data_7U2U # _entry.id 7U2U # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7U2U pdb_00007u2u 10.2210/pdb7u2u/pdb WWPDB D_1000263443 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7U2U _pdbx_database_status.recvd_initial_deposition_date 2022-02-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Khan, J.A.' 1 ? 'lewis, H.' 2 ? 'Kish, K.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Bioorg.Med.Chem. _citation.journal_id_ASTM BMECEP _citation.journal_id_CSD 1200 _citation.journal_id_ISSN 1464-3391 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 67 _citation.language ? _citation.page_first 116833 _citation.page_last 116833 _citation.title 'Scaffold modifications to the 4-(4,4-dimethylpiperidinyl) 2,6-dimethylpyridinyl class of HIV-1 allosteric integrase inhibitors.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.bmc.2022.116833 _citation.pdbx_database_id_PubMed 35605346 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Parcella, K.' 1 ? primary 'Patel, M.' 2 ? primary 'Tu, Y.' 3 ? primary 'Eastman, K.' 4 ? primary 'Peese, K.' 5 ? primary 'Gillis, E.' 6 ? primary 'Belema, M.' 7 ? primary 'Dicker, I.B.' 8 ? primary 'McAuliffe, B.' 9 ? primary 'Ding, B.' 10 ? primary 'Falk, P.' 11 ? primary 'Simmermacher, J.' 12 ? primary 'Parker, D.D.' 13 ? primary 'Sivaprakasam, P.' 14 ? primary 'Khan, J.A.' 15 ? primary 'Kish, K.' 16 ? primary 'Lewis, H.' 17 ? primary 'Hanumegowda, U.' 18 ? primary 'Jenkins, S.' 19 ? primary 'Kadow, J.F.' 20 ? primary 'Krystal, M.' 21 ? primary 'Meanwell, N.A.' 22 ? primary 'Naidu, B.N.' 23 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7U2U _cell.details ? _cell.formula_units_Z ? _cell.length_a 71.421 _cell.length_a_esd ? _cell.length_b 71.421 _cell.length_b_esd ? _cell.length_c 67.130 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7U2U _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Integrase 19685.273 1 ? ? ? ? 2 non-polymer syn ;(2S)-tert-butoxy[(4S)-7-(4,4-dimethylpiperidin-1-yl)-8-{4-[2-(4-fluorophenyl)ethoxy]phenyl}-2,5-dimethylimidazo[1,2-a]pyridin-6-yl]acetic acid ; 601.751 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 3 ? ? ? ? 4 water nat water 18.015 51 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMHGQVDSSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWP VKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKG GIGGYSAGERIVDIIATDIQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMHGQVDSSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWP VKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKG GIGGYSAGERIVDIIATDIQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 HIS n 1 23 GLY n 1 24 GLN n 1 25 VAL n 1 26 ASP n 1 27 SER n 1 28 SER n 1 29 PRO n 1 30 GLY n 1 31 ILE n 1 32 TRP n 1 33 GLN n 1 34 LEU n 1 35 ASP n 1 36 CYS n 1 37 THR n 1 38 HIS n 1 39 LEU n 1 40 GLU n 1 41 GLY n 1 42 LYS n 1 43 VAL n 1 44 ILE n 1 45 LEU n 1 46 VAL n 1 47 ALA n 1 48 VAL n 1 49 HIS n 1 50 VAL n 1 51 ALA n 1 52 SER n 1 53 GLY n 1 54 TYR n 1 55 ILE n 1 56 GLU n 1 57 ALA n 1 58 GLU n 1 59 VAL n 1 60 ILE n 1 61 PRO n 1 62 ALA n 1 63 GLU n 1 64 THR n 1 65 GLY n 1 66 GLN n 1 67 GLU n 1 68 THR n 1 69 ALA n 1 70 TYR n 1 71 PHE n 1 72 LEU n 1 73 LEU n 1 74 LYS n 1 75 LEU n 1 76 ALA n 1 77 GLY n 1 78 ARG n 1 79 TRP n 1 80 PRO n 1 81 VAL n 1 82 LYS n 1 83 THR n 1 84 VAL n 1 85 HIS n 1 86 THR n 1 87 ASP n 1 88 ASN n 1 89 GLY n 1 90 SER n 1 91 ASN n 1 92 PHE n 1 93 THR n 1 94 SER n 1 95 THR n 1 96 THR n 1 97 VAL n 1 98 LYS n 1 99 ALA n 1 100 ALA n 1 101 CYS n 1 102 TRP n 1 103 TRP n 1 104 ALA n 1 105 GLY n 1 106 ILE n 1 107 LYS n 1 108 GLN n 1 109 GLU n 1 110 ASP n 1 111 GLY n 1 112 ILE n 1 113 PRO n 1 114 TYR n 1 115 ASN n 1 116 PRO n 1 117 GLN n 1 118 SER n 1 119 GLN n 1 120 GLY n 1 121 VAL n 1 122 ILE n 1 123 GLU n 1 124 SER n 1 125 MET n 1 126 ASN n 1 127 LYS n 1 128 GLU n 1 129 LEU n 1 130 LYS n 1 131 LYS n 1 132 ILE n 1 133 ILE n 1 134 GLY n 1 135 GLN n 1 136 VAL n 1 137 ARG n 1 138 ASP n 1 139 GLN n 1 140 ALA n 1 141 GLU n 1 142 HIS n 1 143 LEU n 1 144 LYS n 1 145 THR n 1 146 ALA n 1 147 VAL n 1 148 GLN n 1 149 MET n 1 150 ALA n 1 151 VAL n 1 152 PHE n 1 153 ILE n 1 154 HIS n 1 155 ASN n 1 156 HIS n 1 157 LYS n 1 158 ARG n 1 159 LYS n 1 160 GLY n 1 161 GLY n 1 162 ILE n 1 163 GLY n 1 164 GLY n 1 165 TYR n 1 166 SER n 1 167 ALA n 1 168 GLY n 1 169 GLU n 1 170 ARG n 1 171 ILE n 1 172 VAL n 1 173 ASP n 1 174 ILE n 1 175 ILE n 1 176 ALA n 1 177 THR n 1 178 ASP n 1 179 ILE n 1 180 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 180 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human immunodeficiency virus 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11676 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET15b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q76353_9HIV1 _struct_ref.pdbx_db_accession Q76353 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAA CWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQ ; _struct_ref.pdbx_align_begin 50 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7U2U _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 21 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 180 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q76353 _struct_ref_seq.db_align_beg 50 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 209 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 50 _struct_ref_seq.pdbx_auth_seq_align_end 209 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7U2U MET A 1 ? UNP Q76353 ? ? 