data_7TNC # _entry.id 7TNC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7TNC pdb_00007tnc 10.2210/pdb7tnc/pdb WWPDB D_1000262581 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7TNC _pdbx_database_status.recvd_initial_deposition_date 2022-01-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Liu, Y.' 1 0000-0002-7899-2279 'Lu, Y.' 2 0000-0003-1221-6709 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Inorg.Chem. _citation.journal_id_ASTM INOCAJ _citation.journal_id_CSD 0009 _citation.journal_id_ISSN 0020-1669 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 62 _citation.language ? _citation.page_first 11618 _citation.page_last 11625 _citation.title 'Structural Basis for the Effects of Phenylalanine on Tuning the Reduction Potential of Type 1 Copper in Azurin.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.inorgchem.3c01365 _citation.pdbx_database_id_PubMed 37424080 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, Y.' 1 0000-0002-7899-2279 primary 'Marshall, N.M.' 2 ? primary 'Yu, S.S.' 3 ? primary 'Kim, W.' 4 ? primary 'Gao, Y.G.' 5 ? primary 'Robinson, H.' 6 ? primary 'Nilges, M.J.' 7 ? primary 'Zhang, Y.' 8 0000-0002-9360-5388 primary 'New, S.Y.' 9 0000-0003-4392-3852 primary 'Lu, Y.' 10 0000-0003-1221-6709 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7TNC _cell.details ? _cell.formula_units_Z ? _cell.length_a 49.274 _cell.length_a_esd ? _cell.length_b 73.901 _cell.length_b_esd ? _cell.length_c 77.616 _cell.length_c_esd ? _cell.volume 282634.735 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7TNC _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall 'I 2 2' _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Azurin 14067.899 1 ? 'M13F, G116F' ? ? 2 non-polymer syn 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 122.143 1 ? ? ? ? 3 non-polymer syn 'COPPER (II) ION' 63.546 2 ? ? ? ? 4 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 5 water nat water 18.015 176 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AECSVDIQGNDQFQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRV IAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPFHSALMKGTLTLK ; _entity_poly.pdbx_seq_one_letter_code_can ;AECSVDIQGNDQFQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRV IAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPFHSALMKGTLTLK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 GLU n 1 3 CYS n 1 4 SER n 1 5 VAL n 1 6 ASP n 1 7 ILE n 1 8 GLN n 1 9 GLY n 1 10 ASN n 1 11 ASP n 1 12 GLN n 1 13 PHE n 1 14 GLN n 1 15 PHE n 1 16 ASN n 1 17 THR n 1 18 ASN n 1 19 ALA n 1 20 ILE n 1 21 THR n 1 22 VAL n 1 23 ASP n 1 24 LYS n 1 25 SER n 1 26 CYS n 1 27 LYS n 1 28 GLN n 1 29 PHE n 1 30 THR n 1 31 VAL n 1 32 ASN n 1 33 LEU n 1 34 SER n 1 35 HIS n 1 36 PRO n 1 37 GLY n 1 38 ASN n 1 39 LEU n 1 40 PRO n 1 41 LYS n 1 42 ASN n 1 43 VAL n 1 44 MET n 1 45 GLY n 1 46 HIS n 1 47 ASN n 1 48 TRP n 1 49 VAL n 1 50 LEU n 1 51 SER n 1 52 THR n 1 53 ALA n 1 54 ALA n 1 55 ASP n 1 56 MET n 1 57 GLN n 1 58 GLY n 1 59 VAL n 1 60 VAL n 1 61 THR n 1 62 ASP n 1 63 GLY n 1 64 MET n 1 65 ALA n 1 66 SER n 1 67 GLY n 1 68 LEU n 1 69 ASP n 1 70 LYS n 1 71 ASP n 1 72 TYR n 1 73 LEU n 1 74 LYS n 1 75 PRO n 1 76 ASP n 1 77 ASP n 1 78 SER n 1 79 ARG n 1 80 VAL n 1 81 ILE n 1 82 ALA n 1 83 HIS n 1 84 THR n 1 85 LYS n 1 86 LEU n 1 87 ILE n 1 88 GLY n 1 89 SER n 1 90 GLY n 1 91 GLU n 1 92 LYS n 1 93 ASP n 1 94 SER n 1 95 VAL n 1 96 THR n 1 97 PHE n 1 98 ASP n 1 99 VAL n 1 100 SER n 1 101 LYS n 1 102 LEU n 1 103 LYS n 1 104 GLU n 1 105 GLY n 1 106 GLU n 1 107 GLN n 1 108 TYR n 1 109 MET n 1 110 PHE n 1 111 PHE n 1 112 CYS n 1 113 THR n 1 114 PHE n 1 115 PRO n 1 116 PHE n 1 117 HIS n 1 118 SER n 1 119 ALA n 1 120 LEU n 1 121 MET n 1 122 LYS n 1 123 GLY n 1 124 THR n 1 125 LEU n 1 126 THR n 1 127 LEU n 1 128 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 128 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'azu, PA4922' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 287 