data_7U37 # _entry.id 7U37 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7U37 pdb_00007u37 10.2210/pdb7u37/pdb WWPDB D_1000263357 ? ? BMRB 30995 ? 10.13018/BMR30995 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-07-13 2 'Structure model' 1 1 2022-08-03 3 'Structure model' 1 2 2022-09-07 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' Other 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' pdbx_database_status 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 2 'Structure model' '_citation_author.identifier_ORCID' 11 3 'Structure model' '_citation.journal_volume' 12 3 'Structure model' '_citation.page_first' 13 3 'Structure model' '_citation.page_last' 14 3 'Structure model' '_citation_author.identifier_ORCID' 15 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 16 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7U37 _pdbx_database_status.recvd_initial_deposition_date 2022-02-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution NMR structure of Vibrio cholerae ferrous iron transport protein C (FeoC)' _pdbx_database_related.db_id 30995 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email smitha@umbc.edu _pdbx_contact_author.name_first Aaron _pdbx_contact_author.name_last Smith _pdbx_contact_author.name_mi T. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-9332-8683 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Brown, J.B.' 1 0000-0003-1329-4063 'Lee, M.A.' 2 0000-0003-0660-7359 'Smith, A.T.' 3 0000-0002-9332-8683 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country GW _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Inorg.Chem. _citation.journal_id_ASTM JJBCFA _citation.journal_id_CSD ? _citation.journal_id_ISSN 1432-1327 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 27 _citation.language ? _citation.page_first 485 _citation.page_last 495 _citation.title 'The structure of Vibrio cholerae FeoC reveals conservation of the helix-turn-helix motif but not the cluster-binding domain.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1007/s00775-022-01945-4 _citation.pdbx_database_id_PubMed 35796835 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Brown, J.B.' 1 ? primary 'Lee, M.A.' 2 ? primary 'Smith, A.T.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Ferrous iron transport protein C' _entity.formula_weight 8590.936 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Iron transporter FeoC' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GMILNELKAAIESKNGATRQELARRFALSEDGIDAMLAVWIKKGVLSRQQYINAEDEVVRVRYVMNQVGSLAVNVTM _entity_poly.pdbx_seq_one_letter_code_can GMILNELKAAIESKNGATRQELARRFALSEDGIDAMLAVWIKKGVLSRQQYINAEDEVVRVRYVMNQVGSLAVNVTM _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 MET n 1 3 ILE n 1 4 LEU n 1 5 ASN n 1 6 GLU n 1 7 LEU n 1 8 LYS n 1 9 ALA n 1 10 ALA n 1 11 ILE n 1 12 GLU n 1 13 SER n 1 14 LYS n 1 15 ASN n 1 16 GLY