data_7U5O # _entry.id 7U5O # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7U5O pdb_00007u5o 10.2210/pdb7u5o/pdb WWPDB D_1000263550 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7U5O _pdbx_database_status.recvd_initial_deposition_date 2022-03-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chu, K.Y.' 1 0000-0001-7638-0191 'Malik, A.' 2 0000-0002-6054-2050 'Thamilselvan, V.' 3 0000-0002-2932-5613 'Martinez-Hackert, E.' 4 0000-0002-6182-7023 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 298 _citation.language ? _citation.page_first 102076 _citation.page_last 102076 _citation.title 'Type II BMP and activin receptors BMPR2 and ACVR2A share a conserved mode of growth factor recognition.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jbc.2022.102076 _citation.pdbx_database_id_PubMed 35643319 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chu, K.Y.' 1 ? primary 'Malik, A.' 2 ? primary 'Thamilselvan, V.' 3 ? primary 'Martinez-Hackert, E.' 4 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 100.920 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7U5O _cell.details ? _cell.formula_units_Z ? _cell.length_a 80.960 _cell.length_a_esd ? _cell.length_b 115.460 _cell.length_b_esd ? _cell.length_c 110.160 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7U5O _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Inhibin beta B chain' 12825.582 3 ? ? ? ? 2 polymer man 'Bone morphogenetic protein receptor type-2' 12427.736 3 2.7.11.30 ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'Activin beta-B chain' 2 'BMP type-2 receptor,BMPR-2,Bone morphogenetic protein receptor type II,BMP type II receptor,BMPR-II' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCC IPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA ; ;GLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCC IPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA ; A,B,C ? 2 'polypeptide(L)' no no ;SQNQERLCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPP SIQNGTYRFCCCSTDLCNVNFTENFPPPDTT ; ;SQNQERLCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPP SIQNGTYRFCCCSTDLCNVNFTENFPPPDTT ; E,F,G ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 LEU n 1 3 GLU n 1 4 CYS n 1 5 ASP n 1 6 GLY n 1 7 ARG n 1 8 THR n 1 9 ASN n 1 10 LEU n 1 11 CYS n 1 12 CYS n 1 13 ARG n 1 14 GLN n 1 15 GLN n 1 16 PHE n 1 17 PHE n 1 18 ILE n 1 19 ASP n 1 20 PHE n 1 21 ARG n 1 22 LEU n 1 23 ILE n 1 24 GLY n 1 25 TRP n 1 26 ASN n 1 27 ASP n 1 28 TRP n 1 29 ILE n 1 30 ILE n 1 31 ALA n 1 32 PRO n 1 33 THR n 1 34 GLY n 1 35 TYR n 1 36 TYR n 1 37 GLY n 1 38 ASN n 1 39 TYR n 1 40 CYS n 1 41 GLU n 1 42 GLY n 1 43 SER n 1 44 CYS n 1 45 PRO n 1 46 ALA n 1 47 TYR n 1 48 LEU n 1 49 ALA n 1 50 GLY n 1 51 VAL n 1 52 PRO n 1 53 GLY n 1 54 SER n 1 55 ALA n 1 56 SER n 1 57 SER n 1 58 PHE n 1 59 HIS n 1 60 THR n 1 61 ALA n 1 62 VAL n 1 63 VAL n 1 64 ASN n 1 65 GLN n 1 66 TYR n 1 67 ARG n 1 68 MET n 1 69 ARG n 1 70 GLY n 1 71 LEU n 1 72 ASN n 1 73 PRO n 1 74 GLY n 1 75 THR n 1 76 VAL n 1 77 ASN n 1 78 SER n 1 79 CYS n 1 80 CYS n 1 81 ILE n 1 82 PRO n 1 83 THR n 1 84 LYS n 1 85 LEU n 1 86 SER n 1 87 THR n 1 88 MET n 1 89 SER n 1 90 MET n 1 91 LEU n 1 92 TYR n 1 93 PHE n 1 94 ASP n 1 95 ASP n 1 96 GLU n 1 97 TYR n 1 98 ASN n 1 99 ILE n 1 100 VAL n 1 101 LYS n 1 102 ARG n 1 103 ASP n 1 104 VAL n 1 105 PRO n 1 106 ASN n 1 107 MET n 1 108 ILE n 1 109 VAL n 1 110 GLU n 1 111 GLU n 1 112 CYS n 1 113 GLY n 1 114 CYS n 1 115 ALA n 2 1 SER n 2 2 GLN n 2 3 ASN n 2 4 GLN n 2 5 GLU n 2 6 ARG n 2 7 LEU n 2 8 CYS n 2 9 ALA n 2 10 PHE n 2 11 LYS n 2 12 ASP n 2 13 PRO n 2 14 TYR n 2 15 GLN n 2 16 GLN n 2 17 ASP n 2 18 LEU n 2 19 GLY n 2 20 ILE n 2 21 GLY n 2 22 GLU n 2 23 SER n 2 24 ARG n 2 25 ILE n 2 26 SER n 2 27 HIS n 2 28 GLU n 2 29 ASN n 2 30 GLY n 2 31 THR n 2 32 ILE n 2 33 LEU n 2 34 CYS n 2 35 SER n 2 36 LYS n 2 37 GLY n 2 38 SER n 2 39 THR n 2 40 CYS n 2 41 TYR n 2 42 GLY n 2 43 LEU n 2 44 TRP n 2 45 GLU n 2 46 LYS n 2 47 SER n 2 48 LYS n 2 49 GLY n 2 50 ASP n 2 51 ILE n 2 52 ASN n 2 53 LEU n 2 54 VAL n 2 55 LYS n 2 56 GLN n 2 57 GLY n 2 58 CYS n 2 59 TRP n 2 60 SER n 2 61 HIS n 2 62 ILE n 2 63 GLY n 2 64 ASP n 2 65 PRO n 2 66 GLN n 2 67 GLU n 2 68 CYS n 2 69 HIS n 2 70 TYR n 2 71 GLU n 2 72 GLU n 2 73 CYS n 2 74 VAL n 2 75 VAL n 2 76 THR n 2 77 THR n 2 78 THR n 2 79 PRO n 2 80 PRO n 2 81 SER n 2 82 ILE n 2 83 GLN n 2 84 ASN n 2 85 GLY n 2 86 THR n 2 87 TYR n 2 88 ARG n 2 89 PHE n 2 90 CYS n 2 91 CYS n 2 92 CYS n 2 93 SER n 2 94 THR n 2 95 ASP n 2 96 LEU n 2 97 CYS n 2 98 ASN n 2 99 VAL n 2 100 ASN n 2 101 PHE n 2 102 THR n 2 103 GLU n 2 104 ASN n 2 105 PHE n 2 106 PRO n 2 107 PRO n 2 108 PRO n 2 109 ASP n 2 110 THR n 2 111 THR n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 115 human ? INHBB ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'Chinese hamster' 'Cricetulus griseus' 10029 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 111 human ? 'BMPR2, PPH1' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 'Chinese hamster' 'Cricetulus griseus' 10029 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP INHBB_HUMAN P09529 ? 1 ;GLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCC IPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA ; 293 2 UNP BMPR2_HUMAN Q13873 ? 2 ;SQNQERLCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPP SIQNGTYRFCCCSTDLCNVNFTENFPPPDTT ; 27 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7U5O A 1 ? 115 ? P09529 293 ? 407 ? 293 407 2 1 7U5O B 1 ? 115 ? P09529 293 ? 407 ? 293 407 3 1 7U5O C 1 ? 115 ? P09529 293 ? 407 ? 293 407 4 2 7U5O E 1 ? 111 ? Q13873 27 ? 137 ? 27 137 5 2 7U5O F 1 ? 111 ? Q13873 27 ? 137 ? 27 137 6 2 7U5O G 1 ? 111 ? Q13873 27 ? 137 ? 27 137 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7U5O _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.34 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 58.81 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.4 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 294 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;175 mM Ammonium Sulfate 100 mM Bis Tris 14% PEG 3000 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-02-22 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97857 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-G' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97857 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-G _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 112.69 _reflns.entry_id 7U5O _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.45 _reflns.d_resolution_low 60.34 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13152 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.7 _reflns.pdbx_Rmerge_I_obs 0.102 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.57 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.120 _reflns.pdbx_Rpim_I_all 0.062 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.988 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3.45 _reflns_shell.d_res_low 3.78 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 3121 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.909 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 326.840 _refine.B_iso_mean 141.7258 _refine.B_iso_min 53.540 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7U5O _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.4500 _refine.ls_d_res_low 36.0600 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13115 _refine.ls_number_reflns_R_free 646 _refine.ls_number_reflns_R_work 12469 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.5700 _refine.ls_percent_reflns_R_free 4.9300 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2381 _refine.ls_R_factor_R_free 0.2844 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2357 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2HLR _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 33.2700 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.4500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 3.4500 _refine_hist.d_res_low 36.0600 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 4358 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 587 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 4358 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 975 10.949 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 975 10.949 ? 1 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 3 TORSIONAL ? C 975 10.949 ? 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 4 TORSIONAL ? E 414 10.949 ? 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 5 TORSIONAL ? F 414 10.949 ? 2 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.4500 3.7200 2620 . 132 2488 100.0000 . . . 0.2941 0.0000 0.2632 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.7200 4.0900 2616 . 124 2492 100.0000 . . . 0.3211 0.0000 0.2250 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 4.0900 4.6800 2622 . 125 2497 100.0000 . . . 