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AZUR_PSEAE _struct_ref.pdbx_db_accession P00282 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRV IAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK ; _struct_ref.pdbx_align_begin 21 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7TNC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 128 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00282 _struct_ref_seq.db_align_beg 21 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 148 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 128 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7TNC PHE A 13 ? UNP P00282 MET 33 'engineered mutation' 13 1 1 7TNC PHE A 116 ? UNP P00282 GLY 136 'engineered mutation' 116 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CU non-polymer . 'COPPER (II) ION' ? 'Cu 2' 63.546 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TRS non-polymer . 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 'TRIS BUFFER' 'C4 H12 N O3 1' 122.143 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7TNC _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.51 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.02 _exptl_crystal.description 'Diamond-shaped blue crystals.' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;The 1.4 mM apo-protein was prepared in 100 mM pH=5.6 NaOAc buffer. For each well, add 300 uL reservoir buffer containing 100 mM pH=8.0 Tris-HCl, 10 mM CuSO4 and 20% PEG-4000. 3 uL of protein stock was mixed with 1 uL reservoir buffer on the glass slides and sealed on the wells. Diamond-shaped blue crystals grew within 4 days. ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-12-09 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 5.0.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 5.0.2 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate 14.83 _reflns.entry_id 7TNC _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.47 _reflns.d_resolution_low 41 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 24023 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.0 _reflns.pdbx_Rmerge_I_obs 0.09367 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.87 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.103 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_CC_star 0.999 _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.47 _reflns_shell.d_res_low 1.523 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.70 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2009 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.3451 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.3949 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.891 _reflns_shell.pdbx_CC_star 0.971 _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 22.48 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7TNC _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.47 _refine.ls_d_res_low 41.00 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 24023 _refine.ls_number_reflns_R_free 2350 _refine.ls_number_reflns_R_work 42462 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.11 _refine.ls_percent_reflns_R_free 5.24 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2061 _refine.ls_R_factor_R_free 0.2373 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2044 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4azu _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.0246 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1959 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.47 _refine_hist.d_res_low 41.00 _refine_hist.number_atoms_solvent 176 _refine_hist.number_atoms_total 1171 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 984 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 11 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0058 ? 1028 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.8646 ? 1391 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0812 ? 155 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0042 ? 