'expression tag' 30 1 1 7U2U GLY A 2 ? UNP Q76353 ? ? 'expression tag' 31 2 1 7U2U SER A 3 ? UNP Q76353 ? ? 'expression tag' 32 3 1 7U2U SER A 4 ? UNP Q76353 ? ? 'expression tag' 33 4 1 7U2U HIS A 5 ? UNP Q76353 ? ? 'expression tag' 34 5 1 7U2U HIS A 6 ? UNP Q76353 ? ? 'expression tag' 35 6 1 7U2U HIS A 7 ? UNP Q76353 ? ? 'expression tag' 36 7 1 7U2U HIS A 8 ? UNP Q76353 ? ? 'expression tag' 37 8 1 7U2U HIS A 9 ? UNP Q76353 ? ? 'expression tag' 38 9 1 7U2U HIS A 10 ? UNP Q76353 ? ? 'expression tag' 39 10 1 7U2U SER A 11 ? UNP Q76353 ? ? 'expression tag' 40 11 1 7U2U SER A 12 ? UNP Q76353 ? ? 'expression tag' 41 12 1 7U2U GLY A 13 ? UNP Q76353 ? ? 'expression tag' 42 13 1 7U2U LEU A 14 ? UNP Q76353 ? ? 'expression tag' 43 14 1 7U2U VAL A 15 ? UNP Q76353 ? ? 'expression tag' 44 15 1 7U2U PRO A 16 ? UNP Q76353 ? ? 'expression tag' 45 16 1 7U2U ARG A 17 ? UNP Q76353 ? ? 'expression tag' 46 17 1 7U2U GLY A 18 ? UNP Q76353 ? ? 'expression tag' 47 18 1 7U2U SER A 19 ? UNP Q76353 ? ? 'expression tag' 48 19 1 7U2U HIS A 20 ? UNP Q76353 ? ? 'expression tag' 49 20 1 7U2U SER A 27 ? UNP Q76353 CYS 56 conflict 56 21 1 7U2U ASP A 110 ? UNP Q76353 PHE 139 conflict 139 22 1 7U2U HIS A 156 ? UNP Q76353 PHE 185 conflict 185 23 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 KZD non-polymer . ;(2S)-tert-butoxy[(4S)-7-(4,4-dimethylpiperidin-1-yl)-8-{4-[2-(4-fluorophenyl)ethoxy]phenyl}-2,5-dimethylimidazo[1,2-a]pyridin-6-yl]acetic acid ; ? 'C36 H44 F N3 O4' 601.751 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7U2U _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.51 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.01 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2-0.18M Ammonium Sulfate, 100mM Na acetate pH 4.6-5.0' _exptl_crystal_grow.pdbx_pH_range 6.0? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-06-15 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 17-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 17-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 38.730 _reflns.entry_id 7U2U _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.839 _reflns.d_resolution_low 61.850 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 17638 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.800 _reflns.pdbx_Rmerge_I_obs 0.051 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 21.600 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -2.0727 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -2.0727 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] 4.1454 _refine.B_iso_max 89.420 _refine.B_iso_mean 39.8800 _refine.B_iso_min 25.080 _refine.correlation_coeff_Fo_to_Fc 0.9550 _refine.correlation_coeff_Fo_to_Fc_free 0.9490 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7U2U _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.8390 _refine.ls_d_res_low 45.4900 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 17614 _refine.ls_number_reflns_R_free 849 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 100.0000 _refine.ls_percent_reflns_R_free 4.8200 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2033 _refine.ls_R_factor_R_free 0.2108 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2029 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6UM8 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.0990 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.1000 _refine.pdbx_overall_SU_R_Blow_DPI 0.1130 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.1110 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 7U2U _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.250 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.8390 _refine_hist.d_res_low 45.4900 _refine_hist.number_atoms_solvent 51 _refine_hist.number_atoms_total 1164 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 140 _refine_hist.pdbx_B_iso_mean_ligand 46.34 _refine_hist.pdbx_B_iso_mean_solvent 49.95 _refine_hist.pdbx_number_atoms_protein 1054 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 59 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? ? ? 