data_7UB4 # _entry.id 7UB4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7UB4 pdb_00007ub4 10.2210/pdb7ub4/pdb WWPDB D_1000263878 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7UB4 _pdbx_database_status.recvd_initial_deposition_date 2022-03-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Donkor, A.K.' 1 0000-0002-2563-3002 'Ghatge, M.S.' 2 0000-0002-1146-536X 'Musayev, F.N.' 3 0000-0002-7969-1590 'Safo, M.K.' 4 0000-0002-9536-1743 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Protein Sci.' _citation.journal_id_ASTM PRCIEI _citation.journal_id_CSD 0795 _citation.journal_id_ISSN 1469-896X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 31 _citation.language ? _citation.page_first e4471 _citation.page_last e4471 _citation.title ;Characterization of the Escherichia coli pyridoxal 5'-phosphate homeostasis protein (YggS): Role of lysine residues in PLP binding and protein stability. ; _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/pro.4471 _citation.pdbx_database_id_PubMed 36218140 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tramonti, A.' 1 ? primary 'Ghatge, M.S.' 2 ? primary 'Babor, J.T.' 3 ? primary 'Musayev, F.N.' 4 ? primary 'di Salvo, M.L.' 5 ? primary 'Barile, A.' 6 ? primary 'Colotti, G.' 7 ? primary 'Giorgi, A.' 8 ? primary 'Paredes, S.D.' 9 ? primary 'Donkor, A.K.' 10 ? primary 'Al Mughram, M.H.' 11 ? primary 'de Crecy-Lagard, V.' 12 ? primary 'Safo, M.K.' 13 ? primary 'Contestabile, R.' 14 0000-0002-5235-9993 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7UB4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 124.814 _cell.length_a_esd ? _cell.length_b 124.814 _cell.length_b_esd ? _cell.length_c 83.090 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7UB4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 98 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 41 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Pyridoxal phosphate homeostasis protein' 25588.033 1 ? 'K36A, K38A, K233A, K234A' ? ? 2 non-polymer syn "PYRIDOXAL-5'-PHOSPHATE" 247.142 2 ? ? ? ? 3 water nat water 18.015 52 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'PLP homeostasis protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNDIAHNLAQVRDKISAAATRCGRSPEEITLLAVSATAPASAIAEAIDAGQRQFGENYVQEGVDKIRHFQELGVTGLEWH FIGPLQSNKSRLVAEHFDWCHTIDRLRIATRLNDQRPAELPPLNVLIQINISDENSKSGIQLAELDELAAAVAELPRLRL RGLMAIPAPESEYVRQFEVARQMAVAFAGLKTRYPHIDTLSLGMSDDMEAAIAAGSTMVRIGTAIFGARDYSAA ; _entity_poly.pdbx_seq_one_letter_code_can ;MNDIAHNLAQVRDKISAAATRCGRSPEEITLLAVSATAPASAIAEAIDAGQRQFGENYVQEGVDKIRHFQELGVTGLEWH FIGPLQSNKSRLVAEHFDWCHTIDRLRIATRLNDQRPAELPPLNVLIQINISDENSKSGIQLAELDELAAAVAELPRLRL RGLMAIPAPESEYVRQFEVARQMAVAFAGLKTRYPHIDTLSLGMSDDMEAAIAAGSTMVRIGTAIFGARDYSAA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 ASP n 1 4 ILE n 1 5 ALA n 1 6 HIS n 1 7 ASN n 1 8 LEU n 1 9 ALA n 1 10 GLN n 1 11 VAL n 1 12 ARG n 1 13 ASP n 1 14 LYS n 1 15 ILE n 1 16 SER n 1 17 ALA n 1 18 ALA n 1 19 ALA n 1 20 THR n 1 21 ARG n 1 22 CYS n 1 23 GLY n 1 24 ARG n 1 25 SER n 1 26 PRO n 1 27 GLU n 1 28 GLU n 1 29 ILE n 1 30 THR n 1 31 LEU n 1 32 LEU n 1 33 ALA n 1 34 VAL n 1 35 SER n 1 36 ALA n 1 37 THR n 1 38 ALA n 1 39 PRO n 1 40 ALA n 1 41 SER n 1 42 ALA n 1 43 ILE n 1 44 ALA n 1 45 GLU n 1 46 ALA n 1 47 ILE n 1 48 ASP n 1 49 ALA n 1 50 GLY n 1 51 GLN n 1 52 ARG n 1 53 GLN n 1 54 PHE n 1 55 GLY n 1 56 GLU n 1 57 ASN n 1 58 TYR n 1 59 VAL n 1 60 GLN n 1 61 GLU n 1 62 GLY n 1 63 VAL n 1 64 ASP n 1 65 LYS n 1 66 ILE n 1 67 ARG n 1 68 HIS n 1 69 PHE n 1 70 GLN n 1 71 GLU n 1 72 LEU n 1 73 GLY n 1 74 VAL n 1 75 THR n 1 76 GLY n 1 77 LEU n 1 78 GLU n 1 79 TRP n 1 80 HIS n 1 81 PHE n 1 82 ILE n 1 83 GLY n 1 84 PRO n 1 85 LEU n 1 86 GLN n 1 87 SER n 1 88 ASN n 1 89 LYS n 1 90 SER n 1 91 ARG n 1 92 LEU n 1 93 VAL n 1 94 ALA n 1 95 GLU n 1 96 HIS n 1 97 PHE n 1 98 ASP n 1 99 TRP n 1 100 CYS n 1 101 HIS n 1 102 THR n 1 103 ILE n 1 104 ASP n 1 105 ARG n 1 106 LEU n 1 107 ARG n 1 108 ILE n 1 109 ALA n 1 110 THR n 1 111 ARG n 1 112 LEU n 1 113 ASN n 1 114 ASP n 1 115 GLN n 1 116 ARG n 1 117 PRO n 1 118 ALA n 1 119 GLU n 1 120 LEU n 1 121 PRO n 1 122 PRO n 1 123 LEU n 1 124 ASN n 1 125 VAL n 1 126 LEU n 1 127 ILE n 1 128 GLN n 1 129 ILE n 1 130 ASN n 1 131 ILE n 1 