181 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.6121 ? 375 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.47 1.50 . . 86 1767 67.63 . . . 0.3073 . 0.3001 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.50 1.53 . . 104 2018 77.59 . . . 0.3309 . 0.2925 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.53 1.57 . . 136 2380 92.57 . . . 0.3817 . 0.2782 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.57 1.61 . . 162 2601 99.60 . . . 0.3050 . 0.2773 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.61 1.65 . . 138 2585 99.78 . . . 0.2809 . 0.2642 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.65 1.70 . . 146 2606 99.67 . . . 0.3083 . 0.2573 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.70 1.75 . . 167 2548 99.16 . . . 0.2762 . 0.2707 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.75 1.82 . . 93 2609 99.52 . . . 0.2396 . 0.2528 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.82 1.89 . . 140 2632 99.93 . . . 0.3706 . 0.2514 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.89 1.98 . . 176 2558 99.82 . . . 0.2586 . 0.2335 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.98 2.08 . . 151 2543 99.30 . . . 0.2603 . 0.2193 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.08 2.21 . . 173 2545 99.56 . . . 0.2583 . 0.2094 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.21 2.38 . . 139 2625 100.00 . . . 0.2772 . 0.2128 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.38 2.62 . . 151 2597 99.96 . . . 0.2322 . 0.2055 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.62 3.00 . . 107 2625 99.93 . . . 0.2130 . 0.1814 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.00 3.78 . . 135 2614 100.00 . . . 0.2021 . 0.1679 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.78 41.00 . . 146 2609 99.89 . . . 0.1572 . 0.1497 . . . . . . . . . . . # _struct.entry_id 7TNC _struct.title 'M13F/G116F Pseudomonas aeruginosa azurin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7TNC _struct_keywords.text 'Electron transfer protein, ELECTRON TRANSPORT' _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 40 ? GLY A 45 ? PRO A 40 GLY A 45 1 ? 6 HELX_P HELX_P2 AA2 ASP A 55 ? ALA A 65 ? ASP A 55 ALA A 65 1 ? 11 HELX_P HELX_P3 AA3 SER A 66 ? ASP A 71 ? SER A 66 ASP A 71 5 ? 6 HELX_P HELX_P4 AA4 SER A 100 ? LEU A 102 ? SER A 100 LEU A 102 5 ? 3 HELX_P HELX_P5 AA5 PHE A 116 ? LEU A 120 ? PHE A 116 LEU A 120 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 26 SG ? ? A CYS 3 A CYS 26 1_555 ? ? ? ? ? ? ? 2.043 ? ? metalc1 metalc ? ? A ALA 1 N ? ? ? 1_555 D CU . CU B ? A ALA 1 A CU 203 1_555 ? ? ? ? ? ? ? 2.031 ? ? metalc2 metalc ? ? A ALA 1 O ? ? ? 1_555 D CU . CU B ? A ALA 1 A CU 203 1_555 ? ? ? ? ? ? ? 2.181 ? ? metalc3 metalc ? ? A HIS 46 ND1 ? ? ? 1_555 C CU . CU ? ? A HIS 46 A CU 202 1_555 ? ? ? ? ? ? ? 2.023 ? ? metalc4 metalc ? ? A HIS 83 NE2 ? ? ? 1_555 D CU . CU B ? A HIS 83 A CU 203 8_544 ? ? ? ? ? ? ? 2.487 ? ? metalc5 metalc ? ? A HIS 83 NE2 ? ? ? 1_555 D CU . CU A ? A HIS 83 A CU 203 8_544 ? ? ? ? ? ? ? 1.862 ? ? metalc6 metalc ? ? A CYS 112 SG ? ? ? 1_555 C CU . CU ? ? A CYS 112 A CU 202 1_555 ? ? ? ? ? ? ? 2.267 ? ? metalc7 metalc ? ? A HIS 117 ND1 ? ? ? 1_555 C CU . CU ? ? A HIS 117 A CU 202 1_555 ? ? ? ? ? ? ? 2.032 ? ? metalc8 metalc ? ? B TRS . N ? ? ? 1_555 D CU . CU B ? A TRS 201 A CU 203 8_544 ? ? ? ? ? ? ? 2.281 ? ? metalc9 metalc ? ? B TRS . N ? ? ? 1_555 D CU . CU A ? A TRS 201 A CU 203 8_544 ? ? ? ? ? ? ? 1.846 ? ? metalc10 metalc ? ? B TRS . O3 ? ? ? 1_555 D CU . CU B ? A TRS 201 A CU 203 8_544 ? ? ? ? ? ? ? 2.346 ? ? metalc11 metalc ? ? D CU . CU A ? ? 1_555 F HOH . O ? ? A CU 203 A HOH 332 1_555 ? ? ? ? ? ? ? 2.506 ? ? metalc12 metalc ? ? D CU . CU B ? ? 1_555 F HOH . O ? ? A CU 203 A HOH 332 1_555 ? ? ? ? ? ? ? 