n 1 17 ALA n 1 18 THR n 1 19 ARG n 1 20 GLN n 1 21 GLU n 1 22 LEU n 1 23 ALA n 1 24 ARG n 1 25 ARG n 1 26 PHE n 1 27 ALA n 1 28 LEU n 1 29 SER n 1 30 GLU n 1 31 ASP n 1 32 GLY n 1 33 ILE n 1 34 ASP n 1 35 ALA n 1 36 MET n 1 37 LEU n 1 38 ALA n 1 39 VAL n 1 40 TRP n 1 41 ILE n 1 42 LYS n 1 43 LYS n 1 44 GLY n 1 45 VAL n 1 46 LEU n 1 47 SER n 1 48 ARG n 1 49 GLN n 1 50 GLN n 1 51 TYR n 1 52 ILE n 1 53 ASN n 1 54 ALA n 1 55 GLU n 1 56 ASP n 1 57 GLU n 1 58 VAL n 1 59 VAL n 1 60 ARG n 1 61 VAL n 1 62 ARG n 1 63 TYR n 1 64 VAL n 1 65 MET n 1 66 ASN n 1 67 GLN n 1 68 VAL n 1 69 GLY n 1 70 SER n 1 71 LEU n 1 72 ALA n 1 73 VAL n 1 74 ASN n 1 75 VAL n 1 76 THR n 1 77 MET n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 77 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ;D6U24_00500, ERS013138_00486, ERS013165_00119, ERS013166_01719, ERS013173_02915, ERS013186_03225, ERS013193_04710, ERS013198_00924, ERS013199_01103, ERS013200_03657, ERS013202_01477, ERS013206_03620, ERS013207_00898, EYB64_02470 ; _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Vibrio cholerae O1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 127906 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 MET 2 2 2 MET MET A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 GLN 20 20 20 GLN GLN A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 MET 36 36 36 MET MET A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 TRP 40 40 40 TRP TRP A . n A 1 41 ILE 41 41 41 ILE ILE A . n A 1 42 LYS 42 42 42 LYS LYS A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 MET 65 65 65 MET MET A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 MET 77 77 77 MET MET A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7U37 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7U37 _struct.title 'Solution NMR structure of Vibrio cholerae ferrous iron transport protein C (FeoC)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7U37 _struct_keywords.text 'FeoC, ferrous iron transport, Feo, CYTOSOLIC PROTEIN' _struct_keywords.pdbx_keywords 'CYTOSOLIC PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0F0B4M5_VIBCL _struct_ref.pdbx_db_accession A0A0F0B4M5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MILNELKAAIESKNGATRQELARRFALSEDGIDAMLAVWIKKGVLSRQQYINAEDEVVRVRYVMNQVGSLAVNVTM _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7U37 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 77 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0F0B4M5 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 76 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 77 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 7U37 _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code A0A0F0B4M5 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ILE A 3 ? LYS A 14 ? ILE A 3 LYS A 14 1 ? 12 HELX_P HELX_P2 AA2 THR A 18 ? ALA A 27 ? THR A 18 ALA A 27 1 ? 10 HELX_P HELX_P3 AA3 SER A 29 ? LYS A 42 ? SER A 29 LYS A 42 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 48 ? ILE A 52 ? ARG A 48 ILE A 52 AA1 2 VAL A 61 ? MET A 65 ? VAL A 61 MET A 65 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ARG _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 48 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ARG _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 48 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id MET _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 65 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id MET _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 65 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 2 ? ? -146.09 -53.60 2 1 SER A 13 ? ? -108.13 -63.86 3 1 ASN A 15 ? ? -53.45 171.97 4 1 LYS A 42 ? ? -120.52 -72.75 5 1 LYS A 43 ? ? -168.73 -38.53 6 1 SER A 47 ? ? 59.92 -170.24 7 1 ASN A 53 ? ? -158.25 -70.68 8 1 ASP A 56 ? ? -105.88 -74.47 9 1 GLU A 57 ? ? -177.66 -67.71 10 1 VAL A 58 ? ? -151.22 44.22 11 1 ARG A 60 ? ? 54.89 72.28 12 1 GLN A 67 ? ? 53.06 88.58 13 1 THR A 76 ? ? -102.76 75.74 14 2 SER A 47 ? ? 55.01 -170.20 15 2 VAL A 59 ? ? -132.15 -52.74 16 2 ARG A 60 ? ? 52.58 83.29 17 2 VAL A 75 ? ? 59.93 78.74 18 3 LYS A 42 ? ? -109.78 -169.90 19 3 SER A 47 ? ? 63.25 173.46 20 3 ASN A 53 ? ? -178.48 -36.33 21 3 VAL A 59 ? ? -148.19 -53.29 22 3 ARG A 60 ? ? 60.09 92.57 23 3 ASN A 66 ? ? -71.09 -74.39 24 3 LEU A 71 ? ? -94.23 40.11 25 4 SER A 47 ? ? 51.95 -169.88 26 4 ALA A 54 ? ? -174.38 49.69 27 4 GLU A 57 ? ? -106.89 -66.74 28 4 VAL A 58 ? ? -139.69 -71.24 29 4 VAL A 59 ? ? -177.39 -38.05 30 4 ARG A 60 ? ? -179.29 90.20 31 4 VAL A 68 ? ? 60.36 81.76 32 5 MET A 2 ? ? -143.41 39.76 33 5 LYS A 14 ? ? -179.20 122.80 34 5 ASN A 15 ? ? 63.04 104.61 35 5 SER A 47 ? ? 52.33 -170.12 36 5 ASN A 53 ? ? -179.59 -34.85 37 5 GLU A 57 ? ? -179.29 -67.82 38 5 VAL A 58 ? ? -152.93 46.14 39 5 VAL A 59 ? ? -90.33 -69.38 40 5 ARG A 60 ? ? 51.75 84.56 41 5 ASN A 74 ? ? 58.50 -172.89 42 6 SER A 47 ? ? 56.82 -170.12 43 6 ASN A 53 ? ? -179.88 -34.49 44 6 VAL A 59 ? ? -167.47 -38.66 45 6 ARG A 60 ? ? 63.23 105.14 46 6 GLN A 67 ? ? -178.56 -169.99 47 6 ASN A 74 ? ? 60.30 -171.46 48 6 THR A 76 ? ? -132.64 -45.91 49 7 LYS A 14 ? ? -168.11 104.25 50 7 ASN A 15 ? ? 63.23 161.28 51 7 LYS A 42 ? ? -121.88 -169.93 52 7 SER A 47 ? ? 54.43 -173.97 53 7 GLU A 55 ? ? -157.90 33.79 54 7 ASP A 56 ? ? -110.69 -74.56 55 7 GLU A 57 ? ? -141.33 -74.45 56 7 VAL A 58 ? ? -152.74 45.20 57 7 SER A 70 ? ? -178.56 34.16 58 7 LEU A 71 ? ? 59.44 89.01 59 7 ALA A 72 ? ? -171.08 106.14 60 7 ASN A 74 ? ? -59.83 179.46 61 7 THR A 76 ? ? -145.78 -43.23 62 8 SER A 47 ? ? 53.26 -170.12 63 8 ASN A 53 ? ? -179.24 -37.26 64 8 ARG A 60 ? ? 55.75 80.20 65 8 ASN A 66 ? ? -59.94 -173.81 66 8 LEU A 71 ? ? -132.25 -56.20 67 8 ALA A 72 ? ? -139.69 -68.30 68 8 VAL A 73 ? ? 