132 SER n 1 133 ASP n 1 134 GLU n 1 135 ASN n 1 136 SER n 1 137 LYS n 1 138 SER n 1 139 GLY n 1 140 ILE n 1 141 GLN n 1 142 LEU n 1 143 ALA n 1 144 GLU n 1 145 LEU n 1 146 ASP n 1 147 GLU n 1 148 LEU n 1 149 ALA n 1 150 ALA n 1 151 ALA n 1 152 VAL n 1 153 ALA n 1 154 GLU n 1 155 LEU n 1 156 PRO n 1 157 ARG n 1 158 LEU n 1 159 ARG n 1 160 LEU n 1 161 ARG n 1 162 GLY n 1 163 LEU n 1 164 MET n 1 165 ALA n 1 166 ILE n 1 167 PRO n 1 168 ALA n 1 169 PRO n 1 170 GLU n 1 171 SER n 1 172 GLU n 1 173 TYR n 1 174 VAL n 1 175 ARG n 1 176 GLN n 1 177 PHE n 1 178 GLU n 1 179 VAL n 1 180 ALA n 1 181 ARG n 1 182 GLN n 1 183 MET n 1 184 ALA n 1 185 VAL n 1 186 ALA n 1 187 PHE n 1 188 ALA n 1 189 GLY n 1 190 LEU n 1 191 LYS n 1 192 THR n 1 193 ARG n 1 194 TYR n 1 195 PRO n 1 196 HIS n 1 197 ILE n 1 198 ASP n 1 199 THR n 1 200 LEU n 1 201 SER n 1 202 LEU n 1 203 GLY n 1 204 MET n 1 205 SER n 1 206 ASP n 1 207 ASP n 1 208 MET n 1 209 GLU n 1 210 ALA n 1 211 ALA n 1 212 ILE n 1 213 ALA n 1 214 ALA n 1 215 GLY n 1 216 SER n 1 217 THR n 1 218 MET n 1 219 VAL n 1 220 ARG n 1 221 ILE n 1 222 GLY n 1 223 THR n 1 224 ALA n 1 225 ILE n 1 226 PHE n 1 227 GLY n 1 228 ALA n 1 229 ARG n 1 230 ASP n 1 231 TYR n 1 232 SER n 1 233 ALA n 1 234 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 234 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ;yggS, yggS_1, A5U30_002536, A6592_01605, A8499_002487, A9X72_04235, AAG43_002119, ABE90_008885, ACN81_19285, ACU57_02420, AM464_06455, APX88_16445, AT335_001847, AW119_01715, AWP93_03370, B6R31_003812, B6R48_004381, B6R87_004199, BANRA_03839, BANRA_04036, BF481_004825, BFL24_20630, BG944_003862, BGZ_03731, BHS81_17785, BIZ41_00110, BJI68_00120, BMC79_000896, BMT50_14985, BMT91_06560, BN17_28641, BO068_000828, BON63_07220, BON64_00505, BON66_18090, BON67_07075, BON68_25380, BON69_08055, BON71_16625, BON72_22075, BON73_20790, BON74_12080, BON75_05715, BON76_19600, BON77_06680, BON78_02935, BON79_04735, BON80_08660, BON84_07605, BON87_03690, BON88_27660, BON89_07800, BON90_06555, BON91_21215, BON92_03035, BON93_14700, BON94_11530, BON95_23425, BON96_08755, BON97_01525, BON98_24335, BR158_001158, BSR05_00525, BTQ06_15305, BvCmsF30A_00775, BvCmsHHP019_01430, BvCmsKKP036_00786, BvCmsKSNP073_01009, BvCmsNSP072_00005, BVL39_11960, C2121_000334, C2U48_19125, C3F40_21750, C5N07_11350, C5Y87_01815, C9114_13755, C9160_19505, C9E67_04785, CCS08_04675, CDC27_15720, CDL36_11990, CG692_04170, CG831_001596, CIG67_09495, CO706_12770, COD53_12020, CR538_04470, CR539_19790, CWS33_02090, CXJ73_003041, D3822_03980, D3G36_06505, D3Y67_09635, D9D77_01715, D9E34_07450, D9H94_01780, D9J61_17485, DAH19_03655, DAH20_07105, DAH21_16420, DAH22_01755, DAH23_02545, DAH24_02555, DAH25_06525, DAH26_02550, DAH27_13005, DAH28_14020, DAH29_07970, DAH30_03695, DAH31_07445, DAH32_08165, DAH33_07600, DAH36_04450, DAH38_14410, DAH40_03245, DAH41_08800, DAH42_03480, DAH43_04295, DAH45_02570, DAH46_04290, DAH47_01830, DAH48_00100, DAH49_05945, DAH50_00985, DEN87_23415, DEN88_15345, DEN89_15360, DEN90_09900, DEN93_01895, DEN94_02765, DEN95_05305, DEN96_03260, DEN97_02915, DEN98_02920, DEN99_00275, DEO00_02260, DEO01_06395, DEO02_04040, DEO03_09945, DEO04_01960, DEO05_01955, DEO06_10490, DEO07_10895, DEO08_05235, DEO09_01960, DEO10_03860, DEO11_03875, DEO12_19480, DEO13_03715, DEO14_14565, DEO15_02570, DEO17_09170, DEO18_08415, DEO19_02695, DEO20_04970, DIV22_04725, DM870_04190, DN627_06500, DNQ45_04905, DRW19_08955, DS732_21845, DTL43_08565, DTM16_23260, DTM45_03435, DU321_13160, DXT69_09050, DXT70_01070, DXT73_11060, E0I42_19975, E2113_22350, E2114_23105, E2115_25170, E2116_22045, E2117_06585, E2118_25780, E2119_17460, E2120_22990, E2121_10340, E2123_21170, E2124_21650, E2125_22595, E2127_08790, E2128_15520, E2129_10865, E2130_22720, E2132_07800, E2134_10685, E2136_04185, E5M02_18275, E5P22_07505, E5P23_16320, E5P24_19370, E5P25_09260, E5P30_04575, E5P31_12580, E5P32_10610, E5P35_01370, E5P36_03040, E5P37_15605, E5P39_18620, E5P40_16160, E5P41_17595, E5P42_03955, E5P43_17815, E5P44_03755, E5P45_15495, E5P46_17265, E5P47_15135, E5P48_16110, E5P49_09785, E5P50_06510, E5P51_14720, E5P52_04945, E5S34_19085, E5S35_06260, E5S36_16600, E5S37_19475, E5S38_02910, E5S39_05640, E5S42_02315, E5S