2.445 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 4 ? GLN A 8 ? SER A 4 GLN A 8 AA1 2 GLN A 28 ? SER A 34 ? GLN A 28 SER A 34 AA1 3 LYS A 92 ? ASP A 98 ? LYS A 92 ASP A 98 AA2 1 ALA A 19 ? ASP A 23 ? ALA A 19 ASP A 23 AA2 2 LYS A 122 ? LYS A 128 ? LYS A 122 LYS A 128 AA2 3 TYR A 108 ? PHE A 111 ? TYR A 108 PHE A 111 AA2 4 VAL A 49 ? THR A 52 ? VAL A 49 THR A 52 AA2 5 ALA A 82 ? HIS A 83 ? ALA A 82 HIS A 83 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 7 ? N ILE A 7 O ASN A 32 ? O ASN A 32 AA1 2 3 N LEU A 33 ? N LEU A 33 O ASP A 93 ? O ASP A 93 AA2 1 2 N ILE A 20 ? N ILE A 20 O THR A 124 ? O THR A 124 AA2 2 3 O GLY A 123 ? O GLY A 123 N PHE A 110 ? N PHE A 110 AA2 3 4 O MET A 109 ? O MET A 109 N SER A 51 ? N SER A 51 AA2 4 5 N LEU A 50 ? N LEU A 50 O ALA A 82 ? O ALA A 82 # _atom_sites.entry_id 7TNC _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.020295 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013532 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012884 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CL ? ? 9.50761 7.44341 ? ? 1.04373 23.83732 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CU ? ? 23.42449 5.47274 ? ? 2.18335 24.96234 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 MET 44 44 44 MET MET A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 TRP 48 48 48 TRP TRP A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 MET 64 64 64 MET MET A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ASP 71 71 71 ASP ASP A . n A 1 72 TYR 72 72 72 TYR TYR A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 HIS 83 83 83 HIS HIS A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 ILE 87 87 87 ILE ILE A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 ASP 93 93 93 ASP ASP A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 PHE 97 97 97 PHE PHE A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 VAL 99 99 99 VAL VAL A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 GLU 106 106 106 GLU GLU A . n A 1 107 GLN 107 107 107 GLN GLN A . n A 1 108 TYR 108 108 108 TYR TYR A . n A 1 109 MET 109 109 109 MET MET A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 CYS 112 112 112 CYS CYS A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 PHE 116 116 116 PHE PHE A . n A 1 117 HIS 117 117 117 HIS HIS A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 ALA 119 119 119 ALA ALA A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 MET 121 121 121 MET MET A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 THR 126 126 126 THR THR A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 LYS 128 128 128 LYS LYS A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email yi.lu@utexas.edu _pdbx_contact_author.name_first Yi _pdbx_contact_author.name_last Lu _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-1221-6709 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 TRS 1 201 201 TRS TRS A . C 3 CU 1 202 1 CU CU A . D 3 CU 1 203 2 CU CU A . E 4 CL 1 204 1 CL CL A . F 5 HOH 1 301 165 HOH HOH A . F 5 HOH 2 302 132 HOH HOH A . F 5 HOH 3 303 139 HOH HOH A . F 5 HOH 4 304 71 HOH HOH A . F 5 HOH 5 305 66 HOH HOH A . F 5 HOH 6 306 74 HOH HOH A . F 5 HOH 7 307 98 HOH HOH A . F 5 HOH 8 308 18 HOH HOH A . F 5 HOH 9 309 45 HOH HOH A . F 5 HOH 10 310 102 HOH HOH A . F 5 HOH 11 311 174 HOH HOH A . F 5 HOH 12 312 51 HOH HOH A . F 5 HOH 13 313 170 HOH HOH A . F 5 HOH 14 314 27 HOH HOH A . F 5 HOH 15 315 137 HOH HOH A . F 5 HOH 16 316 2 HOH HOH A . F 5 HOH 17 317 21 HOH HOH A . F 5 HOH 18 318 80 HOH HOH A . F 5 HOH 19 319 32 HOH HOH A . F 5 HOH 20 320 33 HOH HOH A . F 5 HOH 21 321 62 HOH HOH A . F 5 HOH 22 322 30 HOH HOH A . F 5 HOH 23 323 160 HOH HOH A . F 5 HOH 24 324 129 HOH HOH A . F 5 HOH 25 325 16 HOH HOH A . F 5 HOH 26 326 88 HOH HOH A . F 5 HOH 27 327 94 HOH HOH A . F 5 HOH 28 328 53 HOH HOH A . F 5 HOH 29 329 37 HOH HOH A . F 5 HOH 30 330 95 HOH HOH A . F 5 HOH 31 331 3 HOH HOH A . F 5 HOH 32 332 23 HOH HOH A . F 5 HOH 33 333 31 HOH HOH A . F 5 HOH 34 334 86 HOH HOH A . F 5 HOH 35 335 93 HOH HOH A . F 5 HOH 36 336 44 HOH HOH A . F 5 HOH 37 337 24 HOH HOH A . F 5 HOH 38 338 43 HOH HOH A . F 5 HOH 39 339 79 HOH HOH A . F 5 HOH 40 340 29 HOH HOH A . F 5 HOH 41 341 11 HOH HOH A . F 5 HOH 42 342 1 HOH HOH A . F 5 HOH 43 343 168 HOH