58.05 83.92 69 8 ASN A 74 ? ? 57.62 91.59 70 9 MET A 2 ? ? -115.44 57.50 71 9 LYS A 14 ? ? -178.22 142.22 72 9 ASN A 15 ? ? 52.29 87.12 73 9 SER A 47 ? ? 62.67 163.09 74 9 ASN A 53 ? ? -176.34 -38.69 75 9 VAL A 59 ? ? -131.60 -40.24 76 9 ARG A 60 ? ? 63.27 71.50 77 9 SER A 70 ? ? -163.47 117.23 78 9 VAL A 73 ? ? -141.09 30.98 79 9 VAL A 75 ? ? -132.98 -62.07 80 9 THR A 76 ? ? -98.09 -60.96 81 10 SER A 47 ? ? 53.88 -171.93 82 10 ALA A 54 ? ? -133.06 -74.32 83 10 ASP A 56 ? ? -145.60 -71.20 84 10 GLU A 57 ? ? -170.83 60.20 85 10 ARG A 60 ? ? -123.57 -73.53 86 10 LEU A 71 ? ? -107.23 66.29 87 11 LYS A 42 ? ? -151.58 -74.37 88 11 LYS A 43 ? ? -170.88 -38.66 89 11 SER A 47 ? ? 57.63 -170.23 90 11 ASN A 53 ? ? -179.14 -35.14 91 11 ASP A 56 ? ? -149.49 28.00 92 11 VAL A 59 ? ? -144.89 -45.44 93 11 ARG A 60 ? ? 62.24 85.04 94 11 ASN A 66 ? ? -112.88 51.72 95 11 ALA A 72 ? ? -171.19 -55.71 96 11 ASN A 74 ? ? 57.19 86.99 97 12 ASN A 15 ? ? -52.20 103.36 98 12 SER A 47 ? ? 54.58 -170.50 99 12 ASN A 53 ? ? -170.02 -70.71 100 12 ALA A 54 ? ? -160.81 25.19 101 12 THR A 76 ? ? -172.03 31.56 102 13 ASN A 15 ? ? -52.46 103.82 103 13 SER A 47 ? ? 56.59 -170.62 104 13 ALA A 54 ? ? -137.43 -75.37 105 13 ASP A 56 ? ? -165.51 28.48 106 13 ASN A 66 ? ? -63.00 -178.71 107 13 SER A 70 ? ? 61.97 172.46 108 13 ASN A 74 ? ? -173.05 -61.09 109 14 VAL A 45 ? ? -107.42 -69.52 110 14 LEU A 46 ? ? -179.03 34.44 111 14 SER A 47 ? ? 52.30 -169.95 112 14 ALA A 54 ? ? -146.34 -75.63 113 14 ASP A 56 ? ? -154.94 -74.81 114 14 GLU A 57 ? ? -179.31 34.39 115 14 ASN A 66 ? ? -142.44 34.77 116 14 SER A 70 ? ? 61.04 170.37 117 14 LEU A 71 ? ? -161.71 -66.87 118 15 LYS A 14 ? ? -177.30 144.02 119 15 ASN A 15 ? ? 63.22 105.24 120 15 LYS A 43 ? ? -91.58 -69.97 121 15 SER A 47 ? ? 59.44 174.79 122 15 ASN A 53 ? ? -179.65 34.53 123 15 VAL A 59 ? ? -153.04 24.63 124 15 ARG A 60 ? ? -103.91 -67.54 125 15 GLN A 67 ? ? -66.02 -178.78 126 15 ASN A 74 ? ? -161.92 -50.75 127 15 VAL A 75 ? ? 58.74 86.57 128 16 LYS A 42 ? ? -111.80 -75.36 129 16 LYS A 43 ? ? -179.68 -61.57 130 16 SER A 47 ? ? 57.47 -170.95 131 16 ASN A 53 ? ? -179.30 -40.89 132 16 GLU A 55 ? ? -144.75 -60.92 133 16 GLU A 57 ? ? -165.78 45.09 134 16 VAL A 58 ? ? -177.39 -38.12 135 16 VAL A 59 ? ? -148.75 -64.13 136 16 ARG A 60 ? ? 60.95 100.48 137 16 SER A 70 ? ? -151.94 -66.76 138 17 SER A 47 ? ? 63.13 -170.04 139 17 ASN A 53 ? ? -111.75 -74.64 140 17 ASP A 56 ? ? -110.16 -75.37 141 17 GLU A 57 ? ? -179.86 -65.57 142 17 VAL A 58 ? ? -152.98 55.15 143 17 VAL A 59 ? ? -141.52 49.66 144 17 ARG A 60 ? ? -51.33 103.67 145 17 VAL A 75 ? ? 55.99 90.02 146 18 MET A 2 ? ? -153.11 -50.28 147 18 VAL A 45 ? ? -97.73 -72.61 148 18 LEU A 46 ? ? -179.03 34.37 149 18 SER A 47 ? ? 52.21 -170.00 150 18 ARG A 60 ? ? 52.30 88.77 151 18 ASN A 66 ? ? -57.25 179.43 152 18 ASN A 74 ? ? -132.93 -45.45 153 18 VAL A 75 ? ? 60.72 87.90 154 19 MET A 2 ? ? 63.20 90.74 155 19 VAL A 45 ? ? -98.38 -72.66 156 19 LEU A 46 ? ? -179.22 34.42 157 19 SER A 47 ? ? 52.13 -169.98 158 19 ASN A 53 ? ? -178.29 -67.96 159 19 ALA A 54 ? ? -148.36 -52.75 160 19 GLU A 55 ? ? -136.92 -74.86 161 19 ASP A 56 ? ? -179.51 -34.87 162 19 ASN A 66 ? ? -141.18 42.51 163 19 SER A 70 ? ? -98.43 -61.82 164 19 LEU A 71 ? ? 59.49 174.86 165 19 ALA A 72 ? ? 56.00 -177.49 166 19 VAL A 73 ? ? 51.74 77.82 167 20 LYS A 43 ? ? -93.93 -68.17 168 20 SER A 47 ? ? 53.80 -170.69 169 20 ILE A 52 ? ? -171.10 125.91 170 20 ASN A 53 ? ? -179.23 -35.77 171 20 ALA A 54 ? ? -178.11 -35.24 172 20 ASP A 56 ? ? -150.79 -67.50 173 20 GLU A 57 ? ? -179.28 66.59 174 20 VAL A 58 ? ? -125.81 -72.52 175 20 VAL A 59 ? ? -149.78 -46.75 176 20 ARG A 60 ? ? 63.13 104.13 177 20 GLN A 67 ? ? -175.74 61.43 178 20 ASN A 74 ? ? 63.07 97.24 179 20 THR A 76 ? ? -145.75 38.53 # _pdbx_nmr_ensemble.entry_id 7U37 _pdbx_nmr_ensemble.conformers_calculated_total_number 160 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7U37 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 ;50 mM sodium phosphate, 5 mM sodium chloride, 1 g/L [U-99% 15N] ammonium chloride, 300 uM [U-15N] Vibrio cholerae FeoC, 90% H2O/10% D2O ; '90% H2O/10% D2O' 15N solution ? 2 ;50 mM sodium phosphate, 5 mM sodium chloride, 1 g/L [U-15N] ammonium chloride, 4 g/L [U-100% 13C] glucose, 300 uM [U-13C; U-15N] Vibrio cholerae FeoC, 90% H2O/10% D2O ; '90% H2O/10% D2O' 15N_13C solution ? 3 '50 mM sodium phosphate, 5 mM sodium chloride, 4 g/L [U-100% 13C] glucose, 300 uM [U-13C; U-15N] Vibrio cholerae FeoC, 100% D2O' '100% D2O' 13C solution ? 4 '50 mM sodium phosphate, 5 mM sodium chloride, 300 uM [U-13C; U-15N] Vibrio cholerae FeoC, 100% D2O' '100% D2O' UL solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'sodium phosphate' 50 ? mM 'natural abundance' 1 'sodium chloride' 5 ? mM 'natural abundance' 1 'ammonium chloride' 1 ? g/L '[U-99% 15N]' 1 'Vibrio cholerae FeoC' 300 ? uM '[U-15N]' 2 'sodium phosphate' 50 ? mM 'natural abundance' 2 'sodium chloride' 5 ? mM 'natural abundance' 2 'ammonium chloride' 1 ? g/L '[U-15N]' 2 glucose 4 ? g/L '[U-100% 13C]' 2 'Vibrio cholerae FeoC' 300 ? uM '[U-13C; U-15N]' 3 'sodium phosphate' 50 ? mM 'natural abundance' 3 'sodium chloride' 5 ? mM 'natural abundance' 3 glucose 4 ? g/L '[U-100% 13C]' 3 'Vibrio cholerae FeoC' 300 ? uM '[U-13C; U-15N]' 4 'sodium phosphate' 50 ? mM 'natural abundance' 4 'sodium chloride' 5 ? mM 'natural abundance' 4 'Vibrio cholerae FeoC' 300 ? uM '[U-13C; U-15N]' # loop_ _pdbx_nmr_exptl_sample_conditions.conditions_id _pdbx_nmr_exptl_sample_conditions.temperature _pdbx_nmr_exptl_sample_conditions.pressure_units _pdbx_nmr_exptl_sample_conditions.pressure _pdbx_nmr_exptl_sample_conditions.pH _pdbx_nmr_exptl_sample_conditions.ionic_strength _pdbx_nmr_exptl_sample_conditions.details _pdbx_nmr_exptl_sample_conditions.ionic_strength_err _pdbx_nmr_exptl_sample_conditions.ionic_strength_units _pdbx_nmr_exptl_sample_conditions.label _pdbx_nmr_exptl_sample_conditions.pH_err _pdbx_nmr_exptl_sample_conditions.pH_units _pdbx_nmr_exptl_sample_conditions.pressure_err _pdbx_nmr_exptl_sample_conditions.temperature_err _pdbx_nmr_exptl_sample_conditions.temperature_units 1 298 atm 1 6 5 ? ? mM conditions_1 ? pH ? ? K 2 298 atm 1 6 5 ? ? mM conditions_2 ? pD ? ? K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D 1H-15N NOESY' 1 isotropic 3 1 2 '3D CBCA(CO)NH' 1 isotropic 4 1 2 '3D HNCACB' 1 isotropic 5 1 2 '3D HNCO' 1 isotropic 6 1 2 '3D HN(CA)CO' 1 isotropic 7 1 2 '4D HSQC-NOESY-HMQC' 1 isotropic 8 2 3 '4D HMQC-NOESY-HMQC' 1 isotropic 9 2 4 '2D 1H-1H NOESY' 1 isotropic # _pdbx_nmr_refine.entry_id 7U37 _pdbx_nmr_refine.method na _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 5 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection TopSpin ? 'Bruker Biospin' 2 processing NMRFx ? 'Johnson, One Moon Scientific' 3 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 4 'peak picking' NMRView ? 'Johnson, One Moon Scientific' 5 refinement CYANA ? 'Guntert, Mumenthaler and Wuthrich' 6 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 ILE N N N N 123 ILE CA C N S 124 ILE C C N N 125 ILE O O N N 126 ILE CB C N S 127 ILE CG1 C N N 128 ILE CG2 C N N 129 ILE CD1 C N N 130 ILE OXT O N N 131 ILE H H N N 132 ILE H2 H N N 133 ILE HA H N N 134 ILE HB H N N 135 ILE HG12 H N N 136 ILE HG13 H N N 137 ILE HG21 H N N 138 ILE HG22 H N N 139 ILE HG23 H N N 140 ILE HD11 H N N 141 ILE HD12 H N N 142 ILE HD13 H N N 143 ILE HXT H N N 144 LEU N N N N 145 LEU CA C N S 146 LEU C C N N 147 LEU O O N N 148 LEU CB C N N 149 LEU CG C N N 150 LEU CD1 C N N 151 LEU CD2 C N N 152 LEU OXT O N N 153 LEU H H N N 154 LEU H2 H N N 155 LEU HA H N N 156 LEU HB2 H N N 157 LEU HB3 H N N 158 LEU HG H N N 159 LEU HD11 H N N 160 LEU HD12 H N N 161 LEU HD13 H N N 162 LEU HD21 H N N 163 LEU HD22 H N N 164 LEU HD23 H N N 165 LEU HXT H N N 166 LYS N N N N 167 LYS CA C N S 168 LYS C C N N 169 LYS O O N N 170 LYS CB C N N 171 LYS CG C N N 172 LYS CD C N N 173 LYS CE C N N 174 LYS NZ N N N 175 LYS OXT O N N 176 LYS H H N N 177 LYS H2 H N N 178 LYS HA H N N 179 LYS HB2 H N N 180 LYS HB3 H N N 181 LYS HG2 H N N 182 LYS HG3 H N N 183 LYS HD2 H N N 184 LYS HD3 H N N 185 LYS HE2 H N N 186 LYS HE3 H N N 187 LYS HZ1 H N N 188 LYS HZ2 H N N 189 LYS HZ3 H N N 190 LYS HXT H N N 191 MET N N N N 192 MET CA C N S 193 MET C C N N 194 MET O O N N 195 MET CB C N N 196 MET CG C N N 197 MET SD S N N 198 MET CE C N N 199 MET OXT O N N 200 MET H H N N 201 MET H2 H N N 202 MET HA H N N 203 MET HB2 H N N 204 MET HB3 H N N 205 MET HG2 H N N 206 MET HG3 H N N 207 MET HE1 H N N 208 MET HE2 H N N 209 MET HE3 H N N 210 MET HXT H N N 211 PHE N N N N 212 PHE CA C N S 213 PHE C C N N 214 PHE O O N N 215 PHE CB C N N 216 PHE CG C Y N 217 PHE CD1 C Y N 218 PHE CD2 C Y N 219 PHE CE1 C Y N 220 PHE CE2 C Y N 221 PHE CZ C Y N 222 PHE OXT O N N 223 PHE H H N N 224 PHE H2 H N N 225 PHE HA H N N 226 PHE HB2 H N N 227 PHE HB3 H N N 228 PHE HD1 H N N 229 PHE HD2 H N N 230 PHE HE1 H N N 231 PHE HE2 H N N 232 PHE HZ H N N 233 PHE HXT H N N 234 SER N N N N 235 SER CA C N S 236 SER C C N N 237 SER O O N N 238 SER CB C N N 239 SER OG O N N 240 SER OXT O N N 241 SER H H N N 242 SER H2 H N N 243 SER HA H N N 244 SER HB2 H N N 245 SER HB3 H N N 246 SER HG H N N 247 SER HXT H N N 248 THR N N N N 249 THR CA C N S 250 THR C C N N 251 THR O O N N 252 THR CB C N R 253 THR OG1 O N N 254 THR CG2 C N N 255 THR OXT O N N 256 THR H H N N 257 THR H2 H N N 258 THR HA H N N 259 THR HB H N N 260 THR HG1 H N N 261 THR HG21 H N N 262 THR HG22 H N N 263 THR HG23 H N N 264 THR HXT H N N 265 TRP N N N N 266 TRP CA C N S 267 TRP C C N N 268 TRP O O N N 269 TRP CB C N N 270 TRP CG C Y N 271 TRP CD1 C Y N 272 TRP CD2 C Y N 273 TRP NE1 N Y N 274 TRP CE2 C Y N 275 TRP CE3 C Y N 276 TRP CZ2 C Y N 277 TRP CZ3 C Y N 278 TRP CH2 C Y N 279 TRP OXT O N N 280 TRP H H N N 281 TRP H2 H N N 282 TRP HA H N N 283 TRP HB2 H N N 284 TRP HB3 H N N 285 TRP HD1 H N N 286 TRP HE1 H N N 287 TRP HE3 H N N 288 TRP HZ2 H N N 289 TRP HZ3 H N N 290 TRP HH2 H N N 291 TRP HXT H N N 292 TYR N N N N 293 TYR CA C N S 294 TYR C C N N 295 TYR O O N N 296 TYR CB C N N 297 TYR CG C Y N 298 TYR CD1 C Y N 299 TYR CD2 C Y N 300 TYR CE1 C Y N 301 TYR CE2 C Y N 302 TYR CZ C Y N 303 TYR OH O N N 304 TYR OXT O N N 305 TYR H H N N 306 TYR H2 H N N 307 TYR HA H N N 308 TYR HB2 H N N 309 TYR HB3 H N N 310 TYR HD1 H N N 311 TYR HD2 H N N 312 TYR HE1 H N N 313 TYR HE2 H N N 314 TYR HH H N N 315 TYR HXT H N N 316 VAL N N N N 317 VAL CA C N S 318 VAL C C N N 319 VAL O O N N 320 VAL CB C N N 321 VAL CG1 C N N 322 VAL CG2 C N N 323 VAL OXT O N N 324 VAL H H N N 325 VAL H2 H N N 326 VAL HA H N N 327 VAL HB H N N 328 VAL HG11 H N N 329 VAL HG12 H N N 330 VAL HG13 H N N 331 VAL HG21 H N N 332 VAL HG22 H N N 333 VAL HG23 H N N 334 VAL HXT H N N 335 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 MET N CA sing N N 182 MET N H sing N N 183 MET N H2 sing N N 184 MET CA C sing N N 185 MET CA CB sing N N 186 MET CA HA sing N N 187 MET C O doub N N 188 MET C OXT sing N N 189 MET CB CG sing N N 190 MET CB HB2 sing N N 191 MET CB HB3 sing N N 192 MET CG SD sing N N 193 MET CG HG2 sing N N 194 MET CG HG3 sing N N 195 MET SD CE sing N N 196 MET CE HE1 sing N N 197 MET CE HE2 sing N N 198 MET CE HE3 sing N N 199 MET OXT HXT sing N N 200 PHE N CA sing N N 201 PHE N H sing N N 202 PHE N H2 sing N N 203 PHE CA C sing N N 204 PHE CA CB sing N N 205 PHE CA HA sing N N 206 PHE C O doub N N 207 PHE C OXT sing N N 208 PHE CB CG sing N N 209 PHE CB HB2 sing N N 210 PHE CB HB3 sing N N 211 PHE CG CD1 doub Y N 212 PHE CG CD2 sing Y N 213 PHE CD1 CE1 sing Y N 214 PHE CD1 HD1 sing N N 215 PHE CD2 CE2 doub Y N 216 PHE CD2 HD2 sing N N 217 PHE CE1 CZ doub Y N 218 PHE CE1 HE1 sing N N 219 PHE CE2 CZ sing Y N 220 PHE CE2 HE2 sing N N 221 PHE CZ HZ sing N N 222 PHE OXT HXT sing N N 223 SER N CA sing N N 224 SER N H sing N N 225 SER N H2 sing N N 226 SER CA C sing N N 227 SER CA CB sing N N 228 SER CA HA sing N N 229 SER C O doub N N 230 SER C OXT sing N N 231 SER CB OG sing N N 232 SER CB HB2 sing N N 233 SER CB HB3 sing N N 234 SER OG HG sing N N 235 SER OXT HXT sing N N 236 THR N CA sing N N 237 THR N H sing N N 238 THR N H2 sing N N 239 THR CA C sing N N 240 THR CA CB sing N N 241 THR CA HA sing N N 242 THR C O doub N N 243 THR C OXT sing N N 244 THR CB OG1 sing N N 245 THR CB CG2 sing N N 246 THR CB HB sing N N 247 THR OG1 HG1 sing N N 248 THR CG2 HG21 sing N N 249 THR CG2 HG22 sing N N 250 THR CG2 HG23 sing N N 251 THR OXT HXT sing N N 252 TRP N CA sing N N 253 TRP N H sing N N 254 TRP N H2 sing N N 255 TRP CA C sing N N 256 TRP CA CB sing N N 257 TRP CA HA sing N N 258 TRP C O doub N N 259 TRP C OXT sing N N 260 TRP CB CG sing N N 261 TRP CB HB2 sing N N 262 TRP CB HB3 sing N N 263 TRP CG CD1 doub Y N 264 TRP CG CD2 sing Y N 265 TRP CD1 NE1 sing Y N 266 TRP CD1 HD1 sing N N 267 TRP CD2 CE2 doub Y N 268 TRP CD2 CE3 sing Y N 269 TRP NE1 CE2 sing Y N 270 TRP NE1 HE1 sing N N 271 TRP CE2 CZ2 sing Y N 272 TRP CE3 CZ3 doub Y N 273 TRP CE3 HE3 sing N N 274 TRP CZ2 CH2 doub Y N 275 TRP CZ2 HZ2 sing N N 276 TRP CZ3 CH2 sing Y N 277 TRP CZ3 HZ3 sing N N 278 TRP CH2 HH2 sing N N 279 TRP OXT HXT sing N N 280 TYR N CA sing N N 281 TYR N H sing N N 282 TYR N H2 sing N N 283 TYR CA C sing N N 284 TYR CA CB sing N N 285 TYR CA HA sing N N 286 TYR C O doub N N 287 TYR C OXT sing N N 288 TYR CB CG sing N N 289 TYR CB HB2 sing N N 290 TYR CB HB3 sing N N 291 TYR CG CD1 doub Y N 292 TYR CG CD2 sing Y N 293 TYR CD1 CE1 sing Y N 294 TYR CD1 HD1 sing N N 295 TYR CD2 CE2 doub Y N 296 TYR CD2 HD2 sing N N 297 TYR CE1 CZ doub Y N 298 TYR CE1 HE1 sing N N 299 TYR CE2 CZ sing Y N 300 TYR CE2 HE2 sing N N 301 TYR CZ OH sing N N 302 TYR OH HH sing N N 303 TYR OXT HXT sing N N 304 VAL N CA sing N N 305 VAL N H sing N N 306 VAL N H2 sing N N 307 VAL CA C sing N N 308 VAL CA CB sing N N 309 VAL CA HA sing N N 310 VAL C O doub N N 311 VAL C OXT sing N N 312 VAL CB CG1 sing N N 313 VAL CB CG2 sing N N 314 VAL CB HB sing N N 315 VAL CG1 HG11 sing N N 316 VAL CG1 HG12 sing N N 317 VAL CG1 HG13 sing N N 318 VAL CG2 HG21 sing N N 319 VAL CG2 HG22 sing N N 320 VAL CG2 HG23 sing N N 321 VAL OXT HXT sing N N 322 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 'R35 GM133497' 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 'T32 GM066706' 2 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model DMX _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 7U37 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_