43_06610, E5S44_08370, E5S46_03050, E5S47_04035, E5S48_19765, E5S51_01045, E5S52_07370, E5S53_08955, E5S55_07915, E5S56_10495, E5S57_01375, E5S58_01605, E5S61_06985, E5S62_00685, EA435_13755, EAI46_13050, EAN77_06340, EAX79_18760, EBP16_03495, EC3234A_50c00850, EC95NR1_02249, ECs3826, ED648_12865, EHD79_07725, EHH55_19850, EI021_05995, EIZ93_04705, EKI52_19505, EL79_0770, EL80_0765, ELT16_22100, ELT20_11815, ELT21_06930, ELT24_14260, ELT25_23905, ELT26_01120, ELT27_12075, ELT29_11660, ELT30_23070, ELT32_11085, ELT34_21400, ELT35_11005, ELT36_22555, ELT39_24285, ELT40_23250, ELT44_23345, ELT45_23015, ELT46_09740, ELT48_18535, ELT51_11245, ELT54_23985, ELT55_20860, ELT59_22130, ELT60_23295, ELT61_23190, ELT63_22530, ELT72_21945, ELU07_18210, ELU82_21625, ELU88_08890, ELU89_22125, ELU90_06760, ELU91_22220, ELU94_16485, ELU96_24085, ELU97_24105, ELU98_16800, ELV00_09650, ELV01_14635, ELV02_23710, ELV03_14355, ELV04_23130, ELV05_13450, ELV07_18185, ELV08_03735, ELV09_05255, ELV11_25160, ELV12_21430, ELV13_23925, ELV20_21495, ELV21_16555, ELV22_07885, ELV23_09990, ELV24_22210, ELV29_20480, ELX56_22225, ELX61_10855, ELX68_21270, ELX70_06600, ELX79_17745, ELX83_22385, ELX85_03700, ELY02_06930, ELY05_01540, ELY23_22015, ELY24_21105, ELY36_14265, ELY39_02230, ELY48_11860, ELY50_05765, EPS76_23030, ERS085406_01321, EVY14_04185, EXX13_15075, EYV17_01965, EYV18_21555, EYX47_12185, F0L67_07365, F2N31_22060, F7F11_00195, F9S76_07455, F9S83_14710, F9V24_03870, F9X20_25345, FE587_00885, FEJ01_00445, FFF58_11750, FJQ51_10270, FKO60_04535, FOI11_01810, FOI11_021370, FPI65_18190, FQ007_01470, FQF29_10150, FTV90_24115, FTV92_22795, FTV93_22815, FV293_10555, FVB16_24045, FY127_17985, FZN31_04490, G3565_13830, G5632_06490, G9448_18855, GIB53_14050, GKF86_09175, GKF89_08035, GKG12_00085, GNO40_18860, GNZ05_07955, GP650_01920, GP662_19735, GP946_14015, GP954_13245, GP979_21920, GQE64_15305, GQF59_22030, GQM04_18765, GQM09_03895, GQM13_07895, GQW68_13910, GQW80_01115, GRC73_21480, GRW05_17975, GRW57_26645, GRW81_17185, GTP88_07945, GUB08_20850, GUB92_14665, GUC01_11340, GUI33_09255, HHH44_003830, HI055_000095, HKA49_003353, HL563_05490, HLV18_01610, HLZ50_19300, HMU06_00730, HMU48_04490, HMV41_05740, HMV95_09385, HV209_16500, HV209_28430, HVV39_06655, HVW19_10795, HVW43_21550, HVX16_04630, HVX32_17080, HVY77_04590, HVZ71_04370, HX136_04100, I6H00_22940, I6H01_08680, I6H02_10245, IAI11_03475, IH768_06245, IH772_17565, IT029_002518, J0541_004081, J4S20_003608, J5U05_000108, JE86ST02C_34240, JE86ST05C_34280, JFD_01472, JNP96_22325, NCTC10082_03252, NCTC10089_00898, NCTC10090_03953, NCTC10418_01404, NCTC10429_01490, NCTC10865_01122, NCTC10958_00951, NCTC10974_01056, NCTC11126_04786, NCTC11181_03104, NCTC12950_01061, NCTC13148_02921, NCTC13216_00987, NCTC4450_02839, NCTC7928_01950, NCTC8008_00336, NCTC8009_02182, NCTC8179_06415, NCTC8333_00986, NCTC8450_05416, NCTC8959_02664, NCTC8985_05487, NCTC9036_00912, NCTC9037_01055, NCTC9045_01016, NCTC9111_01297, NCTC9117_01392, NCTC9775_04646, ND22_003843, RG28_06665, SAMEA3472044_02854, SAMEA3472067_03679, SAMEA3472080_03697, SAMEA3472147_01446, SAMEA3751407_00781, SAMEA3752557_03404, TUM18780_07680, WP2S18E08_09360, WP4S18E07_08580 ; _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain HMS174 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-28A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C3SV52_ECOLX _struct_ref.pdbx_db_accession C3SV52 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNDIAHNLAQVRDKISAAATRCGRSPEEITLLAVSKTKPASAIAEAIDAGQRQFGENYVQEGVDKIRHFQELGVTGLEWH FIGPLQSNKSRLVAEHFDWCHTIDRLRIATRLNDQRPAELPPLNVLIQINISDENSKSGIQLAELDELAAAVAELPRLRL RGLMAIPAPESEYVRQFEVARQMAVAFAGLKTRYPHIDTLSLGMSDDMEAAIAAGSTMVRIGTAIFGARDYSKK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7UB4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 234 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession C3SV52 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 234 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 234 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7UB4 ALA A 36 ? UNP C3SV52 LYS 36 'engineered mutation' 36 1 1 7UB4 ALA A 38 ? UNP C3SV52 LYS 38 'engineered mutation' 38 2 1 7UB4 ALA A 233 ? UNP C3SV52 LYS 233 'engineered mutation' 233 3 1 7UB4 ALA A 234 ? UNP C3SV52 LYS 234 'engineered mutation' 234 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PLP non-polymer . "PYRIDOXAL-5'-PHOSPHATE" 'VITAMIN B6 Phosphate' 'C8 H10 N O6 P' 247.142 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7UB4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.1 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 60 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M Sodium citrate/citric acid, pH 4.0, 0.8M ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details 'VariMax TM-VHF Arc)Sec Confocal Optical System' _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER R 4M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-11-16 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5406 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5406 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 32.300 _reflns.entry_id 7UB4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.400 _reflns.d_resolution_low 28.4430 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13080 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.500 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.300 _reflns.pdbx_Rmerge_I_obs 0.056 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 33.700 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.059 _reflns.pdbx_Rpim_I_all 0.018 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.400 2.490 ? ? 15866 ? ? ? 1360 100.000 ? ? ? ? 0.339 ? ? ? ? ? ? ? ? 11.700 ? ? ? 8.500 0.354 0.103 ? 1 1 0.973 ? ? ? ? ? ? ? ? ? ? 8.980 28.440 ? ? 2814 ? ? ? 282 96.800 ? ? ? ? 0.015 ? ? ? ? ? ? ? ? 10.000 ? ? ? 98.200 0.015 0.005 ? 2 1 1.000 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 105.400 _refine.B_iso_mean 33.1865 _refine.B_iso_min 15.230 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7UB4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.4000 _refine.ls_d_res_low 28.4430 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12994 _refine.ls_number_reflns_R_free 659 _refine.ls_number_reflns_R_work 12335 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.9600 _refine.ls_percent_reflns_R_free 5.0700 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2079 _refine.ls_R_factor_R_free 0.2598 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2051 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1w8g _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.3400 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.4000 _refine_hist.d_res_low 28.4430 _refine_hist.number_atoms_solvent 52 _refine_hist.number_atoms_total 1816 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 226 _refine_hist.pdbx_B_iso_mean_ligand 73.69 _refine_hist.pdbx_B_iso_mean_solvent 31.94 _refine_hist.pdbx_number_atoms_protein 1732 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 32 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.4000 2.5852 . . 125 2441 99.0000 . . . 0.3591 0.0000 0.2588 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5852 2.8451 . . 134 2436 100.0000 . . . 0.2915 0.0000 0.2479 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8451 3.2563 . . 148 2450 100.0000 . . . 0.2921 0.0000 0.2248 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2563 4.1007 . . 108 2406 96.0000 . . . 0.2707 0.0000 0.2011 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.1007 28.4430 . . 144 2602 100.0000 . . . 0.2039 0.0000 0.1704 . . . . . . . . . . . # _struct.entry_id 7UB4 _struct.title 'The crystal structure of the K36A/K38A/K233A/K234A quadruple mutant of E. coli YGGS in complex with PLP' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7UB4 _struct_keywords.text 'PLP-binding protein, Vitamin B6, PLP homeostasis, PROTEIN TRANSPORT' _struct_keywords.pdbx_keywords 'PROTEIN TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 3 ? CYS A 22 ? ASP A 3 CYS A 22 1 ? 20 HELX_P HELX_P2 AA2 SER A 25 ? ILE A 29 ? SER A 25 ILE A 29 5 ? 5 HELX_P HELX_P3 AA3 PRO A 39 ? ALA A 49 ? PRO A 39 ALA A 49 1 ? 11 HELX_P HELX_P4 AA4 TYR A 58 ? LEU A 72 ? TYR A 58 LEU A 72 1 ? 15 HELX_P HELX_P5 AA5 GLN A 86 ? ASN A 88 ? GLN A 86 ASN A 88 5 ? 3 HELX_P HELX_P6 AA6 LYS A 89 ? PHE A 97 ? LYS A 89 PHE A 97 1 ? 9 HELX_P HELX_P7 AA7 ARG A 105 ? ARG A 116 ? ARG A 105 ARG A 116 1 ? 12 HELX_P HELX_P8 AA8 GLN A 141 ? ALA A 143 ? GLN A 141 ALA A 143 5 ? 3 HELX_P HELX_P9 AA9 GLU A 144 ? GLU A 154 ? GLU A 144 GLU A 154 1 ? 11 HELX_P HELX_P10 AB1 GLU A 172 ? TYR A 194 ? GLU A 172 TYR A 194 1 ? 23 HELX_P HELX_P11 AB2 ASP A 207 ? GLY A 215 ? ASP A 207 GLY A 215 1 ? 9 HELX_P HELX_P12 AB3 GLY A 222 ? GLY A 227 ? GLY A 222 GLY A 227 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA1 7 8 ? parallel AA1 8 9 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 30 ? VAL A 34 ? THR A 30 VAL A 34 AA1 2 GLN A 53 ? GLU A 56 ? GLN A 53 GLU A 56 AA1 3 GLU A 78 ? PHE A 81 ? GLU A 78 PHE A 81 AA1 4 TRP A 99 ? ILE A 103 ? TRP A 99 ILE A 103 AA1 5 LEU A 123 ? ILE A 129 ? LEU A 123 ILE A 129 AA1 6 LEU A 158 ? ALA A 165 ? LEU A 158 ALA A 165 AA1 7 THR A 199 ? SER A 201 ? THR A 199 SER A 201 AA1 8 MET A 218 ? ILE A 221 ? MET A 218 ILE A 221 AA1 9 THR A 30 ? VAL A 34 ? THR A 30 VAL A 34 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ALA A 33 ? N ALA A 33 O GLY A 55 ? O GLY A 55 AA1 2 3 N PHE A 54 ? N PHE A 54 O HIS A 80 ? O HIS A 80 AA1 3 4 N PHE A 81 ? N PHE A 81 O TRP A 99 ? O TRP A 99 AA1 4 5 N CYS A 100 ? N CYS A 100 O LEU A 126 ? O LEU A 126 AA1 5 6 N ILE A 129 ? N ILE A 129 O MET A 164 ? O MET A 164 AA1 6 7 N LEU A 163 ? N LEU A 163 O SER A 201 ? O SER A 201 AA1 7 8 O LEU A 200 ? O LEU A 200 N MET A 218 ? N MET A 218 AA1 8 9 O ILE A 221 ? O ILE A 221 N VAL A 34 ? N VAL A 34 # _atom_sites.entry_id 7UB4 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008012 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008012 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012035 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASN 2 2 ? ? ? A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 GLN 10 10 10 GLN GLN A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 ARG 12 12 12 ARG ARG A . n A 1 13 ASP 13 13 13 ASP ASP A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 THR 37 37 37 THR THR A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 PHE 54 54 54 PHE PHE A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 THR 75 75 75 THR THR A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 TRP 79 79 79 TRP TRP A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 PHE 97 97 97 PHE PHE A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 TRP 99 99 99 TRP TRP A . n A 1 100 CYS 100 100 100 CYS CYS A . n A 1 101 HIS 101 101 101 HIS HIS A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 ARG 105 105 105 ARG ARG A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 ASN 113 113 113 ASN ASN A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 ARG 116 116 116 ARG ARG A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 ALA 118 118 118 ALA ALA A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 PRO 121 121 121 PRO PRO A . n A 1 122 PRO 122 122 122 PRO PRO A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 GLN 128 128 128 GLN GLN A . n A 1 129 ILE 129 129 129 ILE ILE A . n A 1 130 ASN 130 130 130 ASN ASN A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 ASN 135 135 135 ASN ASN A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 GLN 141 141 141 GLN GLN A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 ASP 146 146 146 ASP ASP A . n A 1 147 GLU 147 147 147 GLU GLU A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 PRO 156 156 156 PRO PRO A . n A 1 157 ARG 157 157 157 ARG ARG A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 LEU 160 160 160 LEU LEU A . n A 1 161 ARG 161 161 161 ARG ARG A . n A 1 162 GLY 162 162 162 GLY GLY A . n A 1 163 LEU 163 163 163 LEU LEU A . n A 1 164 MET 164 164 164 MET MET A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 ILE 166 166 166 ILE ILE A . n A 1 167 PRO 167 167 167 PRO PRO A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 PRO 169 169 169 PRO PRO A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 SER 171 171 171 SER SER A . n A 1 172 GLU 172 172 172 GLU GLU A . n A 1 173 TYR 173 173 173 TYR TYR A . n A 1 174 VAL 174 174 174 VAL VAL A . n A 1 175 ARG 175 175 175 ARG ARG A . n A 1 176 GLN 176 176 176 GLN GLN A . n A 1 177 PHE 177 177 177 PHE PHE A . n A 1 178 GLU 178 178 178 GLU GLU A . n A 1 179 VAL 179 179 179 VAL VAL A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 ARG 181 181 181 ARG ARG A . n A 1 182 GLN 182 182 182 GLN GLN A . n A 1 183 MET 183 183 183 MET MET A . n A 1 184 ALA 184 184 184 ALA ALA A . n A 1 185 VAL 185 185 185 VAL VAL A . n A 1 186 ALA 186 186 186 ALA ALA A . n A 1 187 PHE 187 187 187 PHE PHE A . n A 1 188 ALA 188 188 188 ALA ALA A . n A 1 189 GLY 189 189 189 GLY GLY A . n A 1 190 LEU 190 190 190 LEU LEU A . n A 1 191 LYS 191 191 191 LYS LYS A . n A 1 192 THR 192 192 192 THR THR A . n A 1 193 ARG 193 193 193 ARG ARG A . n A 1 194 TYR 194 194 194 TYR TYR A . n A 1 195 PRO 195 195 195 PRO PRO A . n A 1 196 HIS 196 196 196 HIS HIS A . n A 1 197 ILE 197 197 197 ILE ILE A . n A 1 198 ASP 198 198 198 ASP ASP A . n A 1 199 THR 199 199 199 THR THR A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 SER 201 201 201 SER SER A . n A 1 202 LEU 202 202 202 LEU LEU A . n A 1 203 GLY 203 203 203 GLY GLY A . n A 1 204 MET 204 204 204 MET MET A . n A 1 205 SER 205 205 205 SER SER A . n A 1 206 ASP 206 206 206 ASP ASP A . n A 1 207 ASP 207 207 207 ASP ASP A . n A 1 208 MET 208 208 208 MET MET A . n A 1 209 GLU 209 209 209 GLU GLU A . n A 1 210 ALA 210 210 210 ALA ALA A . n A 1 211 ALA 211 211 211 ALA ALA A . n A 1 212 ILE 212 212 212 ILE ILE A . n A 1 213 ALA 213 213 213 ALA ALA A . n A 1 214 ALA 214 214 214 ALA ALA A . n A 1 215 GLY 215 215 215 GLY GLY A . n A 1 216 SER 216 216 216 SER SER A . n A 1 217 THR 217 217 217 THR THR A . n A 1 218 MET 218 218 218 MET MET A . n A 1 219 VAL 219 219 219 VAL VAL A . n A 1 220 ARG 220 220 220 ARG ARG A . n A 1 221 ILE 221 221 221 ILE ILE A . n A 1 222 GLY 222 222 222 GLY GLY A . n A 1 223 THR 223 223 223 THR THR A . n A 1 224 ALA 224 224 224 ALA ALA A . n A 1 225 ILE 225 225 225 ILE ILE A . n A 1 226 PHE 226 226 226 PHE PHE A . n A 1 227 GLY 227 227 227 GLY GLY A . n A 1 228 ALA 228 228 228 ALA ALA A . n A 1 229 ARG 229 229 ? ? ? A . n A 1 230 ASP 230 230 ? ? ? A . n A 1 231 TYR 231 231 ? ? ? A . n A 1 232 SER 232 232 ? ? ? A . n A 1 233 ALA 233 233 ? ? ? A . n A 1 234 ALA 234 234 ? ? ? A . n # _pdbx_contact_author.id 3 _pdbx_contact_author.email msafo@vcu.edu _pdbx_contact_author.name_first Martin _pdbx_contact_author.name_last Safo _pdbx_contact_author.name_mi K. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-9536-1743 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PLP 1 301 306 PLP PLP A . C 2 PLP 1 302 308 PLP PLP A . D 3 HOH 1 401 29 HOH HOH A . D 3 HOH 2 402 21 HOH HOH A . D 3 HOH 3 403 8 HOH HOH A . D 3 HOH 4 404 16 HOH HOH A . D 3 HOH 5 405 5 HOH HOH A . D 3 HOH 6 406 10 HOH HOH A . D 3 HOH 7 407 32 HOH HOH A . D 3 HOH 8 408 12 HOH HOH A . D 3 HOH 9 409 36 HOH HOH A . D 3 HOH 10 410 7 HOH HOH A . D 3 HOH 11 411 31 HOH HOH A . D 3 HOH 12 412 46 HOH HOH A . D 3 HOH 13 413 3 HOH HOH A . D 3 HOH 14 414 19 HOH HOH A . D 3 HOH 15 415 26 HOH HOH A . D 3 HOH 16 416 20 HOH HOH A . D 3 HOH 17 417 4 HOH HOH A . D 3 HOH 18 418 41 HOH HOH A . D 3 HOH 19 419 25 HOH HOH A . D 3 HOH 20 420 28 HOH HOH A . D 3 HOH 21 421 1 HOH HOH A . D 3 HOH 22 422 27 HOH HOH A . D 3 HOH 23 423 35 HOH HOH A . D 3 HOH 24 424 44 HOH HOH A . D 3 HOH 25 425 17 HOH HOH A . D 3 HOH 26 426 38 HOH HOH A . D 3 HOH 27 427 40 HOH HOH A . D 3 HOH 28 428 6 HOH HOH A . D 3 HOH 29 429 30 HOH HOH A . D 3 HOH 30 430 51 HOH HOH A . D 3 HOH 31 431 22 HOH HOH A . D 3 HOH 32 432 9 HOH HOH A . D 3 HOH 33 433 15 HOH HOH A . D 3 HOH 34 434 13 HOH HOH A . D 3 HOH 35 435 2 HOH HOH A . D 3 HOH 36 436 52 HOH HOH A . D 3 HOH 37 437 24 HOH HOH A . D 3 HOH 38 438 18 HOH HOH A . D 3 HOH 39 439 50 HOH HOH A . D 3 HOH 40 440 47 HOH HOH A . D 3 HOH 41 441 34 HOH HOH A . D 3 HOH 42 442 43 HOH HOH A . D 3 HOH 43 443 11 HOH HOH A . D 3 HOH 44 444 49 HOH HOH A . D 3 HOH 45 445 42 HOH HOH A . D 3 HOH 46 446 37 HOH HOH A . D 3 HOH 47 447 45 HOH HOH A . D 3 HOH 48 448 39 HOH HOH A . D 3 HOH 49 449 14 HOH HOH A . D 3 HOH 50 450 23 HOH HOH A . D 3 HOH 51 451 33 HOH HOH A . D 3 HOH 52 452 48 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-03-30 2 'Structure model' 1 1 2022-04-06 3 'Structure model' 1 2 2022-09-28 4 'Structure model' 1 3 2022-10-26 5 'Structure model' 1 4 2022-11-09 6 'Structure model' 1 5 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Structure summary' 4 3 'Structure model' 'Database references' 5 4 'Structure model' 'Database references' 6 5 'Structure model' 'Database references' 7 6 'Structure model' 'Data collection' 8 6 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' audit_author 2 2 'Structure model' citation_author 3 2 'Structure model' pdbx_audit_support 4 3 'Structure model' citation_author 5 4 'Structure model' citation 6 4 'Structure model' citation_author 7 5 'Structure model' citation 8 6 'Structure model' chem_comp_atom 9 6 'Structure model' chem_comp_bond 10 6 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation_author.name' 2 3 'Structure model' '_citation_author.name' 3 4 'Structure model' '_citation.country' 4 4 'Structure model' '_citation.journal_abbrev' 5 4 'Structure model' '_citation.journal_id_ASTM' 6 4 'Structure model' '_citation.journal_id_CSD' 7 4 'Structure model' '_citation.journal_id_ISSN' 8 4 'Structure model' '_citation.page_first' 9 4 'Structure model' '_citation.page_last' 10 4 'Structure model' '_citation.pdbx_database_id_DOI' 11 4 'Structure model' '_citation.pdbx_database_id_PubMed' 12 4 'Structure model' '_citation.title' 13 4 'Structure model' '_citation.year' 14 5 'Structure model' '_citation.journal_volume' 15 5 'Structure model' '_citation.title' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.13_2998 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.32 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? CrysalisPro ? ? ? 41.64.69a 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 7UB4 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 37 ? ? 70.43 -15.20 2 1 SER A 132 ? ? -157.59 26.20 3 1 HIS A 196 ? ? 37.05 48.44 4 1 ASP A 198 ? ? -144.45 10.19 5 1 MET A 204 ? ? -128.74 -165.28 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASN 2 ? A ASN 2 3 1 Y 1 A ARG 229 ? A ARG 229 4 1 Y 1 A ASP 230 ? A ASP 230 5 1 Y 1 A TYR 231 ? A TYR 231 6 1 Y 1 A SER 232 ? A SER 232 7 1 Y 1 A ALA 233 ? A ALA 233 8 1 Y 1 A ALA 234 ? A ALA 234 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PLP N1 N Y N 273 PLP C2 C Y N 274 PLP C2A C N N 275 PLP C3 C Y N 276 PLP O3 O N N 277 PLP C4 C Y N 278 PLP C4A C N N 279 PLP O4A O N N 280 PLP C5 C Y N 281 PLP C6 C Y N 282 PLP C5A C N N 283 PLP O4P O N N 284 PLP P P N N 285 PLP O1P O N N 286 PLP O2P O N N 287 PLP O3P O N N 288 PLP H2A1 H N N 289 PLP H2A2 H N N 290 PLP H2A3 H N N 291 PLP HO3 H N N 292 PLP H4A H N N 293 PLP H6 H N N 294 PLP H5A1 H N N 295 PLP H5A2 H N N 296 PLP HOP2 H N N 297 PLP HOP3 H N N 298 PRO N N N N 299 PRO CA C N S 300 PRO C C N N 301 PRO O O N N 302 PRO CB C N N 303 PRO CG C N N 304 PRO CD C N N 305 PRO OXT O N N 306 PRO H H N N 307 PRO HA H N N 308 PRO HB2 H N N 309 PRO HB3 H N N 310 PRO HG2 H N N 311 PRO HG3 H N N 312 PRO HD2 H N N 313 PRO HD3 H N N 314 PRO HXT H N N 315 SER N N N N 316 SER CA C N S 317 SER C C N N 318 SER O O N N 319 SER CB C N N 320 SER OG O N N 321 SER OXT O N N 322 SER H H N N 323 SER H2 H N N 324 SER HA H N N 325 SER HB2 H N N 326 SER HB3 H N N 327 SER HG H N N 328 SER HXT H N N 329 THR N N N N 330 THR CA C N S 331 THR C C N N 332 THR O O N N 333 THR CB C N R 334 THR OG1 O N N 335 THR CG2 C N N 336 THR OXT O N N 337 THR H H N N 338 THR H2 H N N 339 THR HA H N N 340 THR HB H N N 341 THR HG1 H N N 342 THR HG21 H N N 343 THR HG22 H N N 344 THR HG23 H N N 345 THR HXT H N N 346 TRP N N N N 347 TRP CA C N S 348 TRP C C N N 349 TRP O O N N 350 TRP CB C N N 351 TRP CG C Y N 352 TRP CD1 C Y N 353 TRP CD2 C Y N 354 TRP NE1 N Y N 355 TRP CE2 C Y N 356 TRP CE3 C Y N 357 TRP CZ2 C Y N 358 TRP CZ3 C Y N 359 TRP CH2 C Y N 360 TRP OXT O N N 361 TRP H H N N 362 TRP H2 H N N 363 TRP HA H N N 364 TRP HB2 H N N 365 TRP HB3 H N N 366 TRP HD1 H N N 367 TRP HE1 H N N 368 TRP HE3 H N N 369 TRP HZ2 H N N 370 TRP HZ3 H N N 371 TRP HH2 H N N 372 TRP HXT H N N 373 TYR N N N N 374 TYR CA C N S 375 TYR C C N N 376 TYR O O N N 377 TYR CB C N N 378 TYR CG C Y N 379 TYR CD1 C Y N 380 TYR CD2 C Y N 381 TYR CE1 C Y N 382 TYR CE2 C Y N 383 TYR CZ C Y N 384 TYR OH O N N 385 TYR OXT O N N 386 TYR H H N N 387 TYR H2 H N N 388 TYR HA H N N 389 TYR HB2 H N N 390 TYR HB3 H N N 391 TYR HD1 H N N 392 TYR HD2 H N N 393 TYR HE1 H N N 394 TYR HE2 H N N 395 TYR HH H N N 396 TYR HXT H N N 397 VAL N N N N 398 VAL CA C N S 399 VAL C C N N 400 VAL O O N N 401 VAL CB C N N 402 VAL CG1 C N N 403 VAL CG2 C N N 404 VAL OXT O N N 405 VAL H H N N 406 VAL H2 H N N 407 VAL HA H N N 408 VAL HB H N N 409 VAL HG11 H N N 410 VAL HG12 H N N 411 VAL HG13 H N N 412 VAL HG21 H N N 413 VAL HG22 H N N 414 VAL HG23 H N N 415 VAL HXT H N N 416 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PLP N1 C2 doub Y N 260 PLP N1 C6 sing Y N 261 PLP C2 C2A sing N N 262 PLP C2 C3 sing Y N 263 PLP C2A H2A1 sing N N 264 PLP C2A H2A2 sing N N 265 PLP C2A H2A3 sing N N 266 PLP C3 O3 sing N N 267 PLP C3 C4 doub Y N 268 PLP O3 HO3 sing N N 269 PLP C4 C4A sing N N 270 PLP C4 C5 sing Y N 271 PLP C4A O4A doub N N 272 PLP C4A H4A sing N N 273 PLP C5 C6 doub Y N 274 PLP C5 C5A sing N N 275 PLP C6 H6 sing N N 276 PLP C5A O4P sing N N 277 PLP C5A H5A1 sing N N 278 PLP C5A H5A2 sing N N 279 PLP O4P P sing N N 280 PLP P O1P doub N N 281 PLP P O2P sing N N 282 PLP P O3P sing N N 283 PLP O2P HOP2 sing N N 284 PLP O3P HOP3 sing N N 285 PRO N CA sing N N 286 PRO N CD sing N N 287 PRO N H sing N N 288 PRO CA C sing N N 289 PRO CA CB sing N N 290 PRO CA HA sing N N 291 PRO C O doub N N 292 PRO C OXT sing N N 293 PRO CB CG sing N N 294 PRO CB HB2 sing N N 295 PRO CB HB3 sing N N 296 PRO CG CD sing N N 297 PRO CG HG2 sing N N 298 PRO CG HG3 sing N N 299 PRO CD HD2 sing N N 300 PRO CD HD3 sing N N 301 PRO OXT HXT sing N N 302 SER N CA sing N N 303 SER N H sing N N 304 SER N H2 sing N N 305 SER CA C sing N N 306 SER CA CB sing N N 307 SER CA HA sing N N 308 SER C O doub N N 309 SER C OXT sing N N 310 SER CB OG sing N N 311 SER CB HB2 sing N N 312 SER CB HB3 sing N N 313 SER OG HG sing N N 314 SER OXT HXT sing N N 315 THR N CA sing N N 316 THR N H sing N N 317 THR N H2 sing N N 318 THR CA C sing N N 319 THR CA CB sing N N 320 THR CA HA sing N N 321 THR C O doub N N 322 THR C OXT sing N N 323 THR CB OG1 sing N N 324 THR CB CG2 sing N N 325 THR CB HB sing N N 326 THR OG1 HG1 sing N N 327 THR CG2 HG21 sing N N 328 THR CG2 HG22 sing N N 329 THR CG2 HG23 sing N N 330 THR OXT HXT sing N N 331 TRP N CA sing N N 332 TRP N H sing N N 333 TRP N H2 sing N N 334 TRP CA C sing N N 335 TRP CA CB sing N N 336 TRP CA HA sing N N 337 TRP C O doub N N 338 TRP C OXT sing N N 339 TRP CB CG sing N N 340 TRP CB HB2 sing N N 341 TRP CB HB3 sing N N 342 TRP CG CD1 doub Y N 343 TRP CG CD2 sing Y N 344 TRP CD1 NE1 sing Y N 345 TRP CD1 HD1 sing N N 346 TRP CD2 CE2 doub Y N 347 TRP CD2 CE3 sing Y N 348 TRP NE1 CE2 sing Y N 349 TRP NE1 HE1 sing N N 350 TRP CE2 CZ2 sing Y N 351 TRP CE3 CZ3 doub Y N 352 TRP CE3 HE3 sing N N 353 TRP CZ2 CH2 doub Y N 354 TRP CZ2 HZ2 sing N N 355 TRP CZ3 CH2 sing Y N 356 TRP CZ3 HZ3 sing N N 357 TRP CH2 HH2 sing N N 358 TRP OXT HXT sing N N 359 TYR N CA sing N N 360 TYR N H sing N N 361 TYR N H2 sing N N 362 TYR CA C sing N N 363 TYR CA CB sing N N 364 TYR CA HA sing N N 365 TYR C O doub N N 366 TYR C OXT sing N N 367 TYR CB CG sing N N 368 TYR CB HB2 sing N N 369 TYR CB HB3 sing N N 370 TYR CG CD1 doub Y N 371 TYR CG CD2 sing Y N 372 TYR CD1 CE1 sing Y N 373 TYR CD1 HD1 sing N N 374 TYR CD2 CE2 doub Y N 375 TYR CD2 HD2 sing N N 376 TYR CE1 CZ doub Y N 377 TYR CE1 HE1 sing N N 378 TYR CE2 CZ sing Y N 379 TYR CE2 HE2 sing N N 380 TYR CZ OH sing N N 381 TYR OH HH sing N N 382 TYR OXT HXT sing N N 383 VAL N CA sing N N 384 VAL N H sing N N 385 VAL N H2 sing N N 386 VAL CA C sing N N 387 VAL CA CB sing N N 388 VAL CA HA sing N N 389 VAL C O doub N N 390 VAL C OXT sing N N 391 VAL CB CG1 sing N N 392 VAL CB CG2 sing N N 393 VAL CB HB sing N N 394 VAL CG1 HG11 sing N N 395 VAL CG1 HG12 sing N N 396 VAL CG1 HG13 sing N N 397 VAL CG2 HG21 sing N N 398 VAL CG2 HG22 sing N N 399 VAL CG2 HG23 sing N N 400 VAL OXT HXT sing N N 401 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' R01GM129793 1 'Other government' 'United States' S10OD021756 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id PLP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id PLP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "PYRIDOXAL-5'-PHOSPHATE" PLP 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1W8G _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'native gel electrophoresis' _pdbx_struct_assembly_auth_evidence.details ? #