HOH A . F 5 HOH 44 344 9 HOH HOH A . F 5 HOH 45 345 60 HOH HOH A . F 5 HOH 46 346 26 HOH HOH A . F 5 HOH 47 347 100 HOH HOH A . F 5 HOH 48 348 166 HOH HOH A . F 5 HOH 49 349 70 HOH HOH A . F 5 HOH 50 350 134 HOH HOH A . F 5 HOH 51 351 55 HOH HOH A . F 5 HOH 52 352 8 HOH HOH A . F 5 HOH 53 353 108 HOH HOH A . F 5 HOH 54 354 36 HOH HOH A . F 5 HOH 55 355 159 HOH HOH A . F 5 HOH 56 356 156 HOH HOH A . F 5 HOH 57 357 110 HOH HOH A . F 5 HOH 58 358 81 HOH HOH A . F 5 HOH 59 359 76 HOH HOH A . F 5 HOH 60 360 4 HOH HOH A . F 5 HOH 61 361 112 HOH HOH A . F 5 HOH 62 362 22 HOH HOH A . F 5 HOH 63 363 90 HOH HOH A . F 5 HOH 64 364 6 HOH HOH A . F 5 HOH 65 365 64 HOH HOH A . F 5 HOH 66 366 14 HOH HOH A . F 5 HOH 67 367 69 HOH HOH A . F 5 HOH 68 368 141 HOH HOH A . F 5 HOH 69 369 67 HOH HOH A . F 5 HOH 70 370 103 HOH HOH A . F 5 HOH 71 371 91 HOH HOH A . F 5 HOH 72 372 116 HOH HOH A . F 5 HOH 73 373 82 HOH HOH A . F 5 HOH 74 374 133 HOH HOH A . F 5 HOH 75 375 12 HOH HOH A . F 5 HOH 76 376 77 HOH HOH A . F 5 HOH 77 377 130 HOH HOH A . F 5 HOH 78 378 87 HOH HOH A . F 5 HOH 79 379 41 HOH HOH A . F 5 HOH 80 380 150 HOH HOH A . F 5 HOH 81 381 83 HOH HOH A . F 5 HOH 82 382 20 HOH HOH A . F 5 HOH 83 383 117 HOH HOH A . F 5 HOH 84 384 115 HOH HOH A . F 5 HOH 85 385 122 HOH HOH A . F 5 HOH 86 386 40 HOH HOH A . F 5 HOH 87 387 52 HOH HOH A . F 5 HOH 88 388 124 HOH HOH A . F 5 HOH 89 389 61 HOH HOH A . F 5 HOH 90 390 17 HOH HOH A . F 5 HOH 91 391 120 HOH HOH A . F 5 HOH 92 392 180 HOH HOH A . F 5 HOH 93 393 142 HOH HOH A . F 5 HOH 94 394 127 HOH HOH A . F 5 HOH 95 395 50 HOH HOH A . F 5 HOH 96 396 38 HOH HOH A . F 5 HOH 97 397 46 HOH HOH A . F 5 HOH 98 398 123 HOH HOH A . F 5 HOH 99 399 25 HOH HOH A . F 5 HOH 100 400 19 HOH HOH A . F 5 HOH 101 401 171 HOH HOH A . F 5 HOH 102 402 155 HOH HOH A . F 5 HOH 103 403 47 HOH HOH A . F 5 HOH 104 404 78 HOH HOH A . F 5 HOH 105 405 5 HOH HOH A . F 5 HOH 106 406 42 HOH HOH A . F 5 HOH 107 407 175 HOH HOH A . F 5 HOH 108 408 48 HOH HOH A . F 5 HOH 109 409 154 HOH HOH A . F 5 HOH 110 410 140 HOH HOH A . F 5 HOH 111 411 7 HOH HOH A . F 5 HOH 112 412 146 HOH HOH A . F 5 HOH 113 413 13 HOH HOH A . F 5 HOH 114 414 131 HOH HOH A . F 5 HOH 115 415 147 HOH HOH A . F 5 HOH 116 416 144 HOH HOH A . F 5 HOH 117 417 65 HOH HOH A . F 5 HOH 118 418 73 HOH HOH A . F 5 HOH 119 419 101 HOH HOH A . F 5 HOH 120 420 97 HOH HOH A . F 5 HOH 121 421 167 HOH HOH A . F 5 HOH 122 422 113 HOH HOH A . F 5 HOH 123 423 173 HOH HOH A . F 5 HOH 124 424 162 HOH HOH A . F 5 HOH 125 425 15 HOH HOH A . F 5 HOH 126 426 49 HOH HOH A . F 5 HOH 127 427 172 HOH HOH A . F 5 HOH 128 428 92 HOH HOH A . F 5 HOH 129 429 128 HOH HOH A . F 5 HOH 130 430 114 HOH HOH A . F 5 HOH 131 431 106 HOH HOH A . F 5 HOH 132 432 10 HOH HOH A . F 5 HOH 133 433 63 HOH HOH A . F 5 HOH 134 434 96 HOH HOH A . F 5 HOH 135 435 178 HOH HOH A . F 5 HOH 136 436 169 HOH HOH A . F 5 HOH 137 437 89 HOH HOH A . F 5 HOH 138 438 143 HOH HOH A . F 5 HOH 139 439 39 HOH HOH A . F 5 HOH 140 440 164 HOH HOH A . F 5 HOH 141 441 107 HOH HOH A . F 5 HOH 142 442 59 HOH HOH A . F 5 HOH 143 443 54 HOH HOH A . F 5 HOH 144 444 145 HOH HOH A . F 5 HOH 145 445 35 HOH HOH A . F 5 HOH 146 446 118 HOH HOH A . F 5 HOH 147 447 28 HOH HOH A . F 5 HOH 148 448 179 HOH HOH A . F 5 HOH 149 449 121 HOH HOH A . F 5 HOH 150 450 149 HOH HOH A . F 5 HOH 151 451 34 HOH HOH A . F 5 HOH 152 452 68 HOH HOH A . F 5 HOH 153 453 57 HOH HOH A . F 5 HOH 154 454 109 HOH HOH A . F 5 HOH 155 455 125 HOH HOH A . F 5 HOH 156 456 152 HOH HOH A . F 5 HOH 157 457 158 HOH HOH A . F 5 HOH 158 458 84 HOH HOH A . F 5 HOH 159 459 136 HOH HOH A . F 5 HOH 160 460 58 HOH HOH A . F 5 HOH 161 461 105 HOH HOH A . F 5 HOH 162 462 72 HOH HOH A . F 5 HOH 163 463 151 HOH HOH A . F 5 HOH 164 464 135 HOH HOH A . F 5 HOH 165 465 157 HOH HOH A . F 5 HOH 166 466 56 HOH HOH A . F 5 HOH 167 467 177 HOH HOH A . F 5 HOH 168 468 138 HOH HOH A . F 5 HOH 169 469 75 HOH HOH A . F 5 HOH 170 470 104 HOH HOH A . F 5 HOH 171 471 163 HOH HOH A . F 5 HOH 172 472 85 HOH HOH A . F 5 HOH 173 473 126 HOH HOH A . F 5 HOH 174 474 99 HOH HOH A . F 5 HOH 175 475 148 HOH HOH A . F 5 HOH 176 476 153 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6190 ? 