368 ? t_dihedral_angle_d 2.000 SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? ? ? t_trig_c_planes ? ? 'X-RAY DIFFRACTION' ? ? ? 218 ? t_gen_planes 5.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1134 ? t_it 10.000 HARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_nbd ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_improper_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_pseud_angle ? ? 'X-RAY DIFFRACTION' ? ? ? 152 ? t_chiral_improper_torsion 5.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? ? ? t_sum_occupancies ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_distance ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_angle ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? t_utility_torsion ? ? 'X-RAY DIFFRACTION' ? ? ? 902 ? t_ideal_dist_contact 4.000 SEMIHARMONIC 'X-RAY DIFFRACTION' ? 0.008 ? 1134 ? t_bond_d 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 0.840 ? 1551 ? t_angle_deg 2.000 HARMONIC 'X-RAY DIFFRACTION' ? 2.990 ? ? ? t_omega_torsion ? ? 'X-RAY DIFFRACTION' ? 13.270 ? ? ? t_other_torsion ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.839 _refine_ls_shell.d_res_low 1.8500 _refine_ls_shell.number_reflns_all 420 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 23 _refine_ls_shell.number_reflns_R_work 397 _refine_ls_shell.percent_reflns_obs 100.0000 _refine_ls_shell.percent_reflns_R_free 5.4800 _refine_ls_shell.R_factor_all 0.2064 _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.2062 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.2064 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 43 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7U2U _struct.title ;CRYSTAL STRUCTURE OF HIV-1 INTEGRASE COMPLEXED WITH Compound-2a AKA (2S)-2-(TERT-BUTOXY)-2-[7-(4,4-DIMETHYLPIPE RIDIN-1-YL)-8-{4-[2-(4-FLUOROPHENYL)ETHOXY]PHENYL}-2,5-DIM ETHYLIMIDAZO[1,2-A]PYRIDIN-6-YL]ACETIC ACID ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7U2U _struct_keywords.text 'INTEGRASE, DNA BINDING PROTEIN, viral protein' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN, viral protein' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 64 ? TRP A 79 ? THR A 93 TRP A 108 1 ? 16 HELX_P HELX_P2 AA2 ASN A 88 ? SER A 94 ? ASN A 117 SER A 123 1 ? 7 HELX_P HELX_P3 AA3 SER A 94 ? GLY A 105 ? SER A 123 GLY A 134 1 ? 12 HELX_P HELX_P4 AA4 VAL A 121 ? ARG A 137 ? VAL A 150 ARG A 166 1 ? 17 HELX_P HELX_P5 AA5 ASP A 138 ? ALA A 140 ? ASP A 167 ALA A 169 5 ? 3 HELX_P HELX_P6 AA6 HIS A 142 ? LYS A 157 ? HIS A 171 LYS A 186 1 ? 16 HELX_P HELX_P7 AA7 SER A 166 ? ILE A 179 ? SER A 195 ILE A 208 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 55 ? ILE A 60 ? ILE A 84 ILE A 89 AA1 2 LYS A 42 ? HIS A 49 ? LYS A 71 HIS A 78 AA1 3 ILE A 31 ? LEU A 39 ? ILE A 60 LEU A 68 AA1 4 THR A 83 ? HIS A 85 ? THR A 112 HIS A 114 AA1 5 LYS A 107 ? GLU A 109 ? LYS A 136 GLU A 138 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 56 ? O GLU A 85 N ALA A 47 ? N ALA A 76 AA1 2 3 O VAL A 46 ? O VAL A 75 N ASP A 35 ? N ASP A 64 AA1 3 4 N LEU A 34 ? N LEU A 63 O HIS A 85 ? O HIS A 114 AA1 4 5 N VAL A 84 ? N VAL A 113 O GLU A 109 ? O GLU A 138 # _atom_sites.entry_id 7U2U _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014001 _atom_sites.fract_transf_matrix[1][2] 0.008084 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016168 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014896 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C F N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 30 ? ? ? A . n A 1 2 GLY 2 31 ? ? ? A . n A 1 3 SER 3 32 ? ? ? A . n A 1 4 SER 4 33 ? ? ? A . n A 1 5 HIS 5 34 ? ? ? A . n A 1 6 HIS 6 35 ? ? ? A . n A 1 7 HIS 7 36 ? ? ? A . n A 1 8 HIS 8 37 ? ? ? A . n A 1 9 HIS 9 38 ? ? ? A . n A 1 10 HIS 10 39 ? ? ? A . n A 1 11 SER 11 40 ? ? ? A . n A 1 12 SER 12 41 ? ? ? A . n A 1 13 GLY 13 42 ? ? ? A . n A 1 14 LEU 14 43 ? ? ? A . n A 1 15 VAL 15 44 ? ? ? A . n A 1 16 PRO 16 45 ? ? ? A . n A 1 17 ARG 17 46 ? ? ? A . n A 1 18 GLY 18 47 ? ? ? A . n A 1 19 SER 19 48 ? ? ? A . n A 1 20 HIS 20 49 ? ? ? A . n A 1 21 MET 21 50 ? ? ? A . n A 1 22 HIS 22 51 ? ? ? A . n A 1 23 GLY 23 52 ? ? ? A . n A 1 24 GLN 24 53 ? ? ? A . n A 1 25 VAL 25 54 ? ? ? A . n A 1 26 ASP 26 55 ? ? ? A . n A 1 27 SER 27 56 ? ? ? A . n A 1 28 SER 28 57 57 SER SER A . n A 1 29 PRO 29 58 58 PRO PRO A . n A 1 30 GLY 30 59 59 GLY GLY A . n A 1 31 ILE 31 60 60 ILE ILE A . n A 1 32 TRP 32 61 61 TRP TRP A . n A 1 33 GLN 33 62 62 GLN GLN A . n A 1 34 LEU 34 63 63 LEU LEU A . n A 1 35 ASP 35 64 64 ASP ASP A . n A 1 36 CYS 36 65 65 CYS CYS A . n A 1 37 THR 37 66 66 THR THR A . n A 1 38 HIS 38 67 67 HIS HIS A . n A 1 39 LEU 39 68 68 LEU LEU A . n A 1 40 GLU 40 69 69 GLU GLU A . n A 1 41 GLY 41 70 70 GLY GLY A . n A 1 42 LYS 42 71 71 LYS LYS A . n A 1 43 VAL 43 72 72 VAL VAL A . n A 1 44 ILE 44 73 73 ILE ILE A . n A 1 45 LEU 45 74 74 LEU LEU A . n A 1 46 VAL 46 75 75 VAL VAL A . n A 1 47 ALA 47 76 76 ALA ALA A . n A 1 48 VAL 48 77 77 VAL VAL A . n A 1 49 HIS 49 78 78 HIS HIS A . n A 1 50 VAL 50 79 79 VAL VAL A . n A 1 51 ALA 51 80 80 ALA ALA A . n A 1 52 SER 52 81 81 SER SER A . n A 1 53 GLY 53 82 82 GLY GLY A . n A 1 54 TYR 54 83 83 TYR TYR A . n A 1 55 ILE 55 84 84 ILE ILE A . n A 1 56 GLU 56 85 85 GLU GLU A . n A 1 57 ALA 57 86 86 ALA ALA A . n A 1 58 GLU 58 87 87 GLU GLU A . n A 1 59 VAL 59 88 88 VAL VAL A . n A 1 60 ILE 60 89 89 ILE ILE A . n A 1 61 PRO 61 90 90 PRO PRO A . n A 1 62 ALA 62 91 91 ALA ALA A . n A 1 63 GLU 63 92 92 GLU GLU A . n A 1 64 THR 64 93 93 THR THR A . n A 1 65 GLY 65 94 94 GLY GLY A . n A 1 66 GLN 66 95 95 GLN GLN A . n A 1 67 GLU 67 96 96 GLU GLU A . n A 1 68 THR 68 97 97 THR THR A . n A 1 69 ALA 69 98 98 ALA ALA A . n A 1 70 TYR 70 99 99 TYR TYR A . n A 1 71 PHE 71 100 100 PHE PHE A . n A 1 72 LEU 72 101 101 LEU LEU A . n A 1 73 LEU 73 102 102 LEU LEU A . n A 1 74 LYS 74 103 103 LYS LYS A . n A 1 75 LEU 75 104 104 LEU LEU A . n A 1 76 ALA 76 105 105 ALA ALA A . n A 1 77 GLY 77 106 106 GLY GLY A . n A 1 78 ARG 78 107 107 ARG ARG A . n A 1 79 TRP 79 108 108 TRP TRP A . n A 1 80 PRO 80 109 109 PRO PRO A . n A 1 81 VAL 81 110 110 VAL VAL A . n A 1 82 LYS 82 111 111 LYS LYS A . n A 1 83 THR 83 112 112 THR THR A . n A 1 84 VAL 84 113 113 VAL VAL A . n A 1 85 HIS 85 114 114 HIS HIS A . n A 1 86 THR 86 115 115 THR THR A . n A 1 87 ASP 87 116 116 ASP ASP A . n A 1 88 ASN 88 117 117 ASN ASN A . n A 1 89 GLY 89 118 118 GLY GLY A . n A 1 90 SER 90 119 119 SER SER A . n A 1 91 ASN 91 120 120 ASN ASN A . n A 1 92 PHE 92 121 121 PHE PHE A . n A 1 93 THR 93 122 122 THR THR A . n A 1 94 SER 94 123 123 SER SER A . n A 1 95 THR 95 124 124 THR THR A . n A 1 96 THR 96 125 125 THR THR A . n A 1 97 VAL 97 126 126 VAL VAL A . n A 1 98 LYS 98 127 127 LYS LYS A . n A 1 99 ALA 99 128 128 ALA ALA A . n A 1 100 ALA 100 129 129 ALA ALA A . n A 1 101 CYS 101 130 130 CYS CYS A . n A 1 102 TRP 102 131 131 TRP TRP A . n A 1 103 TRP 103 132 132 TRP TRP A . n A 1 104 ALA 104 133 133 ALA ALA A . n A 1 105 GLY 105 134 134 GLY GLY A . n A 1 106 ILE 106 135 135 ILE ILE A . n A 1 107 LYS 107 136 136 LYS LYS A . n A 1 108 GLN 108 137 137 GLN GLN A . n A 1 109 GLU 109 138 138 GLU GLU A . n A 1 110 ASP 110 139 139 ASP ASP A . n A 1 111 GLY 111 140 140 GLY GLY A . n A 1 112 ILE 112 141 ? ? ? A . n A 1 113 PRO 113 142 ? ? ? A . n A 1 114 TYR 114 143 ? ? ? A . n A 1 115 ASN 115 144 ? ? ? A . n A 1 116 PRO 116 145 ? ? ? A . n A 1 117 GLN 117 146 ? ? ? A . n A 1 118 SER 118 147 ? ? ? A . n A 1 119 GLN 119 148 ? ? ? A . n A 1 120 GLY 120 149 149 GLY GLY A . n A 1 121 VAL 121 150 150 VAL VAL A . n A 1 122 ILE 122 151 151 ILE ILE A . n A 1 123 GLU 123 152 152 GLU GLU A . n A 1 124 SER 124 153 153 SER SER A . n A 1 125 MET 125 154 154 MET MET A . n A 1 126 ASN 126 155 155 ASN ASN A . n A 1 127 LYS 127 156 156 LYS LYS A . n A 1 128 GLU 128 157 157 GLU GLU A . n A 1 129 LEU 129 158 158 LEU LEU A . n A 1 130 LYS 130 159 159 LYS LYS A . n A 1 131 LYS 131 160 160 LYS LYS A . n A 1 132 ILE 132 161 161 ILE ILE A . n A 1 133 ILE 133 162 162 ILE ILE A . n A 1 134 GLY 134 163 163 GLY GLY A . n A 1 135 GLN 135 164 164 GLN GLN A . n A 1 136 VAL 136 165 165 VAL VAL A . n A 1 137 ARG 137 166 166 ARG ARG A . n A 1 138 ASP 138 167 167 ASP ASP A . n A 1 139 GLN 139 168 168 GLN GLN A . n A 1 140 ALA 140 169 169 ALA ALA A . n A 1 141 GLU 141 170 170 GLU GLU A . n A 1 142 HIS 142 171 171 HIS HIS A . n A 1 143 LEU 143 172 172 LEU LEU A . n A 1 144 LYS 144 173 173 LYS LYS A . n A 1 145 THR 145 174 174 THR THR A . n A 1 146 ALA 146 175 175 ALA ALA A . n A 1 147 VAL 147 176 176 VAL VAL A . n A 1 148 GLN 148 177 177 GLN GLN A . n A 1 149 MET 149 178 178 MET MET A . n A 1 150 ALA 150 179 179 ALA ALA A . n A 1 151 VAL 151 180 180 VAL VAL A . n A 1 152 PHE 152 181 181 PHE PHE A . n A 1 153 ILE 153 182 182 ILE ILE A . n A 1 154 HIS 154 183 183 HIS HIS A . n A 1 155 ASN 155 184 184 ASN ASN A . n A 1 156 HIS 156 185 185 HIS HIS A . n A 1 157 LYS 157 186 186 LYS LYS A . n A 1 158 ARG 158 187 187 ARG ARG A . n A 1 159 LYS 159 188 188 LYS LYS A . n A 1 160 GLY 160 189 ? ? ? A . n A 1 161 GLY 161 190 ? ? ? A . n A 1 162 ILE 162 191 ? ? ? A . n A 1 163 GLY 163 192 ? ? ? A . n A 1 164 GLY 164 193 193 GLY GLY A . n A 1 165 TYR 165 194 194 TYR TYR A . n A 1 166 SER 166 195 195 SER SER A . n A 1 167 ALA 167 196 196 ALA ALA A . n A 1 168 GLY 168 197 197 GLY GLY A . n A 1 169 GLU 169 198 198 GLU GLU A . n A 1 170 ARG 170 199 199 ARG ARG A . n A 1 171 ILE 171 200 200 ILE ILE A . n A 1 172 VAL 172 201 201 