0.2684 0.0000 0.1976 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 4.6800 5.8900 2642 . 133 2509 100.0000 . . . 0.2614 0.0000 0.2327 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 5.8900 36.0600 2615 . 132 2483 98.0000 . . . 0.2931 0.0000 0.2546 . . . . . . . 5 . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and (resid 293 through 298 or (resid 299 and (name N or name CA or name C or name O or name CB )) or resid 300 through 312 or (resid 313 and (name N or name CA or name C or name O or name CB )) or resid 314 through 338 or (resid 339 and (name N or name CA or name C or name O or name CB )) or resid 346 through 375 or (resid 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 393 or (resid 394 and (name N or name CA or name C or name O or name CB )) or resid 395 through 407)) ; 1 2 ;(chain B and (resid 293 through 300 or (resid 301 and (name N or name CA or name C or name O or name CB )) or resid 302 through 312 or (resid 313 and (name N or name CA or name C or name O or name CB )) or resid 314 through 338 or (resid 339 and (name N or name CA or name C or name O or name CB )) or resid 346 through 375 or (resid 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 392 or (resid 393 through 394 and (name N or name CA or name C or name O or name CB )) or resid 395 through 407)) ; 1 3 ;(chain C and (resid 293 through 298 or (resid 299 and (name N or name CA or name C or name O or name CB )) or resid 300 or (resid 301 and (name N or name CA or name C or name O or name CB )) or resid 302 through 306 or (resid 307 and (name N or name CA or name C or name O or name CB )) or resid 308 through 339 or resid 346 through 368 or (resid 369 and (name N or name CA or name C or name O or name CB )) or resid 370 through 407)) ; 2 1 ;(chain E and (resid 32 through 39 or (resid 40 through 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 87 or resid 93 through 102 or resid 112 through 120 or (resid 121 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 129 or (resid 130 through 131 and (name N or name CA or name C or name O or name CB )) or resid 132 through 133)) ; 2 2 ;(chain F and ((resid 32 through 33 and (name N or name CA or name C or name O or name CB )) or resid 34 through 41 or (resid 53 through 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 71 or resid 75 through 102 or resid 112 through 125 or (resid 126 and (name N or name CA or name C or name O or name CB )) or resid 127 through 133)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A GLY 1 . A GLY 6 . A GLY 293 A GLY 298 ? ;(chain A and (resid 293 through 298 or (resid 299 and (name N or name CA or name C or name O or name CB )) or resid 300 through 312 or (resid 313 and (name N or name CA or name C or name O or name CB )) or resid 314 through 338 or (resid 339 and (name N or name CA or name C or name O or name CB )) or resid 346 through 375 or (resid 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 393 or (resid 394 and (name N or name CA or name C or name O or name CB )) or resid 395 through 407)) ; 1 1 2 A ARG 7 . A ARG 7 . A ARG 299 A ARG 299 ? ;(chain A and (resid 293 through 298 or (resid 299 and (name N or name CA or name C or name O or name CB )) or resid 300 through 312 or (resid 313 and (name N or name CA or name C or name O or name CB )) or resid 314 through 338 or (resid 339 and (name N or name CA or name C or name O or name CB )) or resid 346 through 375 or (resid 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 393 or (resid 394 and (name N or name CA or name C or name O or name CB )) or resid 395 through 407)) ; 1 1 3 A GLY 1 . A ALA 115 . A GLY 293 A ALA 407 ? ;(chain A and (resid 293 through 298 or (resid 299 and (name N or name CA or name C or name O or name CB )) or resid 300 through 312 or (resid 313 and (name N or name CA or name C or name O or name CB )) or resid 314 through 338 or (resid 339 and (name N or name CA or name C or name O or name CB )) or resid 346 through 375 or (resid 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 393 or (resid 394 and (name N or name CA or name C or name O or name CB )) or resid 395 through 407)) ; 1 1 4 A GLY 1 . A ALA 115 . A GLY 293 A ALA 407 ? ;(chain A and (resid 293 through 298 or (resid 299 and (name N or name CA or name C or name O or name CB )) or resid 300 through 312 or (resid 313 and (name N or name CA or name C or name O or name CB )) or resid 314 through 338 or (resid 339 and (name N or name CA or name C or name O or name CB )) or resid 346 through 375 or (resid 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 393 or (resid 394 and (name N or name CA or name C or name O or name CB )) or resid 395 through 407)) ; 1 1 5 A GLY 1 . A ALA 115 . A GLY 293 A ALA 407 ? ;(chain A and (resid 293 through 298 or (resid 299 and (name N or name CA or name C or name O or name CB )) or resid 300 through 312 or (resid 313 and (name N or name CA or name C or name O or name CB )) or resid 314 through 338 or (resid 339 and (name N or name CA or name C or name O or name CB )) or resid 346 through 375 or (resid 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 393 or (resid 394 and (name N or name CA or name C or name O or name CB )) or resid 395 through 407)) ; 1 1 6 A GLY 1 . A ALA 115 . A GLY 293 A ALA 407 ? ;(chain A and (resid 293 through 298 or (resid 299 and (name N or name CA or name C or name O or name CB )) or resid 300 through 312 or (resid 313 and (name N or name CA or name C or name O or name CB )) or resid 314 through 338 or (resid 339 and (name N or name CA or name C or name O or name CB )) or resid 346 through 375 or (resid 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 393 or (resid 394 and (name N or name CA or name C or name O or name CB )) or resid 395 through 407)) ; 1 2 1 B GLY 1 . B THR 8 . B GLY 293 B THR 300 ? ;(chain B and (resid 293 through 300 or (resid 301 and (name N or name CA or name C or name O or name CB )) or resid 302 through 312 or (resid 313 and (name N or name CA or name C or name O or name CB )) or resid 314 through 338 or (resid 339 and (name N or name CA or name C or name O or name CB )) or resid 346 through 375 or (resid 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 392 or (resid 393 through 394 and (name N or name CA or name C or name O or name CB )) or resid 395 through 407)) ; 1 2 2 B ASN 9 . B ASN 9 . B ASN 301 B ASN 301 ? ;(chain B and (resid 293 through 300 or (resid 301 and (name N or name CA or name C or name O or name CB )) or resid 302 through 312 or (resid 313 and (name N or name CA or name C or name O or name CB )) or resid 314 through 338 or (resid 339 and (name N or name CA or name C or name O or name CB )) or resid 346 through 375 or (resid 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 392 or (resid 393 through 394 and (name N or name CA or name C or name O or name CB )) or resid 395 through 407)) ; 1 2 3 B GLY 1 . B ALA 115 . B GLY 293 B ALA 407 ? ;(chain B and (resid 293 through 300 or (resid 301 and (name N or name CA or name C or name O or name CB )) or resid 302 through 312 or (resid 313 and (name N or name CA or name C or name O or name CB )) or resid 314 through 338 or (resid 339 and (name N or name CA or name C or name O or name CB )) or resid 346 through 375 or (resid 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 392 or (resid 393 through 394 and (name N or name CA or name C or name O or name CB )) or resid 395 through 407)) ; 1 2 4 B GLY 1 . B ALA 115 . B GLY 293 B ALA 407 ? ;(chain B and (resid 293 through 300 or (resid 301 and (name N or name CA or name C or name O or name CB )) or resid 302 through 312 or (resid 313 and (name N or name CA or name C or name O or name CB )) or resid 314 through 338 or (resid 339 and (name N or name CA or name C or name O or name CB )) or resid 346 through 375 or (resid 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 392 or (resid 393 through 394 and (name N or name CA or name C or name O or name CB )) or resid 395 through 407)) ; 1 2 5 B GLY 1 . B ALA 115 . B GLY 293 B ALA 407 ? ;(chain B and (resid 293 through 300 or (resid 301 and (name N or name CA or name C or name O or name CB )) or resid 302 through 312 or (resid 313 and (name N or name CA or name C or name O or name CB )) or resid 314 through 338 or (resid 339 and (name N or name CA or name C or name O or name CB )) or resid 346 through 375 or (resid 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 392 or (resid 393 through 394 and (name N or name CA or name C or name O or name CB )) or resid 395 through 407)) ; 1 2 6 B GLY 1 . B ALA 115 . B GLY 293 B ALA 407 ? ;(chain B and (resid 293 through 300 or (resid 301 and (name N or name CA or name C or name O or name CB )) or resid 302 through 312 or (resid 313 and (name N or name CA or name C or name O or name CB )) or resid 314 through 338 or (resid 339 and (name N or name CA or name C or name O or name CB )) or resid 346 through 375 or (resid 