1 MORE -50 ? 1 'SSA (A^2)' 22090 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_455 -x-1,-y,z -1.0000000000 0.0000000000 0.0000000000 -49.2740000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_455 -x-1,y,-z -1.0000000000 0.0000000000 0.0000000000 -49.2740000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id CL _pdbx_struct_special_symmetry.auth_seq_id 204 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id E _pdbx_struct_special_symmetry.label_comp_id CL _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 N ? A ALA 1 ? A ALA 1 ? 1_555 CU B D CU . ? A CU 203 ? 1_555 O ? A ALA 1 ? A ALA 1 ? 1_555 80.6 ? 2 N ? A ALA 1 ? A ALA 1 ? 1_555 CU B D CU . ? A CU 203 ? 1_555 NE2 ? A HIS 83 ? A HIS 83 ? 1_555 123.5 ? 3 O ? A ALA 1 ? A ALA 1 ? 1_555 CU B D CU . ? A CU 203 ? 1_555 NE2 ? A HIS 83 ? A HIS 83 ? 1_555 51.6 ? 4 N ? A ALA 1 ? A ALA 1 ? 1_555 CU B D CU . ? A CU 203 ? 1_555 N ? B TRS . ? A TRS 201 ? 1_555 127.3 ? 5 O ? A ALA 1 ? A ALA 1 ? 1_555 CU B D CU . ? A CU 203 ? 1_555 N ? B TRS . ? A TRS 201 ? 1_555 56.8 ? 6 NE2 ? A HIS 83 ? A HIS 83 ? 1_555 CU B D CU . ? A CU 203 ? 1_555 N ? B TRS . ? A TRS 201 ? 1_555 5.2 ? 7 N ? A ALA 1 ? A ALA 1 ? 1_555 CU B D CU . ? A CU 203 ? 1_555 O3 ? B TRS . ? A TRS 201 ? 1_555 125.4 ? 8 O ? A ALA 1 ? A ALA 1 ? 1_555 CU B D CU . ? A CU 203 ? 1_555 O3 ? B TRS . ? A TRS 201 ? 1_555 58.2 ? 9 NE2 ? A HIS 83 ? A HIS 83 ? 1_555 CU B D CU . ? A CU 203 ? 1_555 O3 ? B TRS . ? A TRS 201 ? 1_555 7.8 ? 10 N ? B TRS . ? A TRS 201 ? 1_555 CU B D CU . ? A CU 203 ? 1_555 O3 ? B TRS . ? A TRS 201 ? 1_555 4.3 ? 11 N ? A ALA 1 ? A ALA 1 ? 1_555 CU B D CU . ? A CU 203 ? 1_555 O ? F HOH . ? A HOH 332 ? 1_555 108.0 ? 12 O ? A ALA 1 ? A ALA 1 ? 1_555 CU B D CU . ? A CU 203 ? 1_555 O ? F HOH . ? A HOH 332 ? 1_555 87.4 ? 13 NE2 ? A HIS 83 ? A HIS 83 ? 1_555 CU B D CU . ? A CU 203 ? 1_555 O ? F HOH . ? A HOH 332 ? 1_555 50.4 ? 14 N ? B TRS . ? A TRS 201 ? 1_555 CU B D CU . ? A CU 203 ? 1_555 O ? F HOH . ? A HOH 332 ? 1_555 47.3 ? 15 O3 ? B TRS . ? A TRS 201 ? 1_555 CU B D CU . ? A CU 203 ? 1_555 O ? F HOH . ? A HOH 332 ? 1_555 43.2 ? 16 ND1 ? A HIS 46 ? A HIS 46 ? 1_555 CU ? C CU . ? A CU 202 ? 1_555 SG ? A CYS 112 ? A CYS 112 ? 1_555 130.6 ? 17 ND1 ? A HIS 46 ? A HIS 46 ? 1_555 CU ? C CU . ? A CU 202 ? 1_555 ND1 ? A HIS 117 ? A HIS 117 ? 1_555 105.7 ? 18 SG ? A CYS 112 ? A CYS 112 ? 1_555 CU ? C CU . ? A CU 202 ? 1_555 ND1 ? A HIS 117 ? A HIS 117 ? 1_555 122.4 ? 19 NE2 ? A HIS 83 ? A HIS 83 ? 1_555 CU A D CU . ? A CU 203 ? 8_544 N ? B TRS . ? A TRS 201 ? 1_555 142.1 ? 20 NE2 ? A HIS 83 ? A HIS 83 ? 1_555 CU A D CU . ? A CU 203 ? 8_544 O ? F HOH . ? A HOH 332 ? 1_555 32.4 ? 21 N ? B TRS . ? A TRS 201 ? 1_555 CU A D CU . ? A CU 203 ? 8_544 O ? F HOH . ? A HOH 332 ? 1_555 115.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-01-25 2 'Structure model' 1 1 2023-07-26 3 'Structure model' 1 2 2023-08-02 4 'Structure model' 1 3 2023-10-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_citation.journal_volume' 11 3 'Structure model' '_citation.page_first' 12 3 'Structure model' '_citation.page_last' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z 4 -x,-y,z 5 x+1/2,y+1/2,z+1/2 6 x+1/2,-y+1/2,-z+1/2 7 -x+1/2,y+1/2,-z+1/2 8 -x+1/2,-y+1/2,z+1/2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? DIALS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _pdbx_entry_details.entry_id 7TNC _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 372 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 372 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 2_555 _pdbx_validate_symm_contact.dist 2.08 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 10 ? ? -117.14 -169.02 2 1 MET A 44 ? ? -146.16 39.95 3 1 PHE A 116 ? ? 79.83 -12.89 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 476 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 7.77 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CU CU CU N N 75 CYS N N N N 76 CYS CA C N R 77 CYS C C N N 78 CYS O O N N 79 CYS CB C N N 80 CYS SG S N N 81 CYS OXT O N N 82 CYS H H N N 83 CYS H2 H N N 84 CYS HA H N N 85 CYS HB2 H N N 86 CYS HB3 H N N 87 CYS HG H N N 88 CYS HXT H N N 89 GLN N N N N 90 GLN CA C N S 91 GLN C C N N 92 GLN O O N N 93 GLN CB C N N 94 GLN CG C N N 95 GLN CD C N N 96 GLN OE1 O N N 97 GLN NE2 N N N 98 GLN OXT O N N 99 GLN H H N N 100 GLN H2 H N N 101 GLN HA H N N 102 GLN HB2 H N N 103 GLN HB3 H N N 104 GLN HG2 H N N 105 GLN HG3 H N N 106 GLN HE21 H N N 107 GLN HE22 H N N 108 GLN HXT H N N 109 GLU N N N N 110 GLU CA C N S 111 GLU C C N N 112 GLU O O N N 113 GLU CB C N N 114 GLU CG C N N 115 GLU CD C N N 116 GLU OE1 O N N 117 GLU OE2 O N N 118 GLU OXT O N N 119 GLU H H N N 120 GLU H2 H N N 121 GLU HA H N N 122 GLU HB2 H N N 123 GLU HB3 H N N 124 GLU HG2 H N N 125 GLU HG3 H N N 126 GLU HE2 H N N 127 GLU HXT H N N 128 GLY N N N N 129 GLY CA C N N 130 GLY C C N N 131 GLY O O N N 132 GLY OXT O N N 133 GLY H H N N 134 GLY H2 H N N 135 GLY HA2 H N N 136 GLY HA3 H N N 137 GLY HXT H N N 138 HIS N N N N 139 HIS CA C N S 140 HIS C C N N 141 HIS O O N N 142 HIS CB C N N 143 HIS CG C Y N 144 HIS ND1 N Y N 145 HIS CD2 C Y N 146 HIS CE1 C Y N 147 HIS NE2 N Y N 148 HIS OXT O N N 149 HIS H H N N 150 HIS H2 H N N 151 HIS HA H N N 152 HIS HB2 H N N 153 HIS HB3 H N N 154 HIS HD1 H N N 155 HIS HD2 H N N 156 HIS HE1 H N N 157 HIS HE2 H N N 158 HIS HXT H N N 159 HOH O O N N 160 HOH H1 H N N 161 HOH H2 H N N 162 ILE N N N N 163 ILE CA C N S 164 ILE C C N N 165 ILE O O N N 166 ILE CB C N S 167 ILE CG1 C N N 168 ILE CG2 C N N 169 ILE CD1 C N N 170 ILE OXT O N N 171 ILE H H N N 172 ILE H2 H N N 173 ILE HA H N N 174 ILE HB H N N 175 ILE HG12 H N N 176 ILE HG13 H N N 177 ILE HG21 H N N 178 ILE HG22 H N N 179 ILE HG23 H N N 180 ILE HD11 H N N 181 ILE HD12 H N N 182 ILE HD13 H N N 183 ILE HXT H N N 184 LEU N N N N 185 LEU CA C N S 186 LEU C C N N 187 LEU O O N N 188 LEU CB C N N 189 LEU CG C N N 190 LEU CD1 C N N 191 LEU CD2 C N N 192 LEU OXT O N N 193 LEU H H N N 194 LEU H2 H N N 195 LEU HA H N N 196 LEU HB2 H N N 197 LEU HB3 H N N 198 LEU HG H N N 199 LEU HD11 H N N 200 LEU HD12 H N N 201 LEU HD13 H N N 202 LEU HD21 H N N 203 LEU HD22 H N N 204 LEU HD23 H N N 205 LEU HXT H N N 206 LYS N N N N 207 LYS CA C N S 208 LYS C C N N 209 LYS O O N N 210 LYS CB C N N 211 LYS CG C N N 212 LYS CD C N N 213 LYS CE C N N 214 LYS NZ N N N 215 LYS OXT O N N 216 LYS H H N N 217 LYS H2 H N N 218 LYS HA H N N 219 LYS HB2 H N N 220 LYS HB3 H N N 221 LYS HG2 H N N 222 LYS HG3 H N N 223 LYS HD2 H N N 224 LYS HD3 H N N 225 LYS HE2 H N N 226 LYS HE3 H N N 227 LYS HZ1 H N N 228 LYS HZ2 H N N 229 LYS HZ3 H N N 230 LYS HXT H N N 231 MET N N N N 232 MET CA C N S 233 MET C C N N 234 MET O O N N 235 MET CB C N N 236 MET CG C N N 237 MET SD S N N 238 MET CE C N N 239 MET OXT O N N 240 MET H H N N 241 MET H2 H N N 242 MET HA H N N 243 MET HB2 H N N 244 MET HB3 H N N 245 MET HG2 H N N 246 MET HG3 H N N 247 MET HE1 H N N 248 MET HE2 H N N 249 MET HE3 H N N 250 MET HXT H N N 251 PHE N N N N 252 PHE CA C N S 253 PHE C C N N 254 PHE O O N N 255 PHE CB C N N 256 PHE CG C Y N 257 PHE CD1 C Y N 258 PHE CD2 C Y N 259 PHE CE1 C Y N 260 PHE CE2 C Y N 261 PHE CZ C Y N 262 PHE OXT O N N 263 PHE H H N N 264 PHE H2 H N N 265 PHE HA H N N 266 PHE HB2 H N N 267 PHE HB3 H N N 268 PHE HD1 H N N 269 PHE HD2 H N N 270 PHE HE1 H N N 271 PHE HE2 H N N 272 PHE HZ H N N 273 PHE HXT H N N 274 PRO N N N N 275 PRO CA C N S 276 PRO C C N N 277 PRO O O N N 278 PRO CB C N N 279 PRO CG C N N 280 PRO CD C N N 281 PRO OXT O N N 282 PRO H H N N 283 PRO HA H N N 284 PRO HB2 H N N 285 PRO HB3 H N N 286 PRO HG2 H N N 287 PRO HG3 H N N 288 PRO HD2 H N N 289 PRO HD3 H N N 290 PRO HXT H N N 291 SER N N N N 292 SER CA C N S 293 SER C C N N 294 SER O O N N 295 SER CB C N N 296 SER OG O N N 297 SER OXT O N N 298 SER H H N N 299 SER H2 H N N 300 SER HA H N N 301 SER HB2 H N N 302 SER HB3 H N N 303 SER HG H N N 304 SER HXT H N N 305 THR N N N N 306 THR CA C N S 307 THR C C N N 308 THR O O N N 309 THR CB C N R 310 THR OG1 O N N 311 THR CG2 C N N 312 THR OXT O N N 313 THR H H N N 314 THR H2 H N N 315 THR HA H N N 316 THR HB H N N 317 THR HG1 H N N 318 THR HG21 H N N 319 THR HG22 H N N 320 THR HG23 H N N 321 THR HXT H N N 322 TRP N N N N 323 TRP CA C N S 324 TRP C C N N 325 TRP O O N N 326 TRP CB C N N 327 TRP CG C Y N 328 TRP CD1 C Y N 329 TRP CD2 C Y N 330 TRP NE1 N Y N 331 TRP CE2 C Y N 332 TRP CE3 C Y N 333 TRP CZ2 C Y N 334 TRP CZ3 C Y N 335 TRP CH2 C Y N 336 TRP OXT O N N 337 TRP H H N N 338 TRP H2 H N N 339 TRP HA H N N 340 TRP HB2 H N N 341 TRP HB3 H N N 342 TRP HD1 H N N 343 TRP HE1 H N N 344 TRP HE3 H N N 345 TRP HZ2 H N N 346 TRP HZ3 H N N 347 TRP HH2 H N N 348 TRP HXT H N N 349 TRS C C N N 350 TRS C1 C N N 351 TRS C2 C N N 352 TRS C3 C N N 353 TRS N N N N 354 TRS O1 O N N 355 TRS O2 O N N 356 TRS O3 O N N 357 TRS H11 H N N 358 TRS H12 H N N 359 TRS H21 H N N 360 TRS H22 H N N 361 TRS H31 H N N 362 TRS H32 H N N 363 TRS HN1 H N N 364 TRS HN2 H N N 365 TRS HN3 H N N 366 TRS HO1 H N N 367 TRS HO2 H N N 368 TRS HO3 H N N 369 TYR N N N N 370 TYR CA C N S 371 TYR C C N N 372 TYR O O N N 373 TYR CB C N N 374 TYR CG C Y N 375 TYR CD1 C Y N 376 TYR CD2 C Y N 377 TYR CE1 C Y N 378 TYR CE2 C Y N 379 TYR CZ C Y N 380 TYR OH O N N 381 TYR OXT O N N 382 TYR H H N N 383 TYR H2 H N N 384 TYR HA H N N 385 TYR HB2 H N N 386 TYR HB3 H N N 387 TYR HD1 H N N 388 TYR HD2 H N N 389 TYR HE1 H N N 390 TYR HE2 H N N 391 TYR HH H N N 392 TYR HXT H N N 393 VAL N N N N 394 VAL CA C N S 395 VAL C C N N 396 VAL O O N N 397 VAL CB C N N 398 VAL CG1 C N N 399 VAL CG2 C N N 400 VAL OXT O N N 401 VAL H H N N 402 VAL H2 H N N 403 VAL HA H N N 404 VAL HB H N N 405 VAL HG11 H N N 406 VAL HG12 H N N 407 VAL HG13 H N N 408 VAL HG21 H N N 409 VAL HG22 H N N 410 VAL HG23 H N N 411 VAL HXT H N N 412 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TRS C C1 sing N N 334 TRS C C2 sing N N 335 TRS C C3 sing N N 336 TRS C N sing N N 337 TRS C1 O1 sing N N 338 TRS C1 H11 sing N N 339 TRS C1 H12 sing N N 340 TRS C2 O2 sing N N 341 TRS C2 H21 sing N N 342 TRS C2 H22 sing N N 343 TRS C3 O3 sing N N 344 TRS C3 H31 sing N N 345 TRS C3 H32 sing N N 346 TRS N HN1 sing N N 347 TRS N HN2 sing N N 348 TRS N HN3 sing N N 349 TRS O1 HO1 sing N N 350 TRS O2 HO2 sing N N 351 TRS O3 HO3 sing N N 352 TYR N CA sing N N 353 TYR N H sing N N 354 TYR N H2 sing N N 355 TYR CA C sing N N 356 TYR CA CB sing N N 357 TYR CA HA sing N N 358 TYR C O doub N N 359 TYR C OXT sing N N 360 TYR CB CG sing N N 361 TYR CB HB2 sing N N 362 TYR CB HB3 sing N N 363 TYR CG CD1 doub Y N 364 TYR CG CD2 sing Y N 365 TYR CD1 CE1 sing Y N 366 TYR CD1 HD1 sing N N 367 TYR CD2 CE2 doub Y N 368 TYR CD2 HD2 sing N N 369 TYR CE1 CZ doub Y N 370 TYR CE1 HE1 sing N N 371 TYR CE2 CZ sing Y N 372 TYR CE2 HE2 sing N N 373 TYR CZ OH sing N N 374 TYR OH HH sing N N 375 TYR OXT HXT sing N N 376 VAL N CA sing N N 377 VAL N H sing N N 378 VAL N H2 sing N N 379 VAL CA C sing N N 380 VAL CA CB sing N N 381 VAL CA HA sing N N 382 VAL C O doub N N 383 VAL C OXT sing N N 384 VAL CB CG1 sing N N 385 VAL CB CG2 sing N N 386 VAL CB HB sing N N 387 VAL CG1 HG11 sing N N 388 VAL CG1 HG12 sing N N 389 VAL CG1 HG13 sing N N 390 VAL CG2 HG21 sing N N 391 VAL CG2 HG22 sing N N 392 VAL CG2 HG23 sing N N 393 VAL OXT HXT sing N N 394 # _pdbx_audit_support.funding_organization 'National Science Foundation (NSF, United States)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 1726244 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id CU _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id CU _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL TRS 3 'COPPER (II) ION' CU 4 'CHLORIDE ION' CL 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4AZU _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'I 2 2 2' _space_group.name_Hall 'I 2 2' _space_group.IT_number 23 _space_group.crystal_system orthorhombic _space_group.id 1 #