VAL VAL A . n A 1 173 ASP 173 202 202 ASP ASP A . n A 1 174 ILE 174 203 203 ILE ILE A . n A 1 175 ILE 175 204 204 ILE ILE A . n A 1 176 ALA 176 205 205 ALA ALA A . n A 1 177 THR 177 206 206 THR THR A . n A 1 178 ASP 178 207 207 ASP ASP A . n A 1 179 ILE 179 208 208 ILE ILE A . n A 1 180 GLN 180 209 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email javed.khan@bms.com _pdbx_contact_author.name_first Javed _pdbx_contact_author.name_last Khan _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7486-857X # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 KZD 1 301 1 KZD LG1 A . C 3 SO4 1 302 1 SO4 SO4 A . D 3 SO4 1 303 2 SO4 SO4 A . E 3 SO4 1 304 3 SO4 SO4 A . F 4 HOH 1 401 41 HOH HOH A . F 4 HOH 2 402 47 HOH HOH A . F 4 HOH 3 403 11 HOH HOH A . F 4 HOH 4 404 9 HOH HOH A . F 4 HOH 5 405 6 HOH HOH A . F 4 HOH 6 406 4 HOH HOH A . F 4 HOH 7 407 24 HOH HOH A . F 4 HOH 8 408 10 HOH HOH A . F 4 HOH 9 409 8 HOH HOH A . F 4 HOH 10 410 48 HOH HOH A . F 4 HOH 11 411 16 HOH HOH A . F 4 HOH 12 412 25 HOH HOH A . F 4 HOH 13 413 21 HOH HOH A . F 4 HOH 14 414 19 HOH HOH A . F 4 HOH 15 415 7 HOH HOH A . F 4 HOH 16 416 44 HOH HOH A . F 4 HOH 17 417 22 HOH HOH A . F 4 HOH 18 418 3 HOH HOH A . F 4 HOH 19 419 34 HOH HOH A . F 4 HOH 20 420 13 HOH HOH A . F 4 HOH 21 421 5 HOH HOH A . F 4 HOH 22 422 2 HOH HOH A . F 4 HOH 23 423 14 HOH HOH A . F 4 HOH 24 424 37 HOH HOH A . F 4 HOH 25 425 23 HOH HOH A . F 4 HOH 26 426 28 HOH HOH A . F 4 HOH 27 427 20 HOH HOH A . F 4 HOH 28 428 15 HOH HOH A . F 4 HOH 29 429 1 HOH HOH A . F 4 HOH 30 430 12 HOH HOH A . F 4 HOH 31 431 30 HOH HOH A . F 4 HOH 32 432 36 HOH HOH A . F 4 HOH 33 433 39 HOH HOH A . F 4 HOH 34 434 17 HOH HOH A . F 4 HOH 35 435 38 HOH HOH A . F 4 HOH 36 436 35 HOH HOH A . F 4 HOH 37 437 26 HOH HOH A . F 4 HOH 38 438 45 HOH HOH A . F 4 HOH 39 439 50 HOH HOH A . F 4 HOH 40 440 29 HOH HOH A . F 4 HOH 41 441 46 HOH HOH A . F 4 HOH 42 442 40 HOH HOH A . F 4 HOH 43 443 43 HOH HOH A . F 4 HOH 44 444 27 HOH HOH A . F 4 HOH 45 445 49 HOH HOH A . F 4 HOH 46 446 51 HOH HOH A . F 4 HOH 47 447 42 HOH HOH A . F 4 HOH 48 448 33 HOH HOH A . F 4 HOH 49 449 31 HOH HOH A . F 4 HOH 50 450 32 HOH HOH A . F 4 HOH 51 451 18 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4250 ? 1 MORE -90 ? 1 'SSA (A^2)' 12230 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_555 -x,-x+y,-z+1/3 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 22.3766666667 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-06-08 2 'Structure model' 1 1 2022-10-12 3 'Structure model' 1 2 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Source and taxonomy' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' entity_src_gen 2 2 'Structure model' reflns_shell 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_entity_src_gen.gene_src_common_name' 2 2 'Structure model' '_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id' 3 2 'Structure model' '_entity_src_gen.pdbx_gene_src_scientific_name' 4 2 'Structure model' '_reflns_shell.Rmerge_I_obs' 5 2 'Structure model' '_reflns_shell.d_res_high' 6 2 'Structure model' '_reflns_shell.d_res_low' 7 2 'Structure model' '_reflns_shell.meanI_over_sigI_obs' 8 2 'Structure model' '_reflns_shell.number_unique_obs' 9 2 'Structure model' '_reflns_shell.pdbx_redundancy' 10 2 'Structure model' '_reflns_shell.percent_possible_all' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? '2.11.7 (17-DEC-2019)' 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 7U2U _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 139 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -82.07 _pdbx_validate_torsion.psi -145.80 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER 57 ? OG ? A SER 28 OG 2 1 Y 1 A LYS 71 ? NZ ? A LYS 42 NZ 3 1 Y 1 A LYS 111 ? CG ? A LYS 82 CG 4 1 Y 1 A LYS 111 ? CD ? A LYS 82 CD 5 1 Y 1 A LYS 111 ? CE ? A LYS 82 CE 6 1 Y 1 A LYS 111 ? NZ ? A LYS 82 NZ 7 1 Y 1 A LYS 136 ? CD ? A LYS 107 CD 8 1 Y 1 A LYS 136 ? CE ? A LYS 107 CE 9 1 Y 1 A LYS 136 ? NZ ? A LYS 107 NZ 10 1 Y 1 A VAL 150 ? CG1 ? A VAL 121 CG1 11 1 Y 1 A VAL 150 ? CG2 ? A VAL 121 CG2 12 1 Y 1 A GLU 152 ? CG ? A GLU 123 CG 13 1 Y 1 A GLU 152 ? CD ? A GLU 123 CD 14 1 Y 1 A GLU 152 ? OE1 ? A GLU 123 OE1 15 1 Y 1 A GLU 152 ? OE2 ? A GLU 123 OE2 16 1 Y 1 A SER 153 ? OG ? A SER 124 OG 17 1 Y 1 A LYS 156 ? CG ? A LYS 127 CG 18 1 Y 1 A LYS 156 ? CD ? A LYS 127 CD 19 1 Y 1 A LYS 156 ? CE ? A LYS 127 CE 20 1 Y 1 A LYS 156 ? NZ ? A LYS 127 NZ 21 1 Y 1 A LYS 160 ? CD ? A LYS 131 CD 22 1 Y 1 A LYS 160 ? CE ? A LYS 131 CE 23 1 Y 1 A LYS 160 ? NZ ? A LYS 131 NZ 24 1 Y 1 A LYS 186 ? CD ? A LYS 157 CD 25 1 Y 1 A LYS 186 ? CE ? A LYS 157 CE 26 1 Y 1 A LYS 186 ? NZ ? A LYS 157 NZ 27 1 Y 1 A LYS 188 ? CG ? A LYS 159 CG 28 1 Y 1 A LYS 188 ? CD ? A LYS 159 CD 29 1 Y 1 A LYS 188 ? CE ? A LYS 159 CE 30 1 Y 1 A LYS 188 ? NZ ? A LYS 159 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 30 ? A MET 1 2 1 Y 1 A GLY 31 ? A GLY 2 3 1 Y 1 A SER 32 ? A SER 3 4 1 Y 1 A SER 33 ? A SER 4 5 1 Y 1 A HIS 34 ? A HIS 5 6 1 Y 1 A HIS 35 ? A HIS 6 7 1 Y 1 A HIS 36 ? A HIS 7 8 1 Y 1 A HIS 37 ? A HIS 8 9 1 Y 1 A HIS 38 ? A HIS 9 10 1 Y 1 A HIS 39 ? A HIS 10 11 1 Y 1 A SER 40 ? A SER 11 12 1 Y 1 A SER 41 ? A SER 12 13 1 Y 1 A GLY 42 ? A GLY 13 14 1 Y 1 A LEU 43 ? A LEU 14 15 1 Y 1 A VAL 44 ? A VAL 15 16 1 Y 1 A PRO 45 ? A PRO 16 17 1 Y 1 A ARG 46 ? A ARG 17 18 1 Y 1 A GLY 47 ? A GLY 18 19 1 Y 1 A SER 48 ? A SER 19 20 1 Y 1 A HIS 49 ? A HIS 20 21 1 Y 1 A MET 50 ? A MET 21 22 1 Y 1 A HIS 51 ? A HIS 22 23 1 Y 1 A GLY 52 ? A GLY 23 24 1 Y 1 A GLN 53 ? A GLN 24 25 1 Y 1 A VAL 54 ? A VAL 25 26 1 Y 1 A ASP 55 ? A ASP 26 27 1 Y 1 A SER 56 ? A SER 27 28 1 Y 1 A ILE 141 ? A ILE 112 29 1 Y 1 A PRO 142 ? A PRO 113 30 1 Y 1 A TYR 143 ? A TYR 114 31 1 Y 1 A ASN 144 ? A ASN 115 32 1 Y 1 A PRO 145 ? A PRO 116 33 1 Y 1 A GLN 146 ? A GLN 117 34 1 Y 1 A SER 147 ? A SER 118 35 1 Y 1 A GLN 148 ? A GLN 119 36 1 Y 1 A GLY 189 ? A GLY 160 37 1 Y 1 A GLY 190 ? A GLY 161 38 1 Y 1 A ILE 191 ? A ILE 162 39 1 Y 1 A GLY 192 ? A GLY 163 40 1 Y 1 A GLN 209 ? A GLN 180 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 KZD C13 C N N 183 KZD C17 C N N 184 KZD C16 C N S 185 KZD C15 C Y N 186 KZD C21 C N N 187 KZD C22 C N N 188 KZD C23 C N N 189 KZD C24 C N N 190 KZD C11 C Y N 191 KZD C12 C Y N 192 KZD C34 C Y N 193 KZD C27 C Y N 194 KZD C33 C N N 195 KZD C1 C N N 196 KZD C2 C N N 197 KZD N3 N N N 198 KZD C4 C N N 199 KZD C5 C N N 200 KZD C6 C N N 201 KZD C7 C Y N 202 KZD C8 C Y N 203 KZD C9 C Y N 204 KZD N10 N Y N 205 KZD C14 C N N 206 KZD O18 O N N 207 KZD O19 O N N 208 KZD O20 O N N 209 KZD C25 C N N 210 KZD C26 C Y N 211 KZD C28 C Y N 212 KZD C29 C Y N 213 KZD C30 C Y N 214 KZD O31 O N N 215 KZD C32 C N N 216 KZD C35 C Y N 217 KZD C36 C Y N 218 KZD C37 C Y N 219 KZD C38 C Y N 220 KZD C39 C Y N 221 KZD N41 N Y N 222 KZD C42 C Y N 223 KZD C43 C Y N 224 KZD C44 C N N 225 KZD F40 F N N 226 KZD H1 H N N 227 KZD H2 H N N 228 KZD H3 H N N 229 KZD H4 H N N 230 KZD H5 H N N 231 KZD H6 H N N 232 KZD H7 H N N 233 KZD H8 H N N 234 KZD H9 H N N 235 KZD H10 H N N 236 KZD H11 H N N 237 KZD H12 H N N 238 KZD H13 H N N 239 KZD H14 H N N 240 KZD H15 H N N 241 KZD H16 H N N 242 KZD H17 H N N 243 KZD H18 H N N 244 KZD H19 H N N 245 KZD H20 H N N 246 KZD H21 H N N 247 KZD H22 H N N 248 KZD H23 H N N 249 KZD H24 H N N 250 KZD H25 H N N 251 KZD H26 H N N 252 KZD H27 H N N 253 KZD H28 H N N 254 KZD H29 H N N 255 KZD H30 H N N 256 KZD H31 H N N 257 KZD H32 H N N 258 KZD H33 H N N 259 KZD H34 H N N 260 KZD H35 H N N 261 KZD H36 H N N 262 KZD H37 H N N 263 KZD H38 H N N 264 KZD H39 H N N 265 KZD H40 H N N 266 KZD H41 H N N 267 KZD H42 H N N 268 KZD H43 H N N 269 KZD H44 H N N 270 LEU N N N N 271 LEU CA C N S 272 LEU C C N N 273 LEU O O N N 274 LEU CB C N N 275 LEU CG C N N 276 LEU CD1 C N N 277 LEU CD2 C N N 278 LEU OXT O N N 279 LEU H H N N 280 LEU H2 H N N 281 LEU HA H N N 282 LEU HB2 H N N 283 LEU HB3 H N N 284 LEU HG H N N 285 LEU HD11 H N N 286 LEU HD12 H N N 287 LEU HD13 H N N 288 LEU HD21 H N N 289 LEU HD22 H N N 290 LEU HD23 H N N 291 LEU HXT H N N 292 LYS N N N N 293 LYS CA C N S 294 LYS C C N N 295 LYS O O N N 296 LYS CB C N N 297 LYS CG C N N 298 LYS CD C N N 299 LYS CE C N N 300 LYS NZ N N N 301 LYS OXT O N N 302 LYS H H N N 303 LYS H2 H N N 304 LYS HA H N N 305 LYS HB2 H N N 306 LYS HB3 H N N 307 LYS HG2 H N N 308 LYS HG3 H N N 309 LYS HD2 H N N 310 LYS HD3 H N N 311 LYS HE2 H N N 312 LYS HE3 H N N 313 LYS HZ1 H N N 314 LYS HZ2 H N N 315 LYS HZ3 H N N 316 LYS HXT H N N 317 MET N N N N 318 MET CA C N S 319 MET C C N N 320 MET O O N N 321 MET CB C N N 322 MET CG C N N 323 MET SD S N N 324 MET CE C N N 325 MET OXT O N N 326 MET H H N N 327 MET H2 H N N 328 MET HA H N N 329 MET HB2 H N N 330 MET HB3 H N N 331 MET HG2 H N N 332 MET HG3 H N N 333 MET HE1 H N N 334 MET HE2 H N N 335 MET HE3 H N N 336 MET HXT H N N 337 PHE N N N N 338 PHE CA C N S 339 PHE C C N N 340 PHE O O N N 341 PHE CB C N N 342 PHE CG C Y N 343 PHE CD1 C Y N 344 PHE CD2 C Y N 345 PHE CE1 C Y N 346 PHE CE2 C Y N 347 PHE CZ C Y N 348 PHE OXT O N N 349 PHE H H N N 350 PHE H2 H N N 351 PHE HA H N N 352 PHE HB2 H N N 353 PHE HB3 H N N 354 PHE HD1 H N N 355 PHE HD2 H N N 356 PHE HE1 H N N 357 PHE HE2 H N N 358 PHE HZ H N N 359 PHE HXT H N N 360 PRO N N N N 361 PRO CA C N S 362 PRO C C N N 363 PRO O O N N 364 PRO CB C N N 365 PRO CG C N N 366 PRO CD C N N 367 PRO OXT O N N 368 PRO H H N N 369 PRO HA H N N 370 PRO HB2 H N N 371 PRO HB3 H N N 372 PRO HG2 H N N 373 PRO HG3 H N N 374 PRO HD2 H N N 375 PRO HD3 H N N 376 PRO HXT H N N 377 SER N N N N 378 SER CA C N S 379 SER C C N N 380 SER O O N N 381 SER CB C N N 382 SER OG O N N 383 SER OXT O N N 384 SER H H N N 385 SER H2 H N N 386 SER HA H N N 387 SER HB2 H N N 388 SER HB3 H N N 389 SER HG H N N 390 SER HXT H N N 391 SO4 S S N N 392 SO4 O1 O N N 393 SO4 O2 O N N 394 SO4 O3 O N N 395 SO4 O4 O N N 396 THR N N N N 397 THR CA C N S 398 THR C C N N 399 THR O O N N 400 THR CB C N R 401 THR OG1 O N N 402 THR CG2 C N N 403 THR OXT O N N 404 THR H H N N 405 THR H2 H N N 406 THR HA H N N 407 THR HB H N N 408 THR HG1 H N N 409 THR HG21 H N N 410 THR HG22 H N N 411 THR HG23 H N N 412 THR HXT H N N 413 TRP N N N N 414 TRP CA C N S 415 TRP C C N N 416 TRP O O N N 417 TRP CB C N N 418 TRP CG C Y N 419 TRP CD1 C Y N 420 TRP CD2 C Y N 421 TRP NE1 N Y N 422 TRP CE2 C Y N 423 TRP CE3 C Y N 424 TRP CZ2 C Y N 425 TRP CZ3 C Y N 426 TRP CH2 C Y N 427 TRP OXT O N N 428 TRP H H N N 429 TRP H2 H N N 430 TRP HA H N N 431 TRP HB2 H N N 432 TRP HB3 H N N 433 TRP HD1 H N N 434 TRP HE1 H N N 435 TRP HE3 H N N 436 TRP HZ2 H N N 437 TRP HZ3 H N N 438 TRP HH2 H N N 439 TRP HXT H N N 440 TYR N N N N 441 TYR CA C N S 442 TYR C C N N 443 TYR O O N N 444 TYR CB C N N 445 TYR CG C Y N 446 TYR CD1 C Y N 447 TYR CD2 C Y N 448 TYR CE1 C Y N 449 TYR CE2 C Y N 450 TYR CZ C Y N 451 TYR OH O N N 452 TYR OXT O N N 453 TYR H H N N 454 TYR H2 H N N 455 TYR HA H N N 456 TYR HB2 H N N 457 TYR HB3 H N N 458 TYR HD1 H N N 459 TYR HD2 H N N 460 TYR HE1 H N N 461 TYR HE2 H N N 462 TYR HH H N N 463 TYR HXT H N N 464 VAL N N N N 465 VAL CA C N S 466 VAL C C N N 467 VAL O O N N 468 VAL CB C N N 469 VAL CG1 C N N 470 VAL CG2 C N N 471 VAL OXT O N N 472 VAL H H N N 473 VAL H2 H N N 474 VAL HA H N N 475 VAL HB H N N 476 VAL HG11 H N N 477 VAL HG12 H N N 478 VAL HG13 H N N 479 VAL HG21 H N N 480 VAL HG22 H N N 481 VAL HG23 H N N 482 VAL HXT H N N 483 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 KZD O18 C17 doub N N 173 KZD O19 C17 sing N N 174 KZD C32 C33 sing N N 175 KZD C32 O31 sing N N 176 KZD C2 C1 sing N N 177 KZD C2 N3 sing N N 178 KZD C33 C34 sing N N 179 KZD C17 C16 sing N N 180 KZD C1 C6 sing N N 181 KZD C29 C30 doub Y N 182 KZD C29 C28 sing Y N 183 KZD C14 C6 sing N N 184 KZD C30 C15 sing Y N 185 KZD C35 C34 doub Y N 186 KZD C35 C36 sing Y N 187 KZD C6 C13 sing N N 188 KZD C6 C5 sing N N 189 KZD C34 C39 sing Y N 190 KZD O31 C28 sing N N 191 KZD C28 C27 doub Y N 192 KZD C36 C37 doub Y N 193 KZD C16 C12 sing N N 194 KZD C16 O20 sing N N 195 KZD N3 C7 sing N N 196 KZD N3 C4 sing N N 197 KZD C7 C12 sing Y N 198 KZD C7 C8 doub Y N 199 KZD C12 C11 doub Y N 200 KZD C15 C8 sing N N 201 KZD C15 C26 doub Y N 202 KZD C8 C9 sing Y N 203 KZD C11 C25 sing N N 204 KZD C11 N10 sing Y N 205 KZD C9 N10 sing Y N 206 KZD C9 N41 doub Y N 207 KZD N10 C43 sing Y N 208 KZD C4 C5 sing N N 209 KZD C39 C38 doub Y N 210 KZD N41 C42 sing Y N 211 KZD O20 C21 sing N N 212 KZD C43 C42 doub Y N 213 KZD C27 C26 sing Y N 214 KZD C37 C38 sing Y N 215 KZD C37 F40 sing N N 216 KZD C42 C44 sing N N 217 KZD C23 C21 sing N N 218 KZD C21 C22 sing N N 219 KZD C21 C24 sing N N 220 KZD C13 H1 sing N N 221 KZD C13 H2 sing N N 222 KZD C13 H3 sing N N 223 KZD C16 H4 sing N N 224 KZD C22 H5 sing N N 225 KZD C22 H6 sing N N 226 KZD C22 H7 sing N N 227 KZD C23 H8 sing N N 228 KZD C23 H9 sing N N 229 KZD C23 H10 sing N N 230 KZD C24 H11 sing N N 231 KZD C24 H12 sing N N 232 KZD C24 H13 sing N N 233 KZD C27 H14 sing N N 234 KZD C33 H15 sing N N 235 KZD C33 H16 sing N N 236 KZD C1 H17 sing N N 237 KZD C1 H18 sing N N 238 KZD C2 H19 sing N N 239 KZD C2 H20 sing N N 240 KZD C4 H21 sing N N 241 KZD C4 H22 sing N N 242 KZD C5 H23 sing N N 243 KZD C5 H24 sing N N 244 KZD C14 H25 sing N N 245 KZD C14 H26 sing N N 246 KZD C14 H27 sing N N 247 KZD O19 H28 sing N N 248 KZD C25 H29 sing N N 249 KZD C25 H30 sing N N 250 KZD C25 H31 sing N N 251 KZD C26 H32 sing N N 252 KZD C29 H33 sing N N 253 KZD C30 H34 sing N N 254 KZD C32 H35 sing N N 255 KZD C32 H36 sing N N 256 KZD C35 H37 sing N N 257 KZD C36 H38 sing N N 258 KZD C38 H39 sing N N 259 KZD C39 H40 sing N N 260 KZD C43 H41 sing N N 261 KZD C44 H42 sing N N 262 KZD C44 H43 sing N N 263 KZD C44 H44 sing N N 264 LEU N CA sing N N 265 LEU N H sing N N 266 LEU N H2 sing N N 267 LEU CA C sing N N 268 LEU CA CB sing N N 269 LEU CA HA sing N N 270 LEU C O doub N N 271 LEU C OXT sing N N 272 LEU CB CG sing N N 273 LEU CB HB2 sing N N 274 LEU CB HB3 sing N N 275 LEU CG CD1 sing N N 276 LEU CG CD2 sing N N 277 LEU CG HG sing N N 278 LEU CD1 HD11 sing N N 279 LEU CD1 HD12 sing N N 280 LEU CD1 HD13 sing N N 281 LEU CD2 HD21 sing N N 282 LEU CD2 HD22 sing N N 283 LEU CD2 HD23 sing N N 284 LEU OXT HXT sing N N 285 LYS N CA sing N N 286 LYS N H sing N N 287 LYS N H2 sing N N 288 LYS CA C sing N N 289 LYS CA CB sing N N 290 LYS CA HA sing N N 291 LYS C O doub N N 292 LYS C OXT sing N N 293 LYS CB CG sing N N 294 LYS CB HB2 sing N N 295 LYS CB HB3 sing N N 296 LYS CG CD sing N N 297 LYS CG HG2 sing N N 298 LYS CG HG3 sing N N 299 LYS CD CE sing N N 300 LYS CD HD2 sing N N 301 LYS CD HD3 sing N N 302 LYS CE NZ sing N N 303 LYS CE HE2 sing N N 304 LYS CE HE3 sing N N 305 LYS NZ HZ1 sing N N 306 LYS NZ HZ2 sing N N 307 LYS NZ HZ3 sing N N 308 LYS OXT HXT sing N N 309 MET N CA sing N N 310 MET N H sing N N 311 MET N H2 sing N N 312 MET CA C sing N N 313 MET CA CB sing N N 314 MET CA HA sing N N 315 MET C O doub N N 316 MET C OXT sing N N 317 MET CB CG sing N N 318 MET CB HB2 sing N N 319 MET CB HB3 sing N N 320 MET CG SD sing N N 321 MET CG HG2 sing N N 322 MET CG HG3 sing N N 323 MET SD CE sing N N 324 MET CE HE1 sing N N 325 MET CE HE2 sing N N 326 MET CE HE3 sing N N 327 MET OXT HXT sing N N 328 PHE N CA sing N N 329 PHE N H sing N N 330 PHE N H2 sing N N 331 PHE CA C sing N N 332 PHE CA CB sing N N 333 PHE CA HA sing N N 334 PHE C O doub N N 335 PHE C OXT sing N N 336 PHE CB CG sing N N 337 PHE CB HB2 sing N N 338 PHE CB HB3 sing N N 339 PHE CG CD1 doub Y N 340 PHE CG CD2 sing Y N 341 PHE CD1 CE1 sing Y N 342 PHE CD1 HD1 sing N N 343 PHE CD2 CE2 doub Y N 344 PHE CD2 HD2 sing N N 345 PHE CE1 CZ doub Y N 346 PHE CE1 HE1 sing N N 347 PHE CE2 CZ sing Y N 348 PHE CE2 HE2 sing N N 349 PHE CZ HZ sing N N 350 PHE OXT HXT sing N N 351 PRO N CA sing N N 352 PRO N CD sing N N 353 PRO N H sing N N 354 PRO CA C sing N N 355 PRO CA CB sing N N 356 PRO CA HA sing N N 357 PRO C O doub N N 358 PRO C OXT sing N N 359 PRO CB CG sing N N 360 PRO CB HB2 sing N N 361 PRO CB HB3 sing N N 362 PRO CG CD sing N N 363 PRO CG HG2 sing N N 364 PRO CG HG3 sing N N 365 PRO CD HD2 sing N N 366 PRO CD HD3 sing N N 367 PRO OXT HXT sing N N 368 SER N CA sing N N 369 SER N H sing N N 370 SER N H2 sing N N 371 SER CA C sing N N 372 SER CA CB sing N N 373 SER CA HA sing N N 374 SER C O doub N N 375 SER C OXT sing N N 376 SER CB OG sing N N 377 SER CB HB2 sing N N 378 SER CB HB3 sing N N 379 SER OG HG sing N N 380 SER OXT HXT sing N N 381 SO4 S O1 doub N N 382 SO4 S O2 doub N N 383 SO4 S O3 sing N N 384 SO4 S O4 sing N N 385 THR N CA sing N N 386 THR N H sing N N 387 THR N H2 sing N N 388 THR CA C sing N N 389 THR CA CB sing N N 390 THR CA HA sing N N 391 THR C O doub N N 392 THR C OXT sing N N 393 THR CB OG1 sing N N 394 THR CB CG2 sing N N 395 THR CB HB sing N N 396 THR OG1 HG1 sing N N 397 THR CG2 HG21 sing N N 398 THR CG2 HG22 sing N N 399 THR CG2 HG23 sing N N 400 THR OXT HXT sing N N 401 TRP N CA sing N N 402 TRP N H sing N N 403 TRP N H2 sing N N 404 TRP CA C sing N N 405 TRP CA CB sing N N 406 TRP CA HA sing N N 407 TRP C O doub N N 408 TRP C OXT sing N N 409 TRP CB CG sing N N 410 TRP CB HB2 sing N N 411 TRP CB HB3 sing N N 412 TRP CG CD1 doub Y N 413 TRP CG CD2 sing Y N 414 TRP CD1 NE1 sing Y N 415 TRP CD1 HD1 sing N N 416 TRP CD2 CE2 doub Y N 417 TRP CD2 CE3 sing Y N 418 TRP NE1 CE2 sing Y N 419 TRP NE1 HE1 sing N N 420 TRP CE2 CZ2 sing Y N 421 TRP CE3 CZ3 doub Y N 422 TRP CE3 HE3 sing N N 423 TRP CZ2 CH2 doub Y N 424 TRP CZ2 HZ2 sing N N 425 TRP CZ3 CH2 sing Y N 426 TRP CZ3 HZ3 sing N N 427 TRP CH2 HH2 sing N N 428 TRP OXT HXT sing N N 429 TYR N CA sing N N 430 TYR N H sing N N 431 TYR N H2 sing N N 432 TYR CA C sing N N 433 TYR CA CB sing N N 434 TYR CA HA sing N N 435 TYR C O doub N N 436 TYR C OXT sing N N 437 TYR CB CG sing N N 438 TYR CB HB2 sing N N 439 TYR CB HB3 sing N N 440 TYR CG CD1 doub Y N 441 TYR CG CD2 sing Y N 442 TYR CD1 CE1 sing Y N 443 TYR CD1 HD1 sing N N 444 TYR CD2 CE2 doub Y N 445 TYR CD2 HD2 sing N N 446 TYR CE1 CZ doub Y N 447 TYR CE1 HE1 sing N N 448 TYR CE2 CZ sing Y N 449 TYR CE2 HE2 sing N N 450 TYR CZ OH sing N N 451 TYR OH HH sing N N 452 TYR OXT HXT sing N N 453 VAL N CA sing N N 454 VAL N H sing N N 455 VAL N H2 sing N N 456 VAL CA C sing N N 457 VAL CA CB sing N N 458 VAL CA HA sing N N 459 VAL C O doub N N 460 VAL C OXT sing N N 461 VAL CB CG1 sing N N 462 VAL CB CG2 sing N N 463 VAL CB HB sing N N 464 VAL CG1 HG11 sing N N 465 VAL CG1 HG12 sing N N 466 VAL CG1 HG13 sing N N 467 VAL CG2 HG21 sing N N 468 VAL CG2 HG22 sing N N 469 VAL CG2 HG23 sing N N 470 VAL OXT HXT sing N N 471 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id KZD _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id KZD _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;(2S)-tert-butoxy[(4S)-7-(4,4-dimethylpiperidin-1-yl)-8-{4-[2-(4-fluorophenyl)ethoxy]phenyl}-2,5-dimethylimidazo[1,2-a]pyridin-6-yl]acetic acid ; KZD 3 'SULFATE ION' SO4 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6UM8 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #