 701 10 HOH HOH A . C 3 HOH 2 702 12 HOH HOH A . C 3 HOH 3 703 14 HOH HOH A . C 3 HOH 4 704 15 HOH HOH A . C 3 HOH 5 705 1 HOH HOH A . C 3 HOH 6 706 9 HOH HOH A . C 3 HOH 7 707 3 HOH HOH A . C 3 HOH 8 708 2 HOH HOH A . C 3 HOH 9 709 7 HOH HOH A . C 3 HOH 10 710 11 HOH HOH A . C 3 HOH 11 711 16 HOH HOH A . C 3 HOH 12 712 6 HOH HOH A . C 3 HOH 13 713 4 HOH HOH A . C 3 HOH 14 714 13 HOH HOH A . C 3 HOH 15 715 5 HOH HOH A . C 3 HOH 16 716 8 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0238 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7TN6 _cell.details ? _cell.formula_units_Z ? _cell.length_a 98.161 _cell.length_a_esd ? _cell.length_b 98.161 _cell.length_b_esd ? _cell.length_c 202.430 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7TN6 _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7TN6 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.77 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 67.36 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '12% PEG3350, 100mM HEPES 7.0, 200mM CaAc2 and 10% Glycerol' _exptl_crystal_grow.pdbx_pH_range 7-8 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-12-12 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7TN6 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.850 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14039 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.600 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.900 _reflns.pdbx_Rmerge_I_obs 0.085 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.000 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.975 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.089 _reflns.pdbx_Rpim_I_all 0.025 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 180691 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.850 2.900 ? ? ? ? ? ? 678 98.800 ? ? ? ? 0.816 ? ? ? ? ? ? ? ? 13.300 ? 0.960 ? ? 0.848 0.228 ? 1 1 0.915 ? ? ? ? ? ? ? ? ? ? 2.900 2.950 ? ? ? ? ? ? 687 99.400 ? ? ? ? 0.627 ? ? ? ? ? ? ? ? 13.300 ? 0.963 ? ? 0.652 0.175 ? 2 1 0.952 ? ? ? ? ? ? ? ? ? ? 2.950 3.010 ? ? ? ? ? ? 674 99.400 ? ? ? ? 0.554 ? ? ? ? ? ? ? ? 13.000 ? 0.950 ? ? 0.577 0.157 ? 3 1 0.932 ? ? ? ? ? ? ? ? ? ? 3.010 3.070 ? ? ? ? ? ? 699 98.600 ? ? ? ? 0.519 ? ? ? ? ? ? ? ? 12.700 ? 0.988 ? ? 0.541 0.149 ? 4 1 0.946 ? ? ? ? ? ? ? ? ? ? 3.070 3.140 ? ? ? ? ? ? 681 99.400 ? ? ? ? 0.402 ? ? ? ? ? ? ? ? 12.100 ? 0.992 ? ? 0.420 0.119 ? 5 1 0.949 ? ? ? ? ? ? ? ? ? ? 3.140 3.210 ? ? ? ? ? ? 636 92.700 ? ? ? ? 0.312 ? ? ? ? ? ? ? ? 12.100 ? 0.931 ? ? 0.326 0.091 ? 6 1 0.969 ? ? ? ? ? ? ? ? ? ? 3.210 3.290 ? ? ? ? ? ? 698 99.100 ? ? ? ? 0.300 ? ? ? ? ? ? ? ? 13.700 ? 1.002 ? ? 0.312 0.083 ? 7 1 0.985 ? ? ? ? ? ? ? ? ? ? 3.290 3.380 ? ? ? ? ? ? 679 99.100 ? ? ? ? 0.226 ? ? ? ? ? ? ? ? 13.700 ? 1.006 ? ? 0.235 0.062 ? 8 1 0.990 ? ? ? ? ? ? ? ? ? ? 3.380 3.480 ? ? ? ? ? ? 693 99.600 ? ? ? ? 0.176 ? ? ? ? ? ? ? ? 13.800 ? 1.001 ? ? 0.183 0.049 ? 9 1 0.994 ? ? ? ? ? ? ? ? ? ? 3.480 3.590 ? ? ? ? ? ? 691 99.100 ? ? ? ? 0.146 ? ? ? ? ? ? ? ? 13.700 ? 1.003 ? ? 0.152 0.040 ? 10 1 0.996 ? ? ? ? ? ? ? ? ? ? 3.590 3.720 ? ? ? ? ? ? 695 99.300 ? ? ? ? 0.114 ? ? ? ? ? ? ? ? 13.400 ? 1.051 ? ? 0.119 0.032 ? 11 1 0.996 ? ? ? ? ? ? ? ? ? ? 3.720 3.870 ? ? ? ? ? ? 704 99.400 ? ? ? ? 0.100 ? ? ? ? ? ? ? ? 13.100 ? 0.962 ? ? 0.104 0.029 ? 12 1 0.995 ? ? ? ? ? ? ? ? ? ? 3.870 4.040 ? ? ? ? ? ? 700 99.400 ? ? ? ? 0.086 ? ? ? ? ? ? ? ? 13.200 ? 0.965 ? ? 0.090 0.025 ? 13 1 0.997 ? ? ? ? ? ? ? ? ? ? 4.040 4.260 ? ? ? ? ? ? 713 99.200 ? ? ? ? 0.074 ? ? ? ? ? ? ? ? 12.800 ? 0.954 ? ? 0.077 0.021 ? 14 1 0.996 ? ? ? ? ? ? ? ? ? ? 4.260 4.520 ? ? ? ? ? ? 697 99.100 ? ? ? ? 0.061 ? ? ? ? ? ? ? ? 12.100 ? 0.869 ? ? 0.064 0.018 ? 15 1 0.995 ? ? ? ? ? ? ? ? ? ? 4.520 4.870 ? ? ? ? ? ? 677 94.600 ? ? ? ? 0.057 ? ? ? ? ? ? ? ? 12.000 ? 0.825 ? ? 0.060 0.018 ? 16 1 0.995 ? ? ? ? ? ? ? ? ? ? 4.870 5.360 ? ? ? ? ? ? 726 99.200 ? ? ? ? 0.061 ? ? ? ? ? ? ? ? 13.500 ? 0.893 ? ? 0.064 0.018 ? 17 1 0.979 ? ? ? ? ? ? ? ? ? ? 5.360 6.140 ? ? ? ? ? ? 743 99.600 ? ? ? ? 0.057 ? ? ? ? ? ? ? ? 13.200 ? 0.870 ? ? 0.060 0.017 ? 18 1 0.994 ? ? ? ? ? ? ? ? ? ? 6.140 7.730 ? ? ? ? ? ? 739 99.200 ? ? ? ? 0.056 ? ? ? ? ? ? ? ? 12.500 ? 0.858 ? ? 0.059 0.017 ? 19 1 0.997 ? ? ? ? ? ? ? ? ? ? 7.730 50.000 ? ? ? ? ? ? 829 97.900 ? ? ? ? 0.062 ? ? ? ? ? ? ? ? 10.700 ? 1.443 ? ? 0.065 0.020 ? 20 1 0.991 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] -0.0300 _refine.aniso_B[1][2] -0.0100 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] -0.0300 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 0.0800 _refine.B_iso_max 172.010 _refine.B_iso_mean 53.8650 _refine.B_iso_min 13.920 _refine.correlation_coeff_Fo_to_Fc 0.9050 _refine.correlation_coeff_Fo_to_Fc_free 0.8700 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7TN6 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.8500 _refine.ls_d_res_low 47.7400 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13136 _refine.ls_number_reflns_R_free 700 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.5100 _refine.ls_percent_reflns_R_free 5.1000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2269 _refine.ls_R_factor_R_free 0.2710 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2244 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.4380 _refine.pdbx_overall_ESU_R_Free 0.3170 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 11.2580 _refine.overall_SU_ML 0.2200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.8500 _refine_hist.d_res_low 47.7400 _refine_hist.number_atoms_solvent 16 _refine_hist.number_atoms_total 2086 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 265 _refine_hist.pdbx_B_iso_mean_ligand 28.44 _refine_hist.pdbx_B_iso_mean_solvent 35.45 _refine_hist.pdbx_number_atoms_protein 2069 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.012 0.013 2143 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 2047 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.897 1.635 2915 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.266 1.571 4718 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 9.199 5.000 266 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 34.848 20.826 109 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 19.972 15.000 335 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 13.339 15.000 16 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.085 0.200 268 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 0.020 2399 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 469 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.85 _refine_ls_shell.d_res_low 2.9220 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 41 _refine_ls_shell.number_reflns_R_work 819 _refine_ls_shell.percent_reflns_obs 84.8100 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3390 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2590 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7TN6 _struct.title 'Crystal structure of Zea mays Inositol-tetrakisphosphate Kinase 1 mutant (ZmITPK1-H192A)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7TN6 _struct_keywords.text 'ATP-grasp, inositol phosphate, kinase, signal transduction, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ITPK1_MAIZE _struct_ref.pdbx_db_accession Q84Y01 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MASDAAAEPSSGVTHPPRYVIGYALAPKKQQSFIQPSLVAQAASRGMDLVPVDASQPLAEQGPFHLLIHKLYGDDWRAQL VAFAARHPAVPIVDPPHAIDRLHNRISMLQVVSELDHAADQDSTFGIPSQVVVYDAAALADFGLLAALRFPLIAKPLVAD GTAKSHKMSLVYHREGLGKLRPPLVLQEFVNHGGVIFKVYVVGGHVTCVKRRSLPDVSPEDDASAQGSVSFSQVSNLPTE RTAEEYYGEKSLEDAVVPPAAFINQIAGGLRRALGLQLFNFDMIRDVRAGDRYLVIDINYFPGYAKMPGYETVLTDFFWE MVHKDGVGNQQEEKGANHVVVK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7TN6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 342 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q84Y01 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 342 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 342 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 7TN6 _struct_ref_seq_dif.mon_id ALA _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 192 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q84Y01 _struct_ref_seq_dif.db_mon_id HIS _struct_ref_seq_dif.pdbx_seq_db_seq_num 192 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 192 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3220 ? 1 MORE -36 ? 1 'SSA (A^2)' 23230 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details SDS-PAGE # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 12_545 x,x-y-1,-z+1/6 0.5000000000 0.8660254038 0.0000000000 49.0805000000 0.8660254038 -0.5000000000 0.0000000000 -85.0099196609 0.0000000000 0.0000000000 -1.0000000000 33.7383333333 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 26 ? ILE A 34 ? ALA A 26 ILE A 34 1 ? 9 HELX_P HELX_P2 AA2 GLN A 35 ? ARG A 45 ? GLN A 35 ARG A 45 1 ? 11 HELX_P HELX_P3 AA3 PRO A 57 ? GLN A 61 ? PRO A 57 GLN A 61 5 ? 5 HELX_P HELX_P4 AA4 GLY A 73 ? HIS A 87 ? GLY A 73 HIS A 87 1 ? 15 HELX_P HELX_P5 AA5 PRO A 95 ? LEU A 102 ? PRO A 95 LEU A 102 1 ? 8 HELX_P HELX_P6 AA6 ASN A 104 ? GLU A 114 ? ASN A 104 GLU A 114 1 ? 11 HELX_P HELX_P7 AA7 ASP A 135 ? PHE A 142 ? ASP A 135 PHE A 142 1 ? 8 HELX_P HELX_P8 AA8 GLY A 143 ? LEU A 148 ? GLY A 143 LEU A 148 5 ? 6 HELX_P HELX_P9 AA9 HIS A 173 ? LYS A 179 ? HIS A 173 LYS A 179 1 ? 7 HELX_P HELX_P10 AB1 VAL A 190 ? GLY A 193 ? VAL A 190 GLY A 193 5 ? 4 HELX_P HELX_P11 AB2 PRO A 259 ? GLY A 275 ? PRO A 259 GLY A 275 1 ? 17 HELX_P HELX_P12 AB3 GLY A 309 ? HIS A 323 ? GLY A 309 HIS A 323 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 VAL 93 A . ? VAL 93 A ASP 94 A ? ASP 94 A 1 -9.58 2 PHE 150 A . ? PHE 150 A PRO 151 A ? PRO 151 A 1 -14.18 3 PRO 182 A . ? PRO 182 A PRO 183 A ? PRO 183 A 1 -0.13 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 5 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 MET A 47 ? PRO A 51 ? MET A 47 PRO A 51 AA1 2 TYR A 19 ? LEU A 25 ? TYR A 19 LEU A 25 AA1 3 LEU A 66 ? LYS A 70 ? LEU A 66 LYS A 70 AA1 4 ILE A 92 ? VAL A 93 ? ILE A 92 VAL A 93 AA2 1 THR A 124 ? GLY A 126 ? THR A 124 GLY A 126 AA2 2 ARG A 292 ? TYR A 300 ? ARG A 292 TYR A 300 AA2 3 LEU A 278 ? ARG A 285 ? LEU A 278 ARG A 285 AA2 4 PHE A 197 ? VAL A 202 ? PHE A 197 VAL A 202 AA2 5 HIS A 205 ? VAL A 209 ? HIS A 205 VAL A 209 AA3 1 VAL A 131 ? VAL A 133 ? VAL A 131 VAL A 133 AA3 2 LEU A 184 ? GLU A 188 ? LEU A 184 GLU A 188 AA3 3 LEU A 152 ? PRO A 156 ? LEU A 152 PRO A 156 AA3 4 SER A 169 ? VAL A 171 ? SER A 169 VAL A 171 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ASP A 48 ? O ASP A 48 N ILE A 21 ? N ILE A 21 AA1 2 3 N GLY A 22 ? N GLY A 22 O LEU A 66 ? O LEU A 66 AA1 3 4 N LEU A 67 ? N LEU A 67 O VAL A 93 ? O VAL A 93 AA2 1 2 N GLY A 126 ? N GLY A 126 O VAL A 295 ? O VAL A 295 AA2 2 3 O LEU A 294 ? O LEU A 294 N ILE A 284 ? N ILE A 284 AA2 3 4 O PHE A 281 ? O PHE A 281 N VAL A 199 ? N VAL A 199 AA2 4 5 N TYR A 200 ? N TYR A 200 O THR A 207 ? O THR A 207 AA3 1 2 N VAL A 133 ? N VAL A 133 O LEU A 184 ? O LEU A 184 AA3 2 3 O VAL A 185 ? O VAL A 185 N LYS A 155 ? N LYS A 155 AA3 3 4 N ALA A 154 ? N ALA A 154 O SER A 169 ? O SER A 169 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 55 ? ? -98.89 30.24 2 1 GLN A 56 ? ? -172.27 114.41 3 1 ASP A 160 ? ? -168.68 -70.20 4 1 SER A 165 ? ? -62.89 0.71 5 1 HIS A 166 ? ? -96.78 30.28 6 1 ARG A 211 ? ? 177.62 124.06 7 1 PRO A 302 ? ? -69.00 -174.61 # _pdbx_entry_details.entry_id 7TN6 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A SER 3 ? A SER 3 4 1 Y 1 A ASP 4 ? A ASP 4 5 1 Y 1 A ALA 5 ? A ALA 5 6 1 Y 1 A ALA 6 ? A ALA 6 7 1 Y 1 A ALA 7 ? A ALA 7 8 1 Y 1 A GLU 8 ? A GLU 8 9 1 Y 1 A PRO 9 ? A PRO 9 10 1 Y 1 A SER 10 ? A SER 10 11 1 Y 1 A SER 11 ? A SER 11 12 1 Y 1 A GLY 12 ? A GLY 12 13 1 Y 1 A VAL 13 ? A VAL 13 14 1 Y 1 A THR 14 ? A THR 14 15 1 Y 1 A HIS 15 ? A HIS 15 16 1 Y 1 A ALA 119 ? A ALA 119 17 1 Y 1 A ASP 120 ? A ASP 120 18 1 Y 1 A LEU 214 ? A LEU 214 19 1 Y 1 A PRO 215 ? A PRO 215 20 1 Y 1 A ASP 216 ? A ASP 216 21 1 Y 1 A VAL 217 ? A VAL 217 22 1 Y 1 A SER 218 ? A SER 218 23 1 Y 1 A PRO 219 ? A PRO 219 24 1 Y 1 A GLU 220 ? A GLU 220 25 1 Y 1 A ASP 221 ? A ASP 221 26 1 Y 1 A ASP 222 ? A ASP 222 27 1 Y 1 A ALA 223 ? A ALA 223 28 1 Y 1 A SER 224 ? A SER 224 29 1 Y 1 A ALA 225 ? A ALA 225 30 1 Y 1 A GLN 226 ? A GLN 226 31 1 Y 1 A GLY 227 ? A GLY 227 32 1 Y 1 A SER 228 ? A SER 228 33 1 Y 1 A VAL 229 ? A VAL 229 34 1 Y 1 A SER 230 ? A SER 230 35 1 Y 1 A PHE 231 ? A PHE 231 36 1 Y 1 A SER 232 ? A SER 232 37 1 Y 1 A GLN 233 ? A GLN 233 38 1 Y 1 A VAL 234 ? A VAL 234 39 1 Y 1 A SER 235 ? A SER 235 40 1 Y 1 A ASN 236 ? A ASN 236 41 1 Y 1 A LEU 237 ? A LEU 237 42 1 Y 1 A PRO 238 ? A PRO 238 43 1 Y 1 A THR 239 ? A THR 239 44 1 Y 1 A GLU 240 ? A GLU 240 45 1 Y 1 A ARG 241 ? A ARG 241 46 1 Y 1 A THR 242 ? A THR 242 47 1 Y 1 A ALA 243 ? A ALA 243 48 1 Y 1 A GLU 244 ? A GLU 244 49 1 Y 1 A GLU 245 ? A GLU 245 50 1 Y 1 A TYR 246 ? A TYR 246 51 1 Y 1 A TYR 247 ? A TYR 247 52 1 Y 1 A GLY 248 ? A GLY 248 53 1 Y 1 A GLU 249 ? A GLU 249 54 1 Y 1 A LYS 250 ? A LYS 250 55 1 Y 1 A SER 251 ? A SER 251 56 1 Y 1 A LEU 252 ? A LEU 252 57 1 Y 1 A GLU 253 ? A GLU 253 58 1 Y 1 A ASP 254 ? A ASP 254 59 1 Y 1 A ALA 255 ? A ALA 255 60 1 Y 1 A ASP 325 ? A ASP 325 61 1 Y 1 A GLY 326 ? A GLY 326 62 1 Y 1 A VAL 327 ? A VAL 327 63 1 Y 1 A GLY 328 ? A GLY 328 64 1 Y 1 A ASN 329 ? A ASN 329 65 1 Y 1 A GLN 330 ? A GLN 330 66 1 Y 1 A GLN 331 ? A GLN 331 67 1 Y 1 A GLU 332 ? A GLU 332 68 1 Y 1 A GLU 333 ? A GLU 333 69 1 Y 1 A LYS 334 ? A LYS 334 70 1 Y 1 A GLY 335 ? A GLY 335 71 1 Y 1 A ALA 336 ? A ALA 336 72 1 Y 1 A ASN 337 ? A ASN 337 73 1 Y 1 A HIS 338 ? A HIS 338 74 1 Y 1 A VAL 339 ? A VAL 339 75 1 Y 1 A VAL 340 ? A VAL 340 76 1 Y 1 A VAL 341 ? A VAL 341 77 1 Y 1 A LYS 342 ? A LYS 342 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of Environmental Health Sciences (NIH/NIEHS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number '1ZI AES080046-31' _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id CL _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id CL _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _atom_sites.entry_id 7TN6 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.010187 _atom_sites.fract_transf_matrix[1][2] 0.005882 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011763 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004940 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL N O S # loop_