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 392 or (resid 393 through 394 and (name N or name CA or name C or name O or name CB )) or resid 395 through 407)) ; 1 3 1 C GLY 1 . C GLY 6 . C GLY 293 C GLY 298 ? ;(chain C and (resid 293 through 298 or (resid 299 and (name N or name CA or name C or name O or name CB )) or resid 300 or (resid 301 and (name N or name CA or name C or name O or name CB )) or resid 302 through 306 or (resid 307 and (name N or name CA or name C or name O or name CB )) or resid 308 through 339 or resid 346 through 368 or (resid 369 and (name N or name CA or name C or name O or name CB )) or resid 370 through 407)) ; 1 3 2 C ARG 7 . C ARG 7 . C ARG 299 C ARG 299 ? ;(chain C and (resid 293 through 298 or (resid 299 and (name N or name CA or name C or name O or name CB )) or resid 300 or (resid 301 and (name N or name CA or name C or name O or name CB )) or resid 302 through 306 or (resid 307 and (name N or name CA or name C or name O or name CB )) or resid 308 through 339 or resid 346 through 368 or (resid 369 and (name N or name CA or name C or name O or name CB )) or resid 370 through 407)) ; 2 1 1 D ARG 6 . D PRO 13 . E ARG 32 E PRO 39 ? ;(chain E and (resid 32 through 39 or (resid 40 through 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 87 or resid 93 through 102 or resid 112 through 120 or (resid 121 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 129 or (resid 130 through 131 and (name N or name CA or name C or name O or name CB )) or resid 132 through 133)) ; 2 1 2 D TYR 14 . D GLU 28 . E TYR 40 E GLU 54 ? ;(chain E and (resid 32 through 39 or (resid 40 through 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 87 or resid 93 through 102 or resid 112 through 120 or (resid 121 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 129 or (resid 130 through 131 and (name N or name CA or name C or name O or name CB )) or resid 132 through 133)) ; 2 1 3 D GLU 5 . D PRO 107 . E GLU 31 E PRO 133 ? ;(chain E and (resid 32 through 39 or (resid 40 through 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 87 or resid 93 through 102 or resid 112 through 120 or (resid 121 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 129 or (resid 130 through 131 and (name N or name CA or name C or name O or name CB )) or resid 132 through 133)) ; 2 1 4 D GLU 5 . D PRO 107 . E GLU 31 E PRO 133 ? ;(chain E and (resid 32 through 39 or (resid 40 through 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 87 or resid 93 through 102 or resid 112 through 120 or (resid 121 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 129 or (resid 130 through 131 and (name N or name CA or name C or name O or name CB )) or resid 132 through 133)) ; 2 1 5 D GLU 5 . D PRO 107 . E GLU 31 E PRO 133 ? ;(chain E and (resid 32 through 39 or (resid 40 through 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 87 or resid 93 through 102 or resid 112 through 120 or (resid 121 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 129 or (resid 130 through 131 and (name N or name CA or name C or name O or name CB )) or resid 132 through 133)) ; 2 1 6 D GLU 5 . D PRO 107 . E GLU 31 E PRO 133 ? ;(chain E and (resid 32 through 39 or (resid 40 through 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 87 or resid 93 through 102 or resid 112 through 120 or (resid 121 through 122 and (name N or name CA or name C or name O or name CB )) or resid 123 through 129 or (resid 130 through 131 and (name N or name CA or name C or name O or name CB )) or resid 132 through 133)) ; 2 2 1 E ARG 6 . E LEU 7 . F ARG 32 F LEU 33 ? ;(chain F and ((resid 32 through 33 and (name N or name CA or name C or name O or name CB )) or resid 34 through 41 or (resid 53 through 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 71 or resid 75 through 102 or resid 112 through 125 or (resid 126 and (name N or name CA or name C or name O or name CB )) or resid 127 through 133)) ; 2 2 2 E ARG 6 . E PRO 107 . F ARG 32 F PRO 133 ? ;(chain F and ((resid 32 through 33 and (name N or name CA or name C or name O or name CB )) or resid 34 through 41 or (resid 53 through 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 71 or resid 75 through 102 or resid 112 through 125 or (resid 126 and (name N or name CA or name C or name O or name CB )) or resid 127 through 133)) ; 2 2 3 E ARG 6 . E PRO 107 . F ARG 32 F PRO 133 ? ;(chain F and ((resid 32 through 33 and (name N or name CA or name C or name O or name CB )) or resid 34 through 41 or (resid 53 through 54 and (name N or name CA or name C or name O or name CB )) or resid 55 through 71 or resid 75 through 102 or resid 112 through 125 or (resid 126 and (name N or name CA or name C or name O or name CB )) or resid 127 through 133)) ; # loop_ _struct_ncs_ens.id _struct_ncs_ens.details 1 ? 2 ? # _struct.entry_id 7U5O _struct.title 'CRYSTAL STRUCTURE OF THE BONE MORPHOGENETIC PROTEIN RECEPTOR TYPE 2 LIGAND BINDING DOMAIN IN COMPLEX WITH ACTIVIN-B' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7U5O _struct_keywords.text 'Cell Signaling, Receptor-ligand complex, Growth factor, Receptor interaction, Activin B, BMPRII, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 2 ? E N N 2 ? F N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 54 ? ARG A 69 ? SER A 346 ARG A 361 1 ? 16 HELX_P HELX_P2 AA2 ALA B 55 ? ARG B 69 ? ALA B 347 ARG B 361 1 ? 15 HELX_P HELX_P3 AA3 SER C 54 ? ARG C 69 ? SER C 346 ARG C 361 1 ? 16 HELX_P HELX_P4 AA4 LEU D 96 ? ASN D 100 ? LEU E 122 ASN E 126 5 ? 5 HELX_P HELX_P5 AA5 GLY F 21 ? ILE F 25 ? GLY G 47 ILE G 51 5 ? 5 HELX_P HELX_P6 AA6 LEU F 96 ? ASN F 100 ? LEU G 122 ASN G 126 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 4 SG ? ? ? 1_555 A CYS 12 SG ? ? A CYS 296 A CYS 304 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf2 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 80 SG ? ? A CYS 303 A CYS 372 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf3 disulf ? ? A CYS 40 SG ? ? ? 1_555 A CYS 112 SG ? ? A CYS 332 A CYS 404 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf4 disulf ? ? A CYS 44 SG ? ? ? 1_555 A CYS 114 SG ? ? A CYS 336 A CYS 406 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf5 disulf ? ? A CYS 79 SG ? ? ? 1_555 A CYS 79 SG ? ? A CYS 371 A CYS 371 2_556 ? ? ? ? ? ? ? 2.005 ? ? disulf6 disulf ? ? B CYS 4 SG ? ? ? 1_555 B CYS 12 SG ? ? B CYS 296 B CYS 304 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf7 disulf ? ? B CYS 11 SG ? ? ? 1_555 B CYS 80 SG ? ? B CYS 303 B CYS 372 1_555 ? ? ? ? ? ? ? 2.027 ? ? disulf8 disulf ? ? B CYS 40 SG ? ? ? 1_555 B CYS 112 SG ? ? B CYS 332 B CYS 404 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf9 disulf ? ? B CYS 44 SG ? ? ? 1_555 B CYS 114 SG ? ? B CYS 336 B CYS 406 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf10 disulf ? ? B CYS 79 SG ? ? ? 1_555 C CYS 79 SG ? ? B CYS 371 C CYS 371 2_556 ? ? ? ? ? ? ? 2.024 ? ? disulf11 disulf ? ? C CYS 4 SG ? ? ? 1_555 C CYS 12 SG ? ? C CYS 296 C CYS 304 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf12 disulf ? ? C CYS 11 SG ? ? ? 1_555 C CYS 80 SG ? ? C CYS 303 C CYS 372 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf13 disulf ? ? C CYS 40 SG ? ? ? 1_555 C CYS 112 SG ? ? C CYS 332 C CYS 404 1_555 ? ? ? ? ? ? ? 2.019 ? ? disulf14 disulf ? ? C CYS 44 SG ? ? ? 1_555 C CYS 114 SG ? ? C CYS 336 C CYS 406 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf15 disulf ? ? D CYS 8 SG ? ? ? 1_555 D CYS 40 SG ? ? E CYS 34 E CYS 66 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf16 disulf ? ? D CYS 34 SG ? ? ? 1_555 D CYS 58 SG ? ? E CYS 60 E CYS 84 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf17 disulf ? ? D CYS 68 SG ? ? ? 1_555 D CYS 91 SG ? ? E CYS 94 E CYS 117 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf18 disulf ? ? D CYS 73 SG ? ? ? 1_555 D CYS 90 SG ? ? E CYS 99 E CYS 116 1_555 ? ? ? ? ? ? ? 2.020 ? ? disulf19 disulf ? ? D CYS 92 SG ? ? ? 1_555 D CYS 97 SG ? ? E CYS 118 E CYS 123 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf20 disulf ? ? E CYS 8 SG ? ? ? 1_555 E CYS 40 SG ? ? F CYS 34 F CYS 66 1_555 ? ? ? ? ? ? ? 2.027 ? ? disulf21 disulf ? ? E CYS 34 SG ? ? ? 1_555 E CYS 58 SG ? ? F CYS 60 F CYS 84 1_555 ? ? ? ? ? ? ? 2.023 ? ? disulf22 disulf ? ? E CYS 68 SG ? ? ? 1_555 E CYS 91 SG ? ? F CYS 94 F CYS 117 1_555 ? ? ? ? ? ? ? 2.033 ? ? disulf23 disulf ? ? E CYS 73 SG ? ? ? 1_555 E CYS 90 SG ? ? F CYS 99 F CYS 116 1_555 ? ? ? ? ? ? ? 2.026 ? ? disulf24 disulf ? ? E CYS 92 SG ? ? ? 1_555 E CYS 97 SG ? ? F CYS 118 F CYS 123 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf25 disulf ? ? F CYS 8 SG ? ? ? 1_555 F CYS 40 SG ? ? G CYS 34 G CYS 66 1_555 ? ? ? ? ? ? ? 2.027 ? ? disulf26 disulf ? ? F CYS 34 SG ? ? ? 1_555 F CYS 58 SG ? ? G CYS 60 G CYS 84 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf27 disulf ? ? F CYS 68 SG ? ? ? 1_555 F CYS 91 SG ? ? G CYS 94 G CYS 117 1_555 ? ? ? ? ? ? ? 2.033 ? ? disulf28 disulf ? ? F CYS 92 SG ? ? ? 1_555 F CYS 97 SG ? ? G CYS 118 G CYS 123 1_555 ? ? ? ? ? ? ? 2.028 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ALA 31 A . ? ALA 323 A PRO 32 A ? PRO 324 A 1 -4.12 2 ALA 31 B . ? ALA 323 B PRO 32 B ? PRO 324 B 1 -4.37 3 ALA 31 C . ? ALA 323 C PRO 32 C ? PRO 324 C 1 -2.94 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 2 ? AA3 ? 3 ? AA4 ? 3 ? AA5 ? 2 ? AA6 ? 3 ? AA7 ? 2 ? AA8 ? 2 ? AA9 ? 3 ? AB1 ? 3 ? AB2 ? 2 ? AB3 ? 3 ? AB4 ? 2 ? AB5 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA4 1 2 ? parallel AA4 2 3 ? anti-parallel AA5 1 2 ? anti-parallel AA6 1 2 ? anti-parallel AA6 2 3 ? anti-parallel AA7 1 2 ? anti-parallel AA8 1 2 ? anti-parallel AA9 1 2 ? anti-parallel AA9 2 3 ? anti-parallel AB1 1 2 ? anti-parallel AB1 2 3 ? anti-parallel AB2 1 2 ? anti-parallel AB3 1 2 ? anti-parallel AB3 2 3 ? anti-parallel AB4 1 2 ? anti-parallel AB5 1 2 ? anti-parallel AB5 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 2 ? GLU A 3 ? LEU A 294 GLU A 295 AA1 2 CYS A 12 ? GLN A 14 ? CYS A 304 GLN A 306 AA1 3 TYR A 39 ? GLU A 41 ? TYR A 331 GLU A 333 AA2 1 PHE A 17 ? ASP A 19 ? PHE A 309 ASP A 311 AA2 2 GLY A 34 ? TYR A 36 ? GLY A 326 TYR A 328 AA3 1 ILE A 29 ? ALA A 31 ? ILE A 321 ALA A 323 AA3 2 CYS A 80 ? PHE A 93 ? CYS A 372 PHE A 385 AA3 3 ILE A 99 ? CYS A 114 ? ILE A 391 CYS A 406 AA4 1 LEU B 2 ? GLU B 3 ? LEU B 294 GLU B 295 AA4 2 CYS B 12 ? GLN B 14 ? CYS B 304 GLN B 306 AA4 3 TYR B 39 ? GLU B 41 ? TYR B 331 GLU B 333 AA5 1 PHE B 17 ? ASP B 19 ? PHE B 309 ASP B 311 AA5 2 GLY B 34 ? TYR B 36 ? GLY B 326 TYR B 328 AA6 1 ILE B 29 ? ALA B 31 ? ILE B 321 ALA B 323 AA6 2 CYS B 80 ? PHE B 93 ? CYS B 372 PHE B 385 AA6 3 ILE B 99 ? CYS B 114 ? ILE B 391 CYS B 406 AA7 1 CYS C 12 ? GLN C 14 ? CYS C 304 GLN C 306 AA7 2 TYR C 39 ? GLU C 41 ? TYR C 331 GLU C 333 AA8 1 PHE C 17 ? ASP C 19 ? PHE C 309 ASP C 311 AA8 2 GLY C 34 ? TYR C 36 ? GLY C 326 TYR C 328 AA9 1 ILE C 29 ? ALA C 31 ? ILE C 321 ALA C 323 AA9 2 CYS C 80 ? PHE C 93 ? CYS C 372 PHE C 385 AA9 3 ILE C 99 ? CYS C 114 ? ILE C 391 CYS C 406 AB1 1 LEU D 53 ? TRP D 59 ? LEU E 79 TRP E 85 AB1 2 THR D 39 ? TRP D 44 ? THR E 65 TRP E 70 AB1 3 ARG D 88 ? CYS D 92 ? ARG E 114 CYS E 118 AB2 1 LEU E 7 ? ALA E 9 ? LEU F 33 ALA F 35 AB2 2 THR E 31 ? LEU E 33 ? THR F 57 LEU F 59 AB3 1 ASP E 50 ? TRP E 59 ? ASP F 76 TRP F 85 AB3 2 THR E 39 ? SER E 47 ? THR F 65 SER F 73 AB3 3 TYR E 87 ? CYS E 92 ? TYR F 113 CYS F 118 AB4 1 LEU F 7 ? ALA F 9 ? LEU G 33 ALA G 35 AB4 2 THR F 31 ? LEU F 33 ? THR G 57 LEU G 59 AB5 1 GLN F 56 ? TRP F 59 ? GLN G 82 TRP G 85 AB5 2 THR F 39 ? GLY F 42 ? THR G 65 GLY G 68 AB5 3 CYS F 90 ? CYS F 92 ? CYS G 116 CYS G 118 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 2 ? N LEU A 294 O ARG A 13 ? O ARG A 305 AA1 2 3 N CYS A 12 ? N CYS A 304 O GLU A 41 ? O GLU A 333 AA2 1 2 N ILE A 18 ? N ILE A 310 O TYR A 35 ? O TYR A 327 AA3 1 2 N ALA A 31 ? N ALA A 323 O LEU A 91 ? O LEU A 383 AA3 2 3 N MET A 88 ? N MET A 380 O VAL A 104 ? O VAL A 396 AA4 1 2 N LEU B 2 ? N LEU B 294 O ARG B 13 ? O ARG B 305 AA4 2 3 N CYS B 12 ? N CYS B 304 O GLU B 41 ? O GLU B 333 AA5 1 2 N ILE B 18 ? N ILE B 310 O TYR B 35 ? O TYR B 327 AA6 1 2 N ALA B 31 ? N ALA B 323 O LEU B 91 ? O LEU B 383 AA6 2 3 N ILE B 81 ? N ILE B 373 O GLY B 113 ? O GLY B 405 AA7 1 2 N GLN C 14 ? N GLN C 306 O TYR C 39 ? O TYR C 331 AA8 1 2 N ILE C 18 ? N ILE C 310 O TYR C 35 ? O TYR C 327 AA9 1 2 N ALA C 31 ? N ALA C 323 O LEU C 91 ? O LEU C 383 AA9 2 3 N MET C 88 ? N MET C 380 O VAL C 104 ? O VAL C 396 AB1 1 2 O LYS D 55 ? O LYS E 81 N LEU D 43 ? N LEU E 69 AB1 2 3 N CYS D 40 ? N CYS E 66 O CYS D 92 ? O CYS E 118 AB2 1 2 N CYS E 8 ? N CYS F 34 O ILE E 32 ? O ILE F 58 AB3 1 2 O TRP E 59 ? O TRP F 85 N THR E 39 ? N THR F 65 AB3 2 3 N CYS E 40 ? N CYS F 66 O CYS E 92 ? O CYS F 118 AB4 1 2 N CYS F 8 ? N CYS G 34 O ILE F 32 ? O ILE G 58 AB5 1 2 O TRP F 59 ? O TRP G 85 N THR F 39 ? N THR G 65 AB5 2 3 N GLY F 42 ? N GLY G 68 O CYS F 90 ? O CYS G 116 # _atom_sites.entry_id 7U5O _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.012352 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002383 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008661 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009245 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 293 293 GLY GLY A . n A 1 2 LEU 2 294 294 LEU LEU A . n A 1 3 GLU 3 295 295 GLU GLU A . n A 1 4 CYS 4 296 296 CYS CYS A . n A 1 5 ASP 5 297 297 ASP ASP A . n A 1 6 GLY 6 298 298 GLY GLY A . n A 1 7 ARG 7 299 299 ARG ARG A . n A 1 8 THR 8 300 300 THR THR A . n A 1 9 ASN 9 301 301 ASN ASN A . n A 1 10 LEU 10 302 302 LEU LEU A . n A 1 11 CYS 11 303 303 CYS CYS A . n A 1 12 CYS 12 304 304 CYS CYS A . n A 1 13 ARG 13 305 305 ARG ARG A . n A 1 14 GLN 14 306 306 GLN GLN A . n A 1 15 GLN 15 307 307 GLN GLN A . n A 1 16 PHE 16 308 308 PHE PHE A . n A 1 17 PHE 17 309 309 PHE PHE A . n A 1 18 ILE 18 310 310 ILE ILE A . n A 1 19 ASP 19 311 311 ASP ASP A . n A 1 20 PHE 20 312 312 PHE PHE A . n A 1 21 ARG 21 313 313 ARG ARG A . n A 1 22 LEU 22 314 314 LEU LEU A . n A 1 23 ILE 23 315 315 ILE ILE A . n A 1 24 GLY 24 316 316 GLY GLY A . n A 1 25 TRP 25 317 317 TRP TRP A . n A 1 26 ASN 26 318 318 ASN ASN A . n A 1 27 ASP 27 319 319 ASP ASP A . n A 1 28 TRP 28 320 320 TRP TRP A . n A 1 29 ILE 29 321 321 ILE ILE A . n A 1 30 ILE 30 322 322 ILE ILE A . n A 1 31 ALA 31 323 323 ALA ALA A . n A 1 32 PRO 32 324 324 PRO PRO A . n A 1 33 THR 33 325 325 THR THR A . n A 1 34 GLY 34 326 326 GLY GLY A . n A 1 35 TYR 35 327 327 TYR TYR A . n A 1 36 TYR 36 328 328 TYR TYR A . n A 1 37 GLY 37 329 329 GLY GLY A . n A 1 38 ASN 38 330 330 ASN ASN A . n A 1 39 TYR 39 331 331 TYR TYR A . n A 1 40 CYS 40 332 332 CYS CYS A . n A 1 41 GLU 41 333 333 GLU GLU A . n A 1 42 GLY 42 334 334 GLY GLY A . n A 1 43 SER 43 335 335 SER SER A . n A 1 44 CYS 44 336 336 CYS CYS A . n A 1 45 PRO 45 337 337 PRO PRO A . n A 1 46 ALA 46 338 338 ALA ALA A . n A 1 47 TYR 47 339 339 TYR TYR A . n A 1 48 LEU 48 340 ? ? ? A . n A 1 49 ALA 49 341 ? ? ? A . n A 1 50 GLY 50 342 ? ? ? A . n A 1 51 VAL 51 343 ? ? ? A . n A 1 52 PRO 52 344 344 PRO PRO A . n A 1 53 GLY 53 345 345 GLY GLY A . n A 1 54 SER 54 346 346 SER SER A . n A 1 55 ALA 55 347 347 ALA ALA A . n A 1 56 SER 56 348 348 SER SER A . n A 1 57 SER 57 349 349 SER SER A . n A 1 58 PHE 58 350 350 PHE PHE A . n A 1 59 HIS 59 351 351 HIS HIS A . n A 1 60 THR 60 352 352 THR THR A . n A 1 61 ALA 61 353 353 ALA ALA A . n A 1 62 VAL 62 354 354 VAL VAL A . n A 1 63 VAL 63 355 355 VAL VAL A . n A 1 64 ASN 64 356 356 ASN ASN A . n A 1 65 GLN 65 357 357 GLN GLN A . n A 1 66 TYR 66 358 358 TYR TYR A . n A 1 67 ARG 67 359 359 ARG ARG A . n A 1 68 MET 68 360 360 MET MET A . n A 1 69 ARG 69 361 361 ARG ARG A . n A 1 70 GLY 70 362 362 GLY GLY A . n A 1 71 LEU 71 363 363 LEU LEU A . n A 1 72 ASN 72 364 364 ASN ASN A . n A 1 73 PRO 73 365 365 PRO PRO A . n A 1 74 GLY 74 366 366 GLY GLY A . n A 1 75 THR 75 367 367 THR THR A . n A 1 76 VAL 76 368 368 VAL VAL A . n A 1 77 ASN 77 369 369 ASN ASN A . n A 1 78 SER 78 370 370 SER SER A . n A 1 79 CYS 79 371 371 CYS CYS A . n A 1 80 CYS 80 372 372 CYS CYS A . n A 1 81 ILE 81 373 373 ILE ILE A . n A 1 82 PRO 82 374 374 PRO PRO A . n A 1 83 THR 83 375 375 THR THR A . n A 1 84 LYS 84 376 376 LYS LYS A . n A 1 85 LEU 85 377 377 LEU LEU A . n A 1 86 SER 86 378 378 SER SER A . n A 1 87 THR 87 379 379 THR THR A . n A 1 88 MET 88 380 380 MET MET A . n A 1 89 SER 89 381 381 SER SER A . n A 1 90 MET 90 382 382 MET MET A . n A 1 91 LEU 91 383 383 LEU LEU A . n A 1 92 TYR 92 384 384 TYR TYR A . n A 1 93 PHE 93 385 385 PHE PHE A . n A 1 94 ASP 94 386 386 ASP ASP A . n A 1 95 ASP 95 387 387 ASP ASP A . n A 1 96 GLU 96 388 388 GLU GLU A . n A 1 97 TYR 97 389 389 TYR TYR A . n A 1 98 ASN 98 390 390 ASN ASN A . n A 1 99 ILE 99 391 391 ILE ILE A . n A 1 100 VAL 100 392 392 VAL VAL A . n A 1 101 LYS 101 393 393 LYS LYS A . n A 1 102 ARG 102 394 394 ARG ARG A . n A 1 103 ASP 103 395 395 ASP ASP A . n A 1 104 VAL 104 396 396 VAL VAL A . n A 1 105 PRO 105 397 397 PRO PRO A . n A 1 106 ASN 106 398 398 ASN ASN A . n A 1 107 MET 107 399 399 MET MET A . n A 1 108 ILE 108 400 400 ILE ILE A . n A 1 109 VAL 109 401 401 VAL VAL A . n A 1 110 GLU 110 402 402 GLU GLU A . n A 1 111 GLU 111 403 403 GLU GLU A . n A 1 112 CYS 112 404 404 CYS CYS A . n A 1 113 GLY 113 405 405 GLY GLY A . n A 1 114 CYS 114 406 406 CYS CYS A . n A 1 115 ALA 115 407 407 ALA ALA A . n B 1 1 GLY 1 293 293 GLY GLY B . n B 1 2 LEU 2 294 294 LEU LEU B . n B 1 3 GLU 3 295 295 GLU GLU B . n B 1 4 CYS 4 296 296 CYS CYS B . n B 1 5 ASP 5 297 297 ASP ASP B . n B 1 6 GLY 6 298 298 GLY GLY B . n B 1 7 ARG 7 299 299 ARG ARG B . n B 1 8 THR 8 300 300 THR THR B . n B 1 9 ASN 9 301 301 ASN ASN B . n B 1 10 LEU 10 302 302 LEU LEU B . n B 1 11 CYS 11 303 303 CYS CYS B . n B 1 12 CYS 12 304 304 CYS CYS B . n B 1 13 ARG 13 305 305 ARG ARG B . n B 1 14 GLN 14 306 306 GLN GLN B . n B 1 15 GLN 15 307 307 GLN GLN B . n B 1 16 PHE 16 308 308 PHE PHE B . n B 1 17 PHE 17 309 309 PHE PHE B . n B 1 18 ILE 18 310 310 ILE ILE B . n B 1 19 ASP 19 311 311 ASP ASP B . n B 1 20 PHE 20 312 312 PHE PHE B . n B 1 21 ARG 21 313 313 ARG ARG B . n B 1 22 LEU 22 314 314 LEU LEU B . n B 1 23 ILE 23 315 315 ILE ILE B . n B 1 24 GLY 24 316 316 GLY GLY B . n B 1 25 TRP 25 317 317 TRP TRP B . n B 1 26 ASN 26 318 318 ASN ASN B . n B 1 27 ASP 27 319 319 ASP ASP B . n B 1 28 TRP 28 320 320 TRP TRP B . n B 1 29 ILE 29 321 321 ILE ILE B . n B 1 30 ILE 30 322 322 ILE ILE B . n B 1 31 ALA 31 323 323 ALA ALA B . n B 1 32 PRO 32 324 324 PRO PRO B . n B 1 33 THR 33 325 325 THR THR B . n B 1 34 GLY 34 326 326 GLY GLY B . n B 1 35 TYR 35 327 327 TYR TYR B . n B 1 36 TYR 36 328 328 TYR TYR B . n B 1 37 GLY 37 329 329 GLY GLY B . n B 1 38 ASN 38 330 330 ASN ASN B . n B 1 39 TYR 39 331 331 TYR TYR B . n B 1 40 CYS 40 332 332 CYS CYS B . n B 1 41 GLU 41 333 333 GLU GLU B . n B 1 42 GLY 42 334 334 GLY GLY B . n B 1 43 SER 43 335 335 SER SER B . n B 1 44 CYS 44 336 336 CYS CYS B . n B 1 45 PRO 45 337 337 PRO PRO B . n B 1 46 ALA 46 338 338 ALA ALA B . n B 1 47 TYR 47 339 339 TYR TYR B . n B 1 48 LEU 48 340 ? ? ? B . n B 1 49 ALA 49 341 ? ? ? B . n B 1 50 GLY 50 342 ? ? ? B . n B 1 51 VAL 51 343 ? ? ? B . n B 1 52 PRO 52 344 ? ? ? B . n B 1 53 GLY 53 345 ? ? ? B . n B 1 54 SER 54 346 346 SER SER B . n B 1 55 ALA 55 347 347 ALA ALA B . n B 1 56 SER 56 348 348 SER SER B . n B 1 57 SER 57 349 349 SER SER B . n B 1 58 PHE 58 350 350 PHE PHE B . n B 1 59 HIS 59 351 351 HIS HIS B . n B 1 60 THR 60 352 352 THR THR B . n B 1 61 ALA 61 353 353 ALA ALA B . n B 1 62 VAL 62 354 354 VAL VAL B . n B 1 63 VAL 63 355 355 VAL VAL B . n B 1 64 ASN 64 356 356 ASN ASN B . n B 1 65 GLN 65 357 357 GLN GLN B . n B 1 66 TYR 66 358 358 TYR TYR B . n B 1 67 ARG 67 359 359 ARG ARG B . n B 1 68 MET 68 360 360 MET MET B . n B 1 69 ARG 69 361 361 ARG ARG B . n B 1 70 GLY 70 362 362 GLY GLY B . n B 1 71 LEU 71 363 363 LEU LEU B . n B 1 72 ASN 72 364 364 ASN ASN B . n B 1 73 PRO 73 365 365 PRO PRO B . n B 1 74 GLY 74 366 366 GLY GLY B . n B 1 75 THR 75 367 367 THR THR B . n B 1 76 VAL 76 368 368 VAL VAL B . n B 1 77 ASN 77 369 369 ASN ASN B . n B 1 78 SER 78 370 370 SER SER B . n B 1 79 CYS 79 371 371 CYS CYS B . n B 1 80 CYS 80 372 372 CYS CYS B . n B 1 81 ILE 81 373 373 ILE ILE B . n B 1 82 PRO 82 374 374 PRO PRO B . n B 1 83 THR 83 375 375 THR THR B . n B 1 84 LYS 84 376 376 LYS LYS B . n B 1 85 LEU 85 377 377 LEU LEU B . n B 1 86 SER 86 378 378 SER SER B . n B 1 87 THR 87 379 379 THR THR B . n B 1 88 MET 88 380 380 MET MET B . n B 1 89 SER 89 381 381 SER SER B . n B 1 90 MET 90 382 382 MET MET B . n B 1 91 LEU 91 383 383 LEU LEU B . n B 1 92 TYR 92 384 384 TYR TYR B . n B 1 93 PHE 93 385 385 PHE PHE B . n B 1 94 ASP 94 386 386 ASP ASP B . n B 1 95 ASP 95 387 387 ASP ASP B . n B 1 96 GLU 96 388 388 GLU GLU B . n B 1 97 TYR 97 389 389 TYR TYR B . n B 1 98 ASN 98 390 390 ASN ASN B . n B 1 99 ILE 99 391 391 ILE ILE B . n B 1 100 VAL 100 392 392 VAL VAL B . n B 1 101 LYS 101 393 393 LYS LYS B . n B 1 102 ARG 102 394 394 ARG ARG B . n B 1 103 ASP 103 395 395 ASP ASP B . n B 1 104 VAL 104 396 396 VAL VAL B . n B 1 105 PRO 105 397 397 PRO PRO B . n B 1 106 ASN 106 398 398 ASN ASN B . n B 1 107 MET 107 399 399 MET MET B . n B 1 108 ILE 108 400 400 ILE ILE B . n B 1 109 VAL 109 401 401 VAL VAL B . n B 1 110 GLU 110 402 402 GLU GLU B . n B 1 111 GLU 111 403 403 GLU GLU B . n B 1 112 CYS 112 404 404 CYS CYS B . n B 1 113 GLY 113 405 405 GLY GLY B . n B 1 114 CYS 114 406 406 CYS CYS B . n B 1 115 ALA 115 407 407 ALA ALA B . n C 1 1 GLY 1 293 293 GLY GLY C . n C 1 2 LEU 2 294 294 LEU LEU C . n C 1 3 GLU 3 295 295 GLU GLU C . n C 1 4 CYS 4 296 296 CYS CYS C . n C 1 5 ASP 5 297 297 ASP ASP C . n C 1 6 GLY 6 298 298 GLY GLY C . n C 1 7 ARG 7 299 299 ARG ARG C . n C 1 8 THR 8 300 300 THR THR C . n C 1 9 ASN 9 301 301 ASN ASN C . n C 1 10 LEU 10 302 302 LEU LEU C . n C 1 11 CYS 11 303 303 CYS CYS C . n C 1 12 CYS 12 304 304 CYS CYS C . n C 1 13 ARG 13 305 305 ARG ARG C . n C 1 14 GLN 14 306 306 GLN GLN C . n C 1 15 GLN 15 307 307 GLN GLN C . n C 1 16 PHE 16 308 308 PHE PHE C . n C 1 17 PHE 17 309 309 PHE PHE C . n C 1 18 ILE 18 310 310 ILE ILE C . n C 1 19 ASP 19 311 311 ASP ASP C . n C 1 20 PHE 20 312 312 PHE PHE C . n C 1 21 ARG 21 313 313 ARG ARG C . n C 1 22 LEU 22 314 314 LEU LEU C . n C 1 23 ILE 23 315 315 ILE ILE C . n C 1 24 GLY 24 316 316 GLY GLY C . n C 1 25 TRP 25 317 317 TRP TRP C . n C 1 26 ASN 26 318 318 ASN ASN C . n C 1 27 ASP 27 319 319 ASP ASP C . n C 1 28 TRP 28 320 320 TRP TRP C . n C 1 29 ILE 29 321 321 ILE ILE C . n C 1 30 ILE 30 322 322 ILE ILE C . n C 1 31 ALA 31 323 323 ALA ALA C . n C 1 32 PRO 32 324 324 PRO PRO C . n C 1 33 THR 33 325 325 THR THR C . n C 1 34 GLY 34 326 326 GLY GLY C . n C 1 35 TYR 35 327 327 TYR TYR C . n C 1 36 TYR 36 328 328 TYR TYR C . n C 1 37 GLY 37 329 329 GLY GLY C . n C 1 38 ASN 38 330 330 ASN ASN C . n C 1 39 TYR 39 331 331 TYR TYR C . n C 1 40 CYS 40 332 332 CYS CYS C . n C 1 41 GLU 41 333 333 GLU GLU C . n C 1 42 GLY 42 334 334 GLY GLY C . n C 1 43 SER 43 335 335 SER SER C . n C 1 44 CYS 44 336 336 CYS CYS C . n C 1 45 PRO 45 337 337 PRO PRO C . n C 1 46 ALA 46 338 338 ALA ALA C . n C 1 47 TYR 47 339 339 TYR TYR C . n C 1 48 LEU 48 340 340 LEU LEU C . n C 1 49 ALA 49 341 341 ALA ALA C . n C 1 50 GLY 50 342 342 GLY GLY C . n C 1 51 VAL 51 343 343 VAL VAL C . n C 1 52 PRO 52 344 344 PRO PRO C . n C 1 53 GLY 53 345 345 GLY GLY C . n C 1 54 SER 54 346 346 SER SER C . n C 1 55 ALA 55 347 347 ALA ALA C . n C 1 56 SER 56 348 348 SER SER C . n C 1 57 SER 57 349 349 SER SER C . n C 1 58 PHE 58 350 350 PHE PHE C . n C 1 59 HIS 59 351 351 HIS HIS C . n C 1 60 THR 60 352 352 THR THR C . n C 1 61 ALA 61 353 353 ALA ALA C . n C 1 62 VAL 62 354 354 VAL VAL C . n C 1 63 VAL 63 355 355 VAL VAL C . n C 1 64 ASN 64 356 356 ASN ASN C . n C 1 65 GLN 65 357 357 GLN GLN C . n C 1 66 TYR 66 358 358 TYR TYR C . n C 1 67 ARG 67 359 359 ARG ARG C . n C 1 68 MET 68 360 360 MET MET C . n C 1 69 ARG 69 361 361 ARG ARG C . n C 1 70 GLY 70 362 362 GLY GLY C . n C 1 71 LEU 71 363 363 LEU LEU C . n C 1 72 ASN 72 364 364 ASN ASN C . n C 1 73 PRO 73 365 365 PRO PRO C . n C 1 74 GLY 74 366 366 GLY GLY C . n C 1 75 THR 75 367 367 THR THR C . n C 1 76 VAL 76 368 368 VAL VAL C . n C 1 77 ASN 77 369 369 ASN ASN C . n C 1 78 SER 78 370 370 SER SER C . n C 1 79 CYS 79 371 371 CYS CYS C . n C 1 80 CYS 80 372 372 CYS CYS C . n C 1 81 ILE 81 373 373 ILE ILE C . n C 1 82 PRO 82 374 374 PRO PRO C . n C 1 83 THR 83 375 375 THR THR C . n C 1 84 LYS 84 376 376 LYS LYS C . n C 1 85 LEU 85 377 377 LEU LEU C . n C 1 86 SER 86 378 378 SER SER C . n C 1 87 THR 87 379 379 THR THR C . n C 1 88 MET 88 380 380 MET MET C . n C 1 89 SER 89 381 381 SER SER C . n C 1 90 MET 90 382 382 MET MET C . n C 1 91 LEU 91 383 383 LEU LEU C . n C 1 92 TYR 92 384 384 TYR TYR C . n C 1 93 PHE 93 385 385 PHE PHE C . n C 1 94 ASP 94 386 386 ASP ASP C . n C 1 95 ASP 95 387 387 ASP ASP C . n C 1 96 GLU 96 388 388 GLU GLU C . n C 1 97 TYR 97 389 389 TYR TYR C . n C 1 98 ASN 98 390 390 ASN ASN C . n C 1 99 ILE 99 391 391 ILE ILE C . n C 1 100 VAL 100 392 392 VAL VAL C . n C 1 101 LYS 101 393 393 LYS LYS C . n C 1 102 ARG 102 394 394 ARG ARG C . n C 1 103 ASP 103 395 395 ASP ASP C . n C 1 104 VAL 104 396 396 VAL VAL C . n C 1 105 PRO 105 397 397 PRO PRO C . n C 1 106 ASN 106 398 398 ASN ASN C . n C 1 107 MET 107 399 399 MET MET C . n C 1 108 ILE 108 400 400 ILE ILE C . n C 1 109 VAL 109 401 401 VAL VAL C . n C 1 110 GLU 110 402 402 GLU GLU C . n C 1 111 GLU 111 403 403 GLU GLU C . n C 1 112 CYS 112 404 404 CYS CYS C . n C 1 113 GLY 113 405 405 GLY GLY C . n C 1 114 CYS 114 406 406 CYS CYS C . n C 1 115 ALA 115 407 407 ALA ALA C . n D 2 1 SER 1 27 ? ? ? E . n D 2 2 GLN 2 28 ? ? ? E . n D 2 3 ASN 3 29 ? ? ? E . n D 2 4 GLN 4 30 ? ? ? E . n D 2 5 GLU 5 31 31 GLU GLU E . n D 2 6 ARG 6 32 32 ARG ARG E . n D 2 7 LEU 7 33 33 LEU LEU E . n D 2 8 CYS 8 34 34 CYS CYS E . n D 2 9 ALA 9 35 35 ALA ALA E . n D 2 10 PHE 10 36 36 PHE PHE E . n D 2 11 LYS 11 37 37 LYS LYS E . n D 2 12 ASP 12 38 38 ASP ASP E . n D 2 13 PRO 13 39 39 PRO PRO E . n D 2 14 TYR 14 40 40 TYR TYR E . n D 2 15 GLN 15 41 41 GLN GLN E . n D 2 16 GLN 16 42 ? ? ? E . n D 2 17 ASP 17 43 ? ? ? E . n D 2 18 LEU 18 44 ? ? ? E . n D 2 19 GLY 19 45 ? ? ? E . n D 2 20 ILE 20 46 ? ? ? E . n D 2 21 GLY 21 47 ? ? ? E . n D 2 22 GLU 22 48 ? ? ? E . n D 2 23 SER 23 49 ? ? ? E . n D 2 24 ARG 24 50 ? ? ? E . n D 2 25 ILE 25 51 ? ? ? E . n D 2 26 SER 26 52 ? ? ? E . n D 2 27 HIS 27 53 53 HIS HIS E . n D 2 28 GLU 28 54 54 GLU GLU E . n D 2 29 ASN 29 55 55 ASN ASN E . n D 2 30 GLY 30 56 56 GLY GLY E . n D 2 31 THR 31 57 57 THR THR E . n D 2 32 ILE 32 58 58 ILE ILE E . n D 2 33 LEU 33 59 59 LEU LEU E . n D 2 34 CYS 34 60 60 CYS CYS E . n D 2 35 SER 35 61 61 SER SER E . n D 2 36 LYS 36 62 62 LYS LYS E . n D 2 37 GLY 37 63 63 GLY GLY E . n D 2 38 SER 38 64 64 SER SER E . n D 2 39 THR 39 65 65 THR THR E . n D 2 40 CYS 40 66 66 CYS CYS E . n D 2 41 TYR 41 67 67 TYR TYR E . n D 2 42 GLY 42 68 68 GLY GLY E . n D 2 43 LEU 43 69 69 LEU LEU E . n D 2 44 TRP 44 70 70 TRP TRP E . n D 2 45 GLU 45 71 71 GLU GLU E . n D 2 46 LYS 46 72 ? ? ? E . n D 2 47 SER 47 73 ? ? ? E . n D 2 48 LYS 48 74 ? ? ? E . n D 2 49 GLY 49 75 75 GLY GLY E . n D 2 50 ASP 50 76 76 ASP ASP E . n D 2 51 ILE 51 77 77 ILE ILE E . n D 2 52 ASN 52 78 78 ASN ASN E . n D 2 53 LEU 53 79 79 LEU LEU E . n D 2 54 VAL 54 80 80 VAL VAL E . n D 2 55 LYS 55 81 81 LYS LYS E . n D 2 56 GLN 56 82 82 GLN GLN E . n D 2 57 GLY 57 83 83 GLY GLY E . n D 2 58 CYS 58 84 84 CYS CYS E . n D 2 59 TRP 59 85 85 TRP TRP E . n D 2 60 SER 60 86 86 SER SER E . n D 2 61 HIS 61 87 87 HIS HIS E . n D 2 62 ILE 62 88 88 ILE ILE E . n D 2 63 GLY 63 89 89 GLY GLY E . n D 2 64 ASP 64 90 90 ASP ASP E . n D 2 65 PRO 65 91 91 PRO PRO E . n D 2 66 GLN 66 92 92 GLN GLN E . n D 2 67 GLU 67 93 93 GLU GLU E . n D 2 68 CYS 68 94 94 CYS CYS E . n D 2 69 HIS 69 95 95 HIS HIS E . n D 2 70 TYR 70 96 96 TYR TYR E . n D 2 71 GLU 71 97 97 GLU GLU E . n D 2 72 GLU 72 98 98 GLU GLU E . n D 2 73 CYS 73 99 99 CYS CYS E . n D 2 74 VAL 74 100 100 VAL VAL E . n D 2 75 VAL 75 101 101 VAL VAL E . n D 2 76 THR 76 102 102 THR THR E . n D 2 77 THR 77 103 ? ? ? E . n D 2 78 THR 78 104 ? ? ? E . n D 2 79 PRO 79 105 ? ? ? E . n D 2 80 PRO 80 106 ? ? ? E . n D 2 81 SER 81 107 ? ? ? E . n D 2 82 ILE 82 108 108 ILE ILE E . n D 2 83 GLN 83 109 109 GLN GLN E . n D 2 84 ASN 84 110 110 ASN ASN E . n D 2 85 GLY 85 111 111 GLY GLY E . n D 2 86 THR 86 112 112 THR THR E . n D 2 87 TYR 87 113 113 TYR TYR E . n D 2 88 ARG 88 114 114 ARG ARG E . n D 2 89 PHE 89 115 115 PHE PHE E . n D 2 90 CYS 90 116 116 CYS CYS E . n D 2 91 CYS 91 117 117 CYS CYS E . n D 2 92 CYS 92 118 118 CYS CYS E . n D 2 93 SER 93 119 119 SER SER E . n D 2 94 THR 94 120 120 THR THR E . n D 2 95 ASP 95 121 121 ASP ASP E . n D 2 96 LEU 96 122 122 LEU LEU E . n D 2 97 CYS 97 123 123 CYS CYS E . n D 2 98 ASN 98 124 124 ASN ASN E . n D 2 99 VAL 99 125 125 VAL VAL E . n D 2 100 ASN 100 126 126 ASN ASN E . n D 2 101 PHE 101 127 127 PHE PHE E . n D 2 102 THR 102 128 128 THR THR E . n D 2 103 GLU 103 129 129 GLU GLU E . n D 2 104 ASN 104 130 130 ASN ASN E . n D 2 105 PHE 105 131 131 PHE PHE E . n D 2 106 PRO 106 132 132 PRO PRO E . n D 2 107 PRO 107 133 133 PRO PRO E . n D 2 108 PRO 108 134 ? ? ? E . n D 2 109 ASP 109 135 ? ? ? E . n D 2 110 THR 110 136 ? ? ? E . n D 2 111 THR 111 137 ? ? ? E . n E 2 1 SER 1 27 ? ? ? F . n E 2 2 GLN 2 28 ? ? ? F . n E 2 3 ASN 3 29 ? ? ? F . n E 2 4 GLN 4 30 ? ? ? F . n E 2 5 GLU 5 31 ? ? ? F . n E 2 6 ARG 6 32 32 ARG ARG F . n E 2 7 LEU 7 33 33 LEU LEU F . n E 2 8 CYS 8 34 34 CYS CYS F . n E 2 9 ALA 9 35 35 ALA ALA F . n E 2 10 PHE 10 36 36 PHE PHE F . n E 2 11 LYS 11 37 37 LYS LYS F . n E 2 12 ASP 12 38 38 ASP ASP F . n E 2 13 PRO 13 39 39 PRO PRO F . n E 2 14 TYR 14 40 40 TYR TYR F . n E 2 15 GLN 15 41 41 GLN GLN F . n E 2 16 GLN 16 42 ? ? ? F . n E 2 17 ASP 17 43 ? ? ? F . n E 2 18 LEU 18 44 ? ? ? F . n E 2 19 GLY 19 45 ? ? ? F . n E 2 20 ILE 20 46 ? ? ? F . n E 2 21 GLY 21 47 ? ? ? F . n E 2 22 GLU 22 48 ? ? ? F . n E 2 23 SER 23 49 ? ? ? F . n E 2 24 ARG 24 50 50 ARG ARG F . n E 2 25 ILE 25 51 51 ILE ILE F . n E 2 26 SER 26 52 52 SER SER F . n E 2 27 HIS 27 53 53 HIS HIS F . n E 2 28 GLU 28 54 54 GLU GLU F . n E 2 29 ASN 29 55 55 ASN ASN F . n E 2 30 GLY 30 56 56 GLY GLY F . n E 2 31 THR 31 57 57 THR THR F . n E 2 32 ILE 32 58 58 ILE ILE F . n E 2 33 LEU 33 59 59 LEU LEU F . n E 2 34 CYS 34 60 60 CYS CYS F . n E 2 35 SER 35 61 61 SER SER F . n E 2 36 LYS 36 62 62 LYS LYS F . n E 2 37 GLY 37 63 63 GLY GLY F . n E 2 38 SER 38 64 64 SER SER F . n E 2 39 THR 39 65 65 THR THR F . n E 2 40 CYS 40 66 66 CYS CYS F . n E 2 41 TYR 41 67 67 TYR TYR F . n E 2 42 GLY 42 68 68 GLY GLY F . n E 2 43 LEU 43 69 69 LEU LEU F . n E 2 44 TRP 44 70 70 TRP TRP F . n E 2 45 GLU 45 71 71 GLU GLU F . n E 2 46 LYS 46 72 72 LYS LYS F . n E 2 47 SER 47 73 73 SER SER F . n E 2 48 LYS 48 74 74 LYS LYS F . n E 2 49 GLY 49 75 75 GLY GLY F . n E 2 50 ASP 50 76 76 ASP ASP F . n E 2 51 ILE 51 77 77 ILE ILE F . n E 2 52 ASN 52 78 78 ASN ASN F . n E 2 53 LEU 53 79 79 LEU LEU F . n E 2 54 VAL 54 80 80 VAL VAL F . n E 2 55 LYS 55 81 81 LYS LYS F . n E 2 56 GLN 56 82 82 GLN GLN F . n E 2 57 GLY 57 83 83 GLY GLY F . n E 2 58 CYS 58 84 84 CYS CYS F . n E 2 59 TRP 59 85 85 TRP TRP F . n E 2 60 SER 60 86 86 SER SER F . n E 2 61 HIS 61 87 87 HIS HIS F . n E 2 62 ILE 62 88 ? ? ? F . n E 2 63 GLY 63 89 ? ? ? F . n E 2 64 ASP 64 90 ? ? ? F . n E 2 65 PRO 65 91 ? ? ? F . n E 2 66 GLN 66 92 ? ? ? F . n E 2 67 GLU 67 93 93 GLU GLU F . n E 2 68 CYS 68 94 94 CYS CYS F . n E 2 69 HIS 69 95 95 HIS HIS F . n E 2 70 TYR 70 96 96 TYR TYR F . n E 2 71 GLU 71 97 97 GLU GLU F . n E 2 72 GLU 72 98 98 GLU GLU F . n E 2 73 CYS 73 99 99 CYS CYS F . n E 2 74 VAL 74 100 100 VAL VAL F . n E 2 75 VAL 75 101 101 VAL VAL F . n E 2 76 THR 76 102 102 THR THR F . n E 2 77 THR 77 103 103 THR THR F . n E 2 78 THR 78 104 104 THR THR F . n E 2 79 PRO 79 105 105 PRO PRO F . n E 2 80 PRO 80 106 106 PRO PRO F . n E 2 81 SER 81 107 107 SER SER F . n E 2 82 ILE 82 108 ? ? ? F . n E 2 83 GLN 83 109 ? ? ? F . n E 2 84 ASN 84 110 ? ? ? F . n E 2 85 GLY 85 111 ? ? ? F . n E 2 86 THR 86 112 112 THR THR F . n E 2 87 TYR 87 113 113 TYR TYR F . n E 2 88 ARG 88 114 114 ARG ARG F . n E 2 89 PHE 89 115 115 PHE PHE F . n E 2 90 CYS 90 116 116 CYS CYS F . n E 2 91 CYS 91 117 117 CYS CYS F . n E 2 92 CYS 92 118 118 CYS CYS F . n E 2 93 SER 93 119 119 SER SER F . n E 2 94 THR 94 120 120 THR THR F . n E 2 95 ASP 95 121 121 ASP ASP F . n E 2 96 LEU 96 122 122 LEU LEU F . n E 2 97 CYS 97 123 123 CYS CYS F . n E 2 98 ASN 98 124 124 ASN ASN F . n E 2 99 VAL 99 125 125 VAL VAL F . n E 2 100 ASN 100 126 126 ASN ASN F . n E 2 101 PHE 101 127 127 PHE PHE F . n E 2 102 THR 102 128 128 THR THR F . n E 2 103 GLU 103 129 129 GLU GLU F . n E 2 104 ASN 104 130 130 ASN ASN F . n E 2 105 PHE 105 131 131 PHE PHE F . n E 2 106 PRO 106 132 132 PRO PRO F . n E 2 107 PRO 107 133 133 PRO PRO F . n E 2 108 PRO 108 134 ? ? ? F . n E 2 109 ASP 109 135 ? ? ? F . n E 2 110 THR 110 136 ? ? ? F . n E 2 111 THR 111 137 ? ? ? F . n F 2 1 SER 1 27 ? ? ? G . n F 2 2 GLN 2 28 ? ? ? G . n F 2 3 ASN 3 29 ? ? ? G . n F 2 4 GLN 4 30 30 GLN GLN G . n F 2 5 GLU 5 31 31 GLU GLU G . n F 2 6 ARG 6 32 32 ARG ARG G . n F 2 7 LEU 7 33 33 LEU LEU G . n F 2 8 CYS 8 34 34 CYS CYS G . n F 2 9 ALA 9 35 35 ALA ALA G . n F 2 10 PHE 10 36 36 PHE PHE G . n F 2 11 LYS 11 37 37 LYS LYS G . n F 2 12 ASP 12 38 38 ASP ASP G . n F 2 13 PRO 13 39 39 PRO PRO G . n F 2 14 TYR 14 40 40 TYR TYR G . n F 2 15 GLN 15 41 41 GLN GLN G . n F 2 16 GLN 16 42 ? ? ? G . n F 2 17 ASP 17 43 ? ? ? G . n F 2 18 LEU 18 44 ? ? ? G . n F 2 19 GLY 19 45 ? ? ? G . n F 2 20 ILE 20 46 46 ILE ILE G . n F 2 21 GLY 21 47 47 GLY GLY G . n F 2 22 GLU 22 48 48 GLU GLU G . n F 2 23 SER 23 49 49 SER SER G . n F 2 24 ARG 24 50 50 ARG ARG G . n F 2 25 ILE 25 51 51 ILE ILE G . n F 2 26 SER 26 52 52 SER SER G . n F 2 27 HIS 27 53 53 HIS HIS G . n F 2 28 GLU 28 54 54 GLU GLU G . n F 2 29 ASN 29 55 55 ASN ASN G . n F 2 30 GLY 30 56 56 GLY GLY G . n F 2 31 THR 31 57 57 THR THR G . n F 2 32 ILE 32 58 58 ILE ILE G . n F 2 33 LEU 33 59 59 LEU LEU G . n F 2 34 CYS 34 60 60 CYS CYS G . n F 2 35 SER 35 61 61 SER SER G . n F 2 36 LYS 36 62 62 LYS LYS G . n F 2 37 GLY 37 63 63 GLY GLY G . n F 2 38 SER 38 64 64 SER SER G . n F 2 39 THR 39 65 65 THR THR G . n F 2 40 CYS 40 66 66 CYS CYS G . n F 2 41 TYR 41 67 67 TYR TYR G . n F 2 42 GLY 42 68 68 GLY GLY G . n F 2 43 LEU 43 69 69 LEU LEU G . n F 2 44 TRP 44 70 ? ? ? G . n F 2 45 GLU 45 71 ? ? ? G . n F 2 46 LYS 46 72 ? ? ? G . n F 2 47 SER 47 73 ? ? ? G . n F 2 48 LYS 48 74 ? ? ? G . n F 2 49 GLY 49 75 ? ? ? G . n F 2 50 ASP 50 76 ? ? ? G . n F 2 51 ILE 51 77 ? ? ? G . n F 2 52 ASN 52 78 ? ? ? G . n F 2 53 LEU 53 79 ? ? ? G . n F 2 54 VAL 54 80 80 VAL VAL G . n F 2 55 LYS 55 81 81 LYS LYS G . n F 2 56 GLN 56 82 82 GLN GLN G . n F 2 57 GLY 57 83 83 GLY GLY G . n F 2 58 CYS 58 84 84 CYS CYS G . n F 2 59 TRP 59 85 85 TRP TRP G . n F 2 60 SER 60 86 86 SER SER G . n F 2 61 HIS 61 87 87 HIS HIS G . n F 2 62 ILE 62 88 88 ILE ILE G . n F 2 63 GLY 63 89 89 GLY GLY G . n F 2 64 ASP 64 90 90 ASP ASP G . n F 2 65 PRO 65 91 91 PRO PRO G . n F 2 66 GLN 66 92 92 GLN GLN G . n F 2 67 GLU 67 93 93 GLU GLU G . n F 2 68 CYS 68 94 94 CYS CYS G . n F 2 69 HIS 69 95 95 HIS HIS G . n F 2 70 TYR 70 96 96 TYR TYR G . n F 2 71 GLU 71 97 97 GLU GLU G . n F 2 72 GLU 72 98 98 GLU GLU G . n F 2 73 CYS 73 99 99 CYS CYS G . n F 2 74 VAL 74 100 100 VAL VAL G . n F 2 75 VAL 75 101 101 VAL VAL G . n F 2 76 THR 76 102 102 THR THR G . n F 2 77 THR 77 103 103 THR THR G . n F 2 78 THR 78 104 104 THR THR G . n F 2 79 PRO 79 105 105 PRO PRO G . n F 2 80 PRO 80 106 106 PRO PRO G . n F 2 81 SER 81 107 ? ? ? G . n F 2 82 ILE 82 108 ? ? ? G . n F 2 83 GLN 83 109 ? ? ? G . n F 2 84 ASN 84 110 ? ? ? G . n F 2 85 GLY 85 111 ? ? ? G . n F 2 86 THR 86 112 112 THR THR G . n F 2 87 TYR 87 113 113 TYR TYR G . n F 2 88 ARG 88 114 114 ARG ARG G . n F 2 89 PHE 89 115 115 PHE PHE G . n F 2 90 CYS 90 116 116 CYS CYS G . n F 2 91 CYS 91 117 117 CYS CYS G . n F 2 92 CYS 92 118 118 CYS CYS G . n F 2 93 SER 93 119 119 SER SER G . n F 2 94 THR 94 120 120 THR THR G . n F 2 95 ASP 95 121 121 ASP ASP G . n F 2 96 LEU 96 122 122 LEU LEU G . n F 2 97 CYS 97 123 123 CYS CYS G . n F 2 98 ASN 98 124 124 ASN ASN G . n F 2 99 VAL 99 125 125 VAL VAL G . n F 2 100 ASN 100 126 126 ASN ASN G . n F 2 101 PHE 101 127 127 PHE PHE G . n F 2 102 THR 102 128 128 THR THR G . n F 2 103 GLU 103 129 129 GLU GLU G . n F 2 104 ASN 104 130 130 ASN ASN G . n F 2 105 PHE 105 131 131 PHE PHE G . n F 2 106 PRO 106 132 ? ? ? G . n F 2 107 PRO 107 133 ? ? ? G . n F 2 108 PRO 108 134 ? ? ? G . n F 2 109 ASP 109 135 ? ? ? G . n F 2 110 THR 110 136 ? ? ? G . n F 2 111 THR 111 137 ? ? ? G . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email emh@msu.edu _pdbx_contact_author.name_first Erik _pdbx_contact_author.name_last Martinez-Hackert _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-6182-7023 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? dimeric 2 2 author_defined_assembly ? dimeric 2 3 author_defined_assembly ? dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,D 2 1 B,E 3 1 C,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-06-22 2 'Structure model' 1 1 2022-07-06 3 'Structure model' 1 2 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' pdbx_initial_refinement_model 5 3 'Structure model' struct_ncs_dom_lim # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.title' 3 3 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 4 3 'Structure model' '_struct_ncs_dom_lim.beg_label_asym_id' 5 3 'Structure model' '_struct_ncs_dom_lim.beg_label_comp_id' 6 3 'Structure model' '_struct_ncs_dom_lim.beg_label_seq_id' 7 3 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 8 3 'Structure model' '_struct_ncs_dom_lim.end_label_asym_id' 9 3 'Structure model' '_struct_ncs_dom_lim.end_label_comp_id' 10 3 'Structure model' '_struct_ncs_dom_lim.end_label_seq_id' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 1.4519 _pdbx_refine_tls.origin_y -32.9811 _pdbx_refine_tls.origin_z 36.0131 _pdbx_refine_tls.T[1][1] 0.8649 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0828 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.1325 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.7163 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0568 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.7755 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 1.3553 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.0664 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.6714 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 1.6416 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.4342 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 1.3907 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.1986 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.2911 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.0021 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.5955 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.0989 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.4153 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.0125 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.1515 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.1242 _pdbx_refine_tls.S[3][3]_esd ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 293 ? ? ? A 407 ? ? all 2 'X-RAY DIFFRACTION' 1 ? ? B 293 ? ? ? B 407 ? ? all 3 'X-RAY DIFFRACTION' 1 ? ? C 293 ? ? ? C 407 ? ? all 4 'X-RAY DIFFRACTION' 1 ? ? E 31 ? ? ? E 133 ? ? all 5 'X-RAY DIFFRACTION' 1 ? ? F 32 ? ? ? F 133 ? ? all 6 'X-RAY DIFFRACTION' 1 ? ? G 30 ? ? ? G 131 ? ? all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 SG G CYS 99 ? ? SG G CYS 116 ? ? 1.54 2 1 NZ B LYS 393 ? ? O F CYS 84 ? ? 1.96 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 CB A CYS 371 ? ? 1_555 SG A CYS 371 ? ? 2_556 1.59 2 1 CB B CYS 371 ? ? 1_555 SG C CYS 371 ? ? 2_556 1.68 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 330 ? ? 61.70 171.26 2 1 SER A 346 ? ? -136.12 -36.00 3 1 ASN B 330 ? ? 61.60 171.31 4 1 CYS C 303 ? ? -55.32 109.70 5 1 ASN C 330 ? ? 61.62 170.49 6 1 TYR C 339 ? ? -57.90 105.62 7 1 ASP E 90 ? ? -166.52 69.58 8 1 TYR F 40 ? ? -104.29 -107.83 9 1 HIS F 53 ? ? -109.07 48.97 10 1 THR F 103 ? ? -115.80 -167.35 11 1 PRO F 106 ? ? -61.25 97.13 12 1 PRO F 132 ? ? -51.27 101.44 13 1 LYS G 37 ? ? -167.44 102.71 14 1 TYR G 40 ? ? -107.68 -116.22 15 1 HIS G 53 ? ? -68.35 9.34 16 1 GLN G 92 ? ? -67.80 19.46 17 1 GLU G 93 ? ? -136.26 -32.21 18 1 THR G 102 ? ? -105.64 -138.17 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASN 301 ? CG ? A ASN 9 CG 2 1 Y 1 A ASN 301 ? OD1 ? A ASN 9 OD1 3 1 Y 1 A ASN 301 ? ND2 ? A ASN 9 ND2 4 1 Y 1 A GLN 307 ? CG ? A GLN 15 CG 5 1 Y 1 A GLN 307 ? CD ? A GLN 15 CD 6 1 Y 1 A GLN 307 ? OE1 ? A GLN 15 OE1 7 1 Y 1 A GLN 307 ? NE2 ? A GLN 15 NE2 8 1 Y 1 A ASN 369 ? CG ? A ASN 77 CG 9 1 Y 1 A ASN 369 ? OD1 ? A ASN 77 OD1 10 1 Y 1 A ASN 369 ? ND2 ? A ASN 77 ND2 11 1 Y 1 A LYS 393 ? CG ? A LYS 101 CG 12 1 Y 1 A LYS 393 ? CD ? A LYS 101 CD 13 1 Y 1 A LYS 393 ? CE ? A LYS 101 CE 14 1 Y 1 A LYS 393 ? NZ ? A LYS 101 NZ 15 1 Y 1 B ARG 299 ? CG ? B ARG 7 CG 16 1 Y 1 B ARG 299 ? CD ? B ARG 7 CD 17 1 Y 1 B ARG 299 ? NE ? B ARG 7 NE 18 1 Y 1 B ARG 299 ? CZ ? B ARG 7 CZ 19 1 Y 1 B ARG 299 ? NH1 ? B ARG 7 NH1 20 1 Y 1 B ARG 299 ? NH2 ? B ARG 7 NH2 21 1 Y 1 B GLN 307 ? CG ? B GLN 15 CG 22 1 Y 1 B GLN 307 ? CD ? B GLN 15 CD 23 1 Y 1 B GLN 307 ? OE1 ? B GLN 15 OE1 24 1 Y 1 B GLN 307 ? NE2 ? B GLN 15 NE2 25 1 Y 1 B ASN 369 ? CG ? B ASN 77 CG 26 1 Y 1 B ASN 369 ? OD1 ? B ASN 77 OD1 27 1 Y 1 B ASN 369 ? ND2 ? B ASN 77 ND2 28 1 Y 1 C ARG 313 ? CG ? C ARG 21 CG 29 1 Y 1 C ARG 313 ? CD ? C ARG 21 CD 30 1 Y 1 C ARG 313 ? NE ? C ARG 21 NE 31 1 Y 1 C ARG 313 ? CZ ? C ARG 21 CZ 32 1 Y 1 C ARG 313 ? NH1 ? C ARG 21 NH1 33 1 Y 1 C ARG 313 ? NH2 ? C ARG 21 NH2 34 1 Y 1 C TYR 339 ? CG ? C TYR 47 CG 35 1 Y 1 C TYR 339 ? CD1 ? C TYR 47 CD1 36 1 Y 1 C TYR 339 ? CD2 ? C TYR 47 CD2 37 1 Y 1 C TYR 339 ? CE1 ? C TYR 47 CE1 38 1 Y 1 C TYR 339 ? CE2 ? C TYR 47 CE2 39 1 Y 1 C TYR 339 ? CZ ? C TYR 47 CZ 40 1 Y 1 C TYR 339 ? OH ? C TYR 47 OH 41 1 Y 1 C LYS 376 ? CG ? C LYS 84 CG 42 1 Y 1 C LYS 376 ? CD ? C LYS 84 CD 43 1 Y 1 C LYS 376 ? CE ? C LYS 84 CE 44 1 Y 1 C LYS 376 ? NZ ? C LYS 84 NZ 45 1 Y 1 C LYS 393 ? CG ? C LYS 101 CG 46 1 Y 1 C LYS 393 ? CD ? C LYS 101 CD 47 1 Y 1 C LYS 393 ? CE ? C LYS 101 CE 48 1 Y 1 C LYS 393 ? NZ ? C LYS 101 NZ 49 1 Y 1 C ARG 394 ? CG ? C ARG 102 CG 50 1 Y 1 C ARG 394 ? CD ? C ARG 102 CD 51 1 Y 1 C ARG 394 ? NE ? C ARG 102 NE 52 1 Y 1 C ARG 394 ? CZ ? C ARG 102 CZ 53 1 Y 1 C ARG 394 ? NH1 ? C ARG 102 NH1 54 1 Y 1 C ARG 394 ? NH2 ? C ARG 102 NH2 55 1 Y 1 E GLU 31 ? CG ? D GLU 5 CG 56 1 Y 1 E GLU 31 ? CD ? D GLU 5 CD 57 1 Y 1 E GLU 31 ? OE1 ? D GLU 5 OE1 58 1 Y 1 E GLU 31 ? OE2 ? D GLU 5 OE2 59 1 Y 1 E ARG 32 ? CG ? D ARG 6 CG 60 1 Y 1 E ARG 32 ? CD ? D ARG 6 CD 61 1 Y 1 E ARG 32 ? NE ? D ARG 6 NE 62 1 Y 1 E ARG 32 ? CZ ? D ARG 6 CZ 63 1 Y 1 E ARG 32 ? NH1 ? D ARG 6 NH1 64 1 Y 1 E ARG 32 ? NH2 ? D ARG 6 NH2 65 1 Y 1 E LEU 33 ? CG ? D LEU 7 CG 66 1 Y 1 E LEU 33 ? CD1 ? D LEU 7 CD1 67 1 Y 1 E LEU 33 ? CD2 ? D LEU 7 CD2 68 1 Y 1 E LYS 37 ? CG ? D LYS 11 CG 69 1 Y 1 E LYS 37 ? CD ? D LYS 11 CD 70 1 Y 1 E LYS 37 ? CE ? D LYS 11 CE 71 1 Y 1 E LYS 37 ? NZ ? D LYS 11 NZ 72 1 Y 1 E HIS 53 ? CG ? D HIS 27 CG 73 1 Y 1 E HIS 53 ? ND1 ? D HIS 27 ND1 74 1 Y 1 E HIS 53 ? CD2 ? D HIS 27 CD2 75 1 Y 1 E HIS 53 ? CE1 ? D HIS 27 CE1 76 1 Y 1 E HIS 53 ? NE2 ? D HIS 27 NE2 77 1 Y 1 E GLU 54 ? CG ? D GLU 28 CG 78 1 Y 1 E GLU 54 ? CD ? D GLU 28 CD 79 1 Y 1 E GLU 54 ? OE1 ? D GLU 28 OE1 80 1 Y 1 E GLU 54 ? OE2 ? D GLU 28 OE2 81 1 Y 1 E LYS 62 ? CG ? D LYS 36 CG 82 1 Y 1 E LYS 62 ? CD ? D LYS 36 CD 83 1 Y 1 E LYS 62 ? CE ? D LYS 36 CE 84 1 Y 1 E LYS 62 ? NZ ? D LYS 36 NZ 85 1 Y 1 E GLU 93 ? CG ? D GLU 67 CG 86 1 Y 1 E GLU 93 ? CD ? D GLU 67 CD 87 1 Y 1 E GLU 93 ? OE1 ? D GLU 67 OE1 88 1 Y 1 E GLU 93 ? OE2 ? D GLU 67 OE2 89 1 Y 1 E HIS 95 ? CG ? D HIS 69 CG 90 1 Y 1 E HIS 95 ? ND1 ? D HIS 69 ND1 91 1 Y 1 E HIS 95 ? CD2 ? D HIS 69 CD2 92 1 Y 1 E HIS 95 ? CE1 ? D HIS 69 CE1 93 1 Y 1 E HIS 95 ? NE2 ? D HIS 69 NE2 94 1 Y 1 E GLU 97 ? CG ? D GLU 71 CG 95 1 Y 1 E GLU 97 ? CD ? D GLU 71 CD 96 1 Y 1 E GLU 97 ? OE1 ? D GLU 71 OE1 97 1 Y 1 E GLU 97 ? OE2 ? D GLU 71 OE2 98 1 Y 1 E GLU 98 ? CG ? D GLU 72 CG 99 1 Y 1 E GLU 98 ? CD ? D GLU 72 CD 100 1 Y 1 E GLU 98 ? OE1 ? D GLU 72 OE1 101 1 Y 1 E GLU 98 ? OE2 ? D GLU 72 OE2 102 1 Y 1 E ILE 108 ? CG1 ? D ILE 82 CG1 103 1 Y 1 E ILE 108 ? CG2 ? D ILE 82 CG2 104 1 Y 1 E ILE 108 ? CD1 ? D ILE 82 CD1 105 1 Y 1 E ARG 114 ? CG ? D ARG 88 CG 106 1 Y 1 E ARG 114 ? CD ? D ARG 88 CD 107 1 Y 1 E ARG 114 ? NE ? D ARG 88 NE 108 1 Y 1 E ARG 114 ? CZ ? D ARG 88 CZ 109 1 Y 1 E ARG 114 ? NH1 ? D ARG 88 NH1 110 1 Y 1 E ARG 114 ? NH2 ? D ARG 88 NH2 111 1 Y 1 E ASN 126 ? CG ? D ASN 100 CG 112 1 Y 1 E ASN 126 ? OD1 ? D ASN 100 OD1 113 1 Y 1 E ASN 126 ? ND2 ? D ASN 100 ND2 114 1 Y 1 F ARG 32 ? CG ? E ARG 6 CG 115 1 Y 1 F ARG 32 ? CD ? E ARG 6 CD 116 1 Y 1 F ARG 32 ? NE ? E ARG 6 NE 117 1 Y 1 F ARG 32 ? CZ ? E ARG 6 CZ 118 1 Y 1 F ARG 32 ? NH1 ? E ARG 6 NH1 119 1 Y 1 F ARG 32 ? NH2 ? E ARG 6 NH2 120 1 Y 1 F LYS 37 ? CG ? E LYS 11 CG 121 1 Y 1 F LYS 37 ? CD ? E LYS 11 CD 122 1 Y 1 F LYS 37 ? CE ? E LYS 11 CE 123 1 Y 1 F LYS 37 ? NZ ? E LYS 11 NZ 124 1 Y 1 F TYR 40 ? CG ? E TYR 14 CG 125 1 Y 1 F TYR 40 ? CD1 ? E TYR 14 CD1 126 1 Y 1 F TYR 40 ? CD2 ? E TYR 14 CD2 127 1 Y 1 F TYR 40 ? CE1 ? E TYR 14 CE1 128 1 Y 1 F TYR 40 ? CE2 ? E TYR 14 CE2 129 1 Y 1 F TYR 40 ? CZ ? E TYR 14 CZ 130 1 Y 1 F TYR 40 ? OH ? E TYR 14 OH 131 1 Y 1 F GLN 41 ? CG ? E GLN 15 CG 132 1 Y 1 F GLN 41 ? CD ? E GLN 15 CD 133 1 Y 1 F GLN 41 ? OE1 ? E GLN 15 OE1 134 1 Y 1 F GLN 41 ? NE2 ? E GLN 15 NE2 135 1 Y 0 F ASN 55 ? CA ? E ASN 29 CA 136 1 Y 0 F ASN 55 ? CG ? E ASN 29 CG 137 1 Y 1 F LYS 62 ? CG ? E LYS 36 CG 138 1 Y 1 F LYS 62 ? CD ? E LYS 36 CD 139 1 Y 1 F LYS 62 ? CE ? E LYS 36 CE 140 1 Y 1 F LYS 62 ? NZ ? E LYS 36 NZ 141 1 Y 1 F LYS 74 ? CG ? E LYS 48 CG 142 1 Y 1 F LYS 74 ? CD ? E LYS 48 CD 143 1 Y 1 F LYS 74 ? CE ? E LYS 48 CE 144 1 Y 1 F LYS 74 ? NZ ? E LYS 48 NZ 145 1 Y 1 F LYS 81 ? CG ? E LYS 55 CG 146 1 Y 1 F LYS 81 ? CD ? E LYS 55 CD 147 1 Y 1 F LYS 81 ? CE ? E LYS 55 CE 148 1 Y 1 F LYS 81 ? NZ ? E LYS 55 NZ 149 1 Y 1 F GLU 93 ? CG ? E GLU 67 CG 150 1 Y 1 F GLU 93 ? CD ? E GLU 67 CD 151 1 Y 1 F GLU 93 ? OE1 ? E GLU 67 OE1 152 1 Y 1 F GLU 93 ? OE2 ? E GLU 67 OE2 153 1 Y 1 F HIS 95 ? CG ? E HIS 69 CG 154 1 Y 1 F HIS 95 ? ND1 ? E HIS 69 ND1 155 1 Y 1 F HIS 95 ? CD2 ? E HIS 69 CD2 156 1 Y 1 F HIS 95 ? CE1 ? E HIS 69 CE1 157 1 Y 1 F HIS 95 ? NE2 ? E HIS 69 NE2 158 1 Y 1 F GLU 97 ? CG ? E GLU 71 CG 159 1 Y 1 F GLU 97 ? CD ? E GLU 71 CD 160 1 Y 1 F GLU 97 ? OE1 ? E GLU 71 OE1 161 1 Y 1 F GLU 97 ? OE2 ? E GLU 71 OE2 162 1 Y 1 F GLU 98 ? CG ? E GLU 72 CG 163 1 Y 1 F GLU 98 ? CD ? E GLU 72 CD 164 1 Y 1 F GLU 98 ? OE1 ? E GLU 72 OE1 165 1 Y 1 F GLU 98 ? OE2 ? E GLU 72 OE2 166 1 Y 1 F ARG 114 ? CG ? E ARG 88 CG 167 1 Y 1 F ARG 114 ? CD ? E ARG 88 CD 168 1 Y 1 F ARG 114 ? NE ? E ARG 88 NE 169 1 Y 1 F ARG 114 ? CZ ? E ARG 88 CZ 170 1 Y 1 F ARG 114 ? NH1 ? E ARG 88 NH1 171 1 Y 1 F ARG 114 ? NH2 ? E ARG 88 NH2 172 1 Y 1 F ASP 121 ? CG ? E ASP 95 CG 173 1 Y 1 F ASP 121 ? OD1 ? E ASP 95 OD1 174 1 Y 1 F ASP 121 ? OD2 ? E ASP 95 OD2 175 1 Y 1 F LEU 122 ? CG ? E LEU 96 CG 176 1 Y 1 F LEU 122 ? CD1 ? E LEU 96 CD1 177 1 Y 1 F LEU 122 ? CD2 ? E LEU 96 CD2 178 1 Y 1 F ASN 130 ? CG ? E ASN 104 CG 179 1 Y 1 F ASN 130 ? OD1 ? E ASN 104 OD1 180 1 Y 1 F ASN 130 ? ND2 ? E ASN 104 ND2 181 1 Y 1 F PHE 131 ? CG ? E PHE 105 CG 182 1 Y 1 F PHE 131 ? CD1 ? E PHE 105 CD1 183 1 Y 1 F PHE 131 ? CD2 ? E PHE 105 CD2 184 1 Y 1 F PHE 131 ? CE1 ? E PHE 105 CE1 185 1 Y 1 F PHE 131 ? CE2 ? E PHE 105 CE2 186 1 Y 1 F PHE 131 ? CZ ? E PHE 105 CZ 187 1 Y 1 G GLN 30 ? CG ? F GLN 4 CG 188 1 Y 1 G GLN 30 ? CD ? F GLN 4 CD 189 1 Y 1 G GLN 30 ? OE1 ? F GLN 4 OE1 190 1 Y 1 G GLN 30 ? NE2 ? F GLN 4 NE2 191 1 Y 1 G GLU 31 ? CG ? F GLU 5 CG 192 1 Y 1 G GLU 31 ? CD ? F GLU 5 CD 193 1 Y 1 G GLU 31 ? OE1 ? F GLU 5 OE1 194 1 Y 1 G GLU 31 ? OE2 ? F GLU 5 OE2 195 1 Y 1 G ARG 32 ? CG ? F ARG 6 CG 196 1 Y 1 G ARG 32 ? CD ? F ARG 6 CD 197 1 Y 1 G ARG 32 ? NE ? F ARG 6 NE 198 1 Y 1 G ARG 32 ? CZ ? F ARG 6 CZ 199 1 Y 1 G ARG 32 ? NH1 ? F ARG 6 NH1 200 1 Y 1 G ARG 32 ? NH2 ? F ARG 6 NH2 201 1 Y 1 G LEU 33 ? CG ? F LEU 7 CG 202 1 Y 1 G LEU 33 ? CD1 ? F LEU 7 CD1 203 1 Y 1 G LEU 33 ? CD2 ? F LEU 7 CD2 204 1 Y 1 G LYS 37 ? CG ? F LYS 11 CG 205 1 Y 1 G LYS 37 ? CD ? F LYS 11 CD 206 1 Y 1 G LYS 37 ? CE ? F LYS 11 CE 207 1 Y 1 G LYS 37 ? NZ ? F LYS 11 NZ 208 1 Y 1 G GLN 41 ? CG ? F GLN 15 CG 209 1 Y 1 G GLN 41 ? CD ? F GLN 15 CD 210 1 Y 1 G GLN 41 ? OE1 ? F GLN 15 OE1 211 1 Y 1 G GLN 41 ? NE2 ? F GLN 15 NE2 212 1 Y 1 G ARG 50 ? CG ? F ARG 24 CG 213 1 Y 1 G ARG 50 ? CD ? F ARG 24 CD 214 1 Y 1 G ARG 50 ? NE ? F ARG 24 NE 215 1 Y 1 G ARG 50 ? CZ ? F ARG 24 CZ 216 1 Y 1 G ARG 50 ? NH1 ? F ARG 24 NH1 217 1 Y 1 G ARG 50 ? NH2 ? F ARG 24 NH2 218 1 Y 1 G GLU 54 ? CG ? F GLU 28 CG 219 1 Y 1 G GLU 54 ? CD ? F GLU 28 CD 220 1 Y 1 G GLU 54 ? OE1 ? F GLU 28 OE1 221 1 Y 1 G GLU 54 ? OE2 ? F GLU 28 OE2 222 1 Y 0 G ASN 55 ? CA ? F ASN 29 CA 223 1 Y 0 G ASN 55 ? OD1 ? F ASN 29 OD1 224 1 Y 1 G LYS 62 ? CG ? F LYS 36 CG 225 1 Y 1 G LYS 62 ? CD ? F LYS 36 CD 226 1 Y 1 G LYS 62 ? CE ? F LYS 36 CE 227 1 Y 1 G LYS 62 ? NZ ? F LYS 36 NZ 228 1 Y 1 G LEU 69 ? CG ? F LEU 43 CG 229 1 Y 1 G LEU 69 ? CD1 ? F LEU 43 CD1 230 1 Y 1 G LEU 69 ? CD2 ? F LEU 43 CD2 231 1 Y 1 G HIS 87 ? CG ? F HIS 61 CG 232 1 Y 1 G HIS 87 ? ND1 ? F HIS 61 ND1 233 1 Y 1 G HIS 87 ? CD2 ? F HIS 61 CD2 234 1 Y 1 G HIS 87 ? CE1 ? F HIS 61 CE1 235 1 Y 1 G HIS 87 ? NE2 ? F HIS 61 NE2 236 1 Y 1 G GLN 92 ? CG ? F GLN 66 CG 237 1 Y 1 G GLN 92 ? CD ? F GLN 66 CD 238 1 Y 1 G GLN 92 ? OE1 ? F GLN 66 OE1 239 1 Y 1 G GLN 92 ? NE2 ? F GLN 66 NE2 240 1 Y 1 G HIS 95 ? CG ? F HIS 69 CG 241 1 Y 1 G HIS 95 ? ND1 ? F HIS 69 ND1 242 1 Y 1 G HIS 95 ? CD2 ? F HIS 69 CD2 243 1 Y 1 G HIS 95 ? CE1 ? F HIS 69 CE1 244 1 Y 1 G HIS 95 ? NE2 ? F HIS 69 NE2 245 1 Y 1 G GLU 97 ? CG ? F GLU 71 CG 246 1 Y 1 G GLU 97 ? CD ? F GLU 71 CD 247 1 Y 1 G GLU 97 ? OE1 ? F GLU 71 OE1 248 1 Y 1 G GLU 97 ? OE2 ? F GLU 71 OE2 249 1 Y 1 G GLU 98 ? CG ? F GLU 72 CG 250 1 Y 1 G GLU 98 ? CD ? F GLU 72 CD 251 1 Y 1 G GLU 98 ? OE1 ? F GLU 72 OE1 252 1 Y 1 G GLU 98 ? OE2 ? F GLU 72 OE2 253 1 Y 1 G ARG 114 ? CG ? F ARG 88 CG 254 1 Y 1 G ARG 114 ? CD ? F ARG 88 CD 255 1 Y 1 G ARG 114 ? NE ? F ARG 88 NE 256 1 Y 1 G ARG 114 ? CZ ? F ARG 88 CZ 257 1 Y 1 G ARG 114 ? NH1 ? F ARG 88 NH1 258 1 Y 1 G ARG 114 ? NH2 ? F ARG 88 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 340 ? A LEU 48 2 1 Y 1 A ALA 341 ? A ALA 49 3 1 Y 1 A GLY 342 ? A GLY 50 4 1 Y 1 A VAL 343 ? A VAL 51 5 1 Y 1 B LEU 340 ? B LEU 48 6 1 Y 1 B ALA 341 ? B ALA 49 7 1 Y 1 B GLY 342 ? B GLY 50 8 1 Y 1 B VAL 343 ? B VAL 51 9 1 Y 1 B PRO 344 ? B PRO 52 10 1 Y 1 B GLY 345 ? B GLY 53 11 1 Y 1 E SER 27 ? D SER 1 12 1 Y 1 E GLN 28 ? D GLN 2 13 1 Y 1 E ASN 29 ? D ASN 3 14 1 Y 1 E GLN 30 ? D GLN 4 15 1 Y 1 E GLN 42 ? D GLN 16 16 1 Y 1 E ASP 43 ? D ASP 17 17 1 Y 1 E LEU 44 ? D LEU 18 18 1 Y 1 E GLY 45 ? D GLY 19 19 1 Y 1 E ILE 46 ? D ILE 20 20 1 Y 1 E GLY 47 ? D GLY 21 21 1 Y 1 E GLU 48 ? D GLU 22 22 1 Y 1 E SER 49 ? D SER 23 23 1 Y 1 E ARG 50 ? D ARG 24 24 1 Y 1 E ILE 51 ? D ILE 25 25 1 Y 1 E SER 52 ? D SER 26 26 1 Y 1 E LYS 72 ? D LYS 46 27 1 Y 1 E SER 73 ? D SER 47 28 1 Y 1 E LYS 74 ? D LYS 48 29 1 Y 1 E THR 103 ? D THR 77 30 1 Y 1 E THR 104 ? D THR 78 31 1 Y 1 E PRO 105 ? D PRO 79 32 1 Y 1 E PRO 106 ? D PRO 80 33 1 Y 1 E SER 107 ? D SER 81 34 1 Y 1 E PRO 134 ? D PRO 108 35 1 Y 1 E ASP 135 ? D ASP 109 36 1 Y 1 E THR 136 ? D THR 110 37 1 Y 1 E THR 137 ? D THR 111 38 1 Y 1 F SER 27 ? E SER 1 39 1 Y 1 F GLN 28 ? E GLN 2 40 1 Y 1 F ASN 29 ? E ASN 3 41 1 Y 1 F GLN 30 ? E GLN 4 42 1 Y 1 F GLU 31 ? E GLU 5 43 1 Y 1 F GLN 42 ? E GLN 16 44 1 Y 1 F ASP 43 ? E ASP 17 45 1 Y 1 F LEU 44 ? E LEU 18 46 1 Y 1 F GLY 45 ? E GLY 19 47 1 Y 1 F ILE 46 ? E ILE 20 48 1 Y 1 F GLY 47 ? E GLY 21 49 1 Y 1 F GLU 48 ? E GLU 22 50 1 Y 1 F SER 49 ? E SER 23 51 1 Y 1 F ILE 88 ? E ILE 62 52 1 Y 1 F GLY 89 ? E GLY 63 53 1 Y 1 F ASP 90 ? E ASP 64 54 1 Y 1 F PRO 91 ? E PRO 65 55 1 Y 1 F GLN 92 ? E GLN 66 56 1 Y 1 F ILE 108 ? E ILE 82 57 1 Y 1 F GLN 109 ? E GLN 83 58 1 Y 1 F ASN 110 ? E ASN 84 59 1 Y 1 F GLY 111 ? E GLY 85 60 1 Y 1 F PRO 134 ? E PRO 108 61 1 Y 1 F ASP 135 ? E ASP 109 62 1 Y 1 F THR 136 ? E THR 110 63 1 Y 1 F THR 137 ? E THR 111 64 1 Y 1 G SER 27 ? F SER 1 65 1 Y 1 G GLN 28 ? F GLN 2 66 1 Y 1 G ASN 29 ? F ASN 3 67 1 Y 1 G GLN 42 ? F GLN 16 68 1 Y 1 G ASP 43 ? F ASP 17 69 1 Y 1 G LEU 44 ? F LEU 18 70 1 Y 1 G GLY 45 ? F GLY 19 71 1 Y 1 G TRP 70 ? F TRP 44 72 1 Y 1 G GLU 71 ? F GLU 45 73 1 Y 1 G LYS 72 ? F LYS 46 74 1 Y 1 G SER 73 ? F SER 47 75 1 Y 1 G LYS 74 ? F LYS 48 76 1 Y 1 G GLY 75 ? F GLY 49 77 1 Y 1 G ASP 76 ? F ASP 50 78 1 Y 1 G ILE 77 ? F ILE 51 79 1 Y 1 G ASN 78 ? F ASN 52 80 1 Y 1 G LEU 79 ? F LEU 53 81 1 Y 1 G SER 107 ? F SER 81 82 1 Y 1 G ILE 108 ? F ILE 82 83 1 Y 1 G GLN 109 ? F GLN 83 84 1 Y 1 G ASN 110 ? F ASN 84 85 1 Y 1 G GLY 111 ? F GLY 85 86 1 Y 1 G PRO 132 ? F PRO 106 87 1 Y 1 G PRO 133 ? F PRO 107 88 1 Y 1 G PRO 134 ? F PRO 108 89 1 Y 1 G ASP 135 ? F ASP 109 90 1 Y 1 G THR 136 ? F THR 110 91 1 Y 1 G THR 137 ? F THR 111 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number R01GM121499 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2HLR _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #