data_7UC3 # _entry.id 7UC3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7UC3 pdb_00007uc3 10.2210/pdb7uc3/pdb WWPDB D_1000263924 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-03-22 2 'Structure model' 1 1 2023-10-25 3 'Structure model' 1 2 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' 3 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model 4 3 'Structure model' pdbx_entry_details 5 3 'Structure model' pdbx_modification_feature # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 3 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7UC3 _pdbx_database_status.recvd_initial_deposition_date 2022-03-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 3 _pdbx_contact_author.email p.young@auckland.ac.nz _pdbx_contact_author.name_first Paul _pdbx_contact_author.name_last Young _pdbx_contact_author.name_mi G _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7325-1869 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wardega, J.K.' 1 ? 'Squire, C.J.' 2 ? 'Young, P.G.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Intramolecular ester bond-containing repeat domain from G. bergeri adhesin' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wardega, J.K.' 1 ? primary 'Squire, C.J.' 2 ? primary 'Young, P.G.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Adhesin 17036.812 1 ? ? 'Repeat domain' ? 2 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 3 water nat water 18.015 153 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GARVTNKKIVSSLQTTVEADGQSSTAEKSAEVTENKDGVNVVDTIHYKGLIPKQKYEVVGILYEVKDGKLVDPNKPITIS NGTGEYTVSDSGEGEWKLNFGKIDGVEARKSYVVYEEVTSVENLVDTDNDGNPDKKHEVEHKDPKDKSQTFVVKP ; _entity_poly.pdbx_seq_one_letter_code_can ;GARVTNKKIVSSLQTTVEADGQSSTAEKSAEVTENKDGVNVVDTIHYKGLIPKQKYEVVGILYEVKDGKLVDPNKPITIS NGTGEYTVSDSGEGEWKLNFGKIDGVEARKSYVVYEEVTSVENLVDTDNDGNPDKKHEVEHKDPKDKSQTFVVKP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'MAGNESIUM ION' MG 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 ARG n 1 4 VAL n 1 5 THR n 1 6 ASN n 1 7 LYS n 1 8 LYS n 1 9 ILE n 1 10 VAL n 1 11 SER n 1 12 SER n 1 13 LEU n 1 14 GLN n 1 15 THR n 1 16 THR n 1 17 VAL n 1 18 GLU n 1 19 ALA n 1 20 ASP n 1 21 GLY n 1 22 GLN n 1 23 SER n 1 24 SER n 1 25 THR n 1 26 ALA n 1 27 GLU n 1 28 LYS n 1 29 SER n 1 30 ALA n 1 31 GLU n 1 32 VAL n 1 33 THR n 1 34 GLU n 1 35 ASN n 1 36 LYS n 1 37 ASP n 1 38 GLY n 1 39 VAL n 1 40 ASN n 1 41 VAL n 1 42 VAL n 1 43 ASP n 1 44 THR n 1 45 ILE n 1 46 HIS n 1 47 TYR n 1 48 LYS n 1 49 GLY n 1 50 LEU n 1 51 ILE n 1 52 PRO n 1 53 LYS n 1 54 GLN n 1 55 LYS n 1 56 TYR n 1 57 GLU n 1 58 VAL n 1 59 VAL n 1 60 GLY n 1 61 ILE n 1 62 LEU n 1 63 TYR n 1 64 GLU n 1 65 VAL n 1 66 LYS n 1 67 ASP n 1 68 GLY n 1 69 LYS n 1 70 LEU n 1 71 VAL n 1 72 ASP n 1 73 PRO n 1 74 ASN n 1 75 LYS n 1 76 PRO n 1 77 ILE n 1 78 THR n 1 79 ILE n 1 80 SER n 1 81 ASN n 1 82 GLY n 1 83 THR n 1 84 GLY n 1 85 GLU n 1 86 TYR n 1 87 THR n 1 88 VAL n 1 89 SER n 1 90 ASP n 1 91 SER n 1 92 GLY n 1 93 GLU n 1 94 GLY n 1 95 GLU n 1 96 TRP n 1 97 LYS n 1 98 LEU n 1 99 ASN n 1 100 PHE n 1 101 GLY n 1 102 LYS n 1 103 ILE n 1 104 ASP n 1 105 GLY n 1 106 VAL n 1 107 GLU n 1 108 ALA n 1 109 ARG n 1 110 LYS n 1 111 SER n 1 112 TYR n 1 113 VAL n 1 114 VAL n 1 115 TYR n 1 116 GLU n 1 117 GLU n 1 118 VAL n 1 119 THR n 1 120 SER n 1 121 VAL n 1 122 GLU n 1 123 ASN n 1 124 LEU n 1 125 VAL n 1 126 ASP n 1 127 THR n 1 128 ASP n 1 129 ASN n 1 130 ASP n 1 131 GLY n 1 132 ASN n 1 133 PRO n 1 134 ASP n 1 135 LYS n 1 136 LYS n 1 137 HIS n 1 138 GLU n 1 139 VAL n 1 140 GLU n 1 141 HIS n 1 142 LYS n 1 143 ASP n 1 144 PRO n 1 145 LYS n 1 146 ASP n 1 147 LYS n 1 148 SER n 1 149 GLN n 1 150 THR n 1 151 PHE n 1 152 VAL n 1 153 VAL n 1 154 LYS n 1 155 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 155 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene HMPREF1983_01328 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Gemella bergeri' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 84136 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pProEXHta _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 ARG 3 3 ? ? ? A . n A 1 4 VAL 4 4 ? ? ? A . n A 1 5 THR 5 5 ? ? ? A . n A 1 6 ASN 6 6 ? ? ? A . n A 1 7 LYS 7 7 ? ? ? A . n A 1 8 LYS 8 8 ? ? ? A . n A 1 9 ILE 9 9 ? ? ? A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 HIS 46 46 46 HIS HIS A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ILE 51 51 51 ILE ILE A . n A 1 52 PRO 52 52 52 PRO PRO A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 ASP 72 72 72 ASP ASP A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 ASN 81 81 81 ASN ASN A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 GLU 85 85 85 GLU GLU A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 GLU 93 93 93 GLU GLU A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 TRP 96 96 96 TRP TRP A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 TYR 112 112 112 TYR TYR A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 TYR 115 115 115 TYR TYR A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 GLU 117 117 117 GLU GLU A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 THR 119 119 119 THR THR A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 VAL 121 121 121 VAL VAL A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 ASN 123 123 123 ASN ASN A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 ASN 129 129 129 ASN ASN A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 PRO 133 133 133 PRO PRO A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 HIS 137 137 137 HIS HIS A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 VAL 139 139 139 VAL VAL A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 HIS 141 141 141 HIS HIS A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 ASP 143 143 143 ASP ASP A . n A 1 144 PRO 144 144 144 PRO PRO A . n A 1 145 LYS 145 145 145 LYS LYS A . n A 1 146 ASP 146 146 146 ASP ASP A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 SER 148 148 148 SER SER A . n A 1 149 GLN 149 149 149 GLN GLN A . n A 1 150 THR 150 150 150 THR THR A . n A 1 151 PHE 151 151 151 PHE PHE A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 LYS 154 154 154 LYS LYS A . n A 1 155 PRO 155 155 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MG 1 201 1 MG MG A . C 3 HOH 1 301 132 HOH HOH A . C 3 HOH 2 302 41 HOH HOH A . C 3 HOH 3 303 9 HOH HOH A . C 3 HOH 4 304 75 HOH HOH A . C 3 HOH 5 305 57 HOH HOH A . C 3 HOH 6 306 116 HOH HOH A . C 3 HOH 7 307 114 HOH HOH A . C 3 HOH 8 308 88 HOH HOH A . C 3 HOH 9 309 123 HOH HOH A . C 3 HOH 10 310 1 HOH HOH A . C 3 HOH 11 311 83 HOH HOH A . C 3 HOH 12 312 81 HOH HOH A . C 3 HOH 13 313 62 HOH HOH A . C 3 HOH 14 314 124 HOH HOH A . C 3 HOH 15 315 76 HOH HOH A . C 3 HOH 16 316 68 HOH HOH A . C 3 HOH 17 317 3 HOH HOH A . C 3 HOH 18 318 129 HOH HOH A . C 3 HOH 19 319 153 HOH HOH A . C 3 HOH 20 320 16 HOH HOH A . C 3 HOH 21 321 92 HOH HOH A . C 3 HOH 22 322 6 HOH HOH A . C 3 HOH 23 323 53 HOH HOH A . C 3 HOH 24 324 94 HOH HOH A . C 3 HOH 25 325 39 HOH HOH A . C 3 HOH 26 326 49 HOH HOH A . C 3 HOH 27 327 61 HOH HOH A . C 3 HOH 28 328 71 HOH HOH A . C 3 HOH 29 329 7 HOH HOH A . C 3 HOH 30 330 142 HOH HOH A . C 3 HOH 31 331 10 HOH HOH A . C 3 HOH 32 332 108 HOH HOH A . C 3 HOH 33 333 91 HOH HOH A . C 3 HOH 34 334 111 HOH HOH A . C 3 HOH 35 335 35 HOH HOH A . C 3 HOH 36 336 70 HOH HOH A . C 3 HOH 37 337 29 HOH HOH A . C 3 HOH 38 338 87 HOH HOH A . C 3 HOH 39 339 85 HOH HOH A . C 3 HOH 40 340 128 HOH HOH A . C 3 HOH 41 341 67 HOH HOH A . C 3 HOH 42 342 45 HOH HOH A . C 3 HOH 43 343 55 HOH HOH A . C 3 HOH 44 344 145 HOH HOH A . C 3 HOH 45 345 12 HOH HOH A . C 3 HOH 46 346 125 HOH HOH A . C 3 HOH 47 347 78 HOH HOH A . C 3 HOH 48 348 113 HOH HOH A . C 3 HOH 49 349 73 HOH HOH A . C 3 HOH 50 350 24 HOH HOH A . C 3 HOH 51 351 26 HOH HOH A . C 3 HOH 52 352 47 HOH HOH A . C 3 HOH 53 353 77 HOH HOH A . C 3 HOH 54 354 34 HOH HOH A . C 3 HOH 55 355 103 HOH HOH A . C 3 HOH 56 356 137 HOH HOH A . C 3 HOH 57 357 152 HOH HOH A . C 3 HOH 58 358 15 HOH HOH A . C 3 HOH 59 359 65 HOH HOH A . C 3 HOH 60 360 25 HOH HOH A . C 3 HOH 61 361 110 HOH HOH A . C 3 HOH 62 362 134 HOH HOH A . C 3 HOH 63 363 98 HOH HOH A . C 3 HOH 64 364 44 HOH HOH A . C 3 HOH 65 365 104 HOH HOH A . C 3 HOH 66 366 11 HOH HOH A . C 3 HOH 67 367 93 HOH HOH A . C 3 HOH 68 368 59 HOH HOH A . C 3 HOH 69 369 130 HOH HOH A . C 3 HOH 70 370 112 HOH HOH A . C 3 HOH 71 371 127 HOH HOH A . C 3 HOH 72 372 48 HOH HOH A . C 3 HOH 73 373 117 HOH HOH A . C 3 HOH 74 374 120 HOH HOH A . C 3 HOH 75 375 30 HOH HOH A . C 3 HOH 76 376 31 HOH HOH A . C 3 HOH 77 377 133 HOH HOH A . C 3 HOH 78 378 90 HOH HOH A . C 3 HOH 79 379 131 HOH HOH A . C 3 HOH 80 380 23 HOH HOH A . C 3 HOH 81 381 42 HOH HOH A . C 3 HOH 82 382 40 HOH HOH A . C 3 HOH 83 383 28 HOH HOH A . C 3 HOH 84 384 135 HOH HOH A . C 3 HOH 85 385 101 HOH HOH A . C 3 HOH 86 386 37 HOH HOH A . C 3 HOH 87 387 118 HOH HOH A . C 3 HOH 88 388 69 HOH HOH A . C 3 HOH 89 389 22 HOH HOH A . C 3 HOH 90 390 89 HOH HOH A . C 3 HOH 91 391 107 HOH HOH A . C 3 HOH 92 392 20 HOH HOH A . C 3 HOH 93 393 52 HOH HOH A . C 3 HOH 94 394 21 HOH HOH A . C 3 HOH 95 395 5 HOH HOH A . C 3 HOH 96 396 17 HOH HOH A . C 3 HOH 97 397 106 HOH HOH A . C 3 HOH 98 398 51 HOH HOH A . C 3 HOH 99 399 138 HOH HOH A . C 3 HOH 100 400 33 HOH HOH A . C 3 HOH 101 401 109 HOH HOH A . C 3 HOH 102 402 126 HOH HOH A . C 3 HOH 103 403 27 HOH HOH A . C 3 HOH 104 404 99 HOH HOH A . C 3 HOH 105 405 46 HOH HOH A . C 3 HOH 106 406 38 HOH HOH A . C 3 HOH 107 407 97 HOH HOH A . C 3 HOH 108 408 36 HOH HOH A . C 3 HOH 109 409 80 HOH HOH A . C 3 HOH 110 410 72 HOH HOH A . C 3 HOH 111 411 140 HOH HOH A . C 3 HOH 112 412 143 HOH HOH A . C 3 HOH 113 413 4 HOH HOH A . C 3 HOH 114 414 60 HOH HOH A . C 3 HOH 115 415 18 HOH HOH A . C 3 HOH 116 416 43 HOH HOH A . C 3 HOH 117 417 32 HOH HOH A . C 3 HOH 118 418 19 HOH HOH A . C 3 HOH 119 419 122 HOH HOH A . C 3 HOH 120 420 14 HOH HOH A . C 3 HOH 121 421 56 HOH HOH A . C 3 HOH 122 422 86 HOH HOH A . C 3 HOH 123 423 54 HOH HOH A . C 3 HOH 124 424 139 HOH HOH A . C 3 HOH 125 425 136 HOH HOH A . C 3 HOH 126 426 79 HOH HOH A . C 3 HOH 127 427 13 HOH HOH A . C 3 HOH 128 428 105 HOH HOH A . C 3 HOH 129 429 58 HOH HOH A . C 3 HOH 130 430 50 HOH HOH A . C 3 HOH 131 431 119 HOH HOH A . C 3 HOH 132 432 151 HOH HOH A . C 3 HOH 133 433 63 HOH HOH A . C 3 HOH 134 434 141 HOH HOH A . C 3 HOH 135 435 66 HOH HOH A . C 3 HOH 136 436 144 HOH HOH A . C 3 HOH 137 437 82 HOH HOH A . C 3 HOH 138 438 148 HOH HOH A . C 3 HOH 139 439 121 HOH HOH A . C 3 HOH 140 440 149 HOH HOH A . C 3 HOH 141 441 2 HOH HOH A . C 3 HOH 142 442 8 HOH HOH A . C 3 HOH 143 443 84 HOH HOH A . C 3 HOH 144 444 115 HOH HOH A . C 3 HOH 145 445 147 HOH HOH A . C 3 HOH 146 446 74 HOH HOH A . C 3 HOH 147 447 95 HOH HOH A . C 3 HOH 148 448 100 HOH HOH A . C 3 HOH 149 449 102 HOH HOH A . C 3 HOH 150 450 96 HOH HOH A . C 3 HOH 151 451 64 HOH HOH A . C 3 HOH 152 452 146 HOH HOH A . C 3 HOH 153 453 150 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 34 ? CG ? A GLU 34 CG 2 1 Y 1 A GLU 34 ? CD ? A GLU 34 CD 3 1 Y 1 A GLU 34 ? OE1 ? A GLU 34 OE1 4 1 Y 1 A GLU 34 ? OE2 ? A GLU 34 OE2 5 1 Y 1 A LYS 36 ? CG ? A LYS 36 CG 6 1 Y 1 A LYS 36 ? CD ? A LYS 36 CD 7 1 Y 1 A LYS 36 ? CE ? A LYS 36 CE 8 1 Y 1 A LYS 36 ? NZ ? A LYS 36 NZ 9 1 Y 1 A ASP 37 ? CG ? A ASP 37 CG 10 1 Y 1 A ASP 37 ? OD1 ? A ASP 37 OD1 11 1 Y 1 A ASP 37 ? OD2 ? A ASP 37 OD2 12 1 Y 1 A LYS 102 ? CG ? A LYS 102 CG 13 1 Y 1 A LYS 102 ? CD ? A LYS 102 CD 14 1 Y 1 A LYS 102 ? CE ? A LYS 102 CE 15 1 Y 1 A LYS 102 ? NZ ? A LYS 102 NZ 16 1 Y 1 A ARG 109 ? CG ? A ARG 109 CG 17 1 Y 1 A ARG 109 ? CD ? A ARG 109 CD 18 1 Y 1 A ARG 109 ? NE ? A ARG 109 NE 19 1 Y 1 A ARG 109 ? CZ ? A ARG 109 CZ 20 1 Y 1 A ARG 109 ? NH1 ? A ARG 109 NH1 21 1 Y 1 A ARG 109 ? NH2 ? A ARG 109 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.594 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7UC3 _cell.details ? _cell.formula_units_Z ? _cell.length_a 31.542 _cell.length_a_esd ? _cell.length_b 46.647 _cell.length_b_esd ? _cell.length_c 48.536 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 2 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7UC3 _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7UC3 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.10 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 41.31 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M NaCl, 0.1 M Bis-Tris Cl, and 25% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-07-16 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97780 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97780 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX2 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7UC3 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.442 _reflns.d_resolution_low 48.533 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 24975 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 26.5 _reflns.pdbx_Rmerge_I_obs 0.067 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 22.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.52 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.068 _reflns.pdbx_Rpim_I_all 0.013 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.45 _reflns_shell.d_res_low 1.48 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 713 _reflns_shell.percent_possible_all 58.4 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 16.7 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.354 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.479 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.569 _refine.aniso_B[1][2] -0.000 _refine.aniso_B[1][3] -2.710 _refine.aniso_B[2][2] 2.654 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] -3.166 _refine.B_iso_max ? _refine.B_iso_mean 20.210 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.966 _refine.correlation_coeff_Fo_to_Fc_free 0.943 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7UC3 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.442 _refine.ls_d_res_low 48.533 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 24975 _refine.ls_number_reflns_R_free 1229 _refine.ls_number_reflns_R_work 23746 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.788 _refine.ls_percent_reflns_R_free 4.921 _refine.ls_R_factor_all 0.171 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2226 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1679 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4ni6 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.079 _refine.pdbx_overall_ESU_R_Free 0.076 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 3.055 _refine.overall_SU_ML 0.053 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1101 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 153 _refine_hist.number_atoms_total 1255 _refine_hist.d_res_high 1.442 _refine_hist.d_res_low 48.533 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 0.013 1123 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.016 1033 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.272 1.646 1524 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.288 1.596 2406 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.277 5.000 146 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 41.855 27.551 49 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 11.535 15.000 195 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 0.050 0.200 151 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 0.020 1280 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 208 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.191 0.200 182 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.170 0.200 1015 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.151 0.200 534 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.071 0.200 542 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.115 0.200 111 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.122 0.200 7 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.198 0.200 34 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.140 0.200 14 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 1.355 1.910 581 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.337 1.905 580 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 1.875 2.874 725 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 1.883 2.878 726 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 1.591 2.154 542 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 1.590 2.160 543 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 1.936 3.101 798 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 1.935 3.107 799 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 3.312 23.758 1212 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 3.156 23.445 1196 ? r_lrange_other ? ? 'X-RAY DIFFRACTION' ? 0.839 3.000 2156 ? r_rigid_bond_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.442 1.479 1873 . 83 1554 87.3999 . 0.265 . 0.312 . 0.262 . . . . . 0.202 . 20 . 0.844 0.797 'X-RAY DIFFRACTION' 1.479 1.519 1826 . 83 1690 97.0975 . 0.193 . 0.246 . 0.190 . . . . . 0.155 . 20 . 0.913 0.895 'X-RAY DIFFRACTION' 1.519 1.563 1796 . 82 1673 97.7171 . 0.170 . 0.229 . 0.168 . . . . . 0.131 . 20 . 0.937 0.911 'X-RAY DIFFRACTION' 1.563 1.612 1720 . 107 1577 97.9070 . 0.160 . 0.214 . 0.156 . . . . . 0.123 . 20 . 0.946 0.942 'X-RAY DIFFRACTION' 1.612 1.664 1683 . 80 1566 97.8015 . 0.142 . 0.213 . 0.138 . . . . . 0.114 . 20 . 0.955 0.941 'X-RAY DIFFRACTION' 1.664 1.723 1602 . 62 1516 98.5019 . 0.134 . 0.274 . 0.129 . . . . . 0.111 . 20 . 0.957 0.926 'X-RAY DIFFRACTION' 1.723 1.788 1551 . 61 1462 98.1947 . 0.178 . 0.208 . 0.177 . . . . . 0.158 . 20 . 0.854 0.828 'X-RAY DIFFRACTION' 1.788 1.861 1533 . 77 1433 98.4997 . 0.194 . 0.222 . 0.193 . . . . . 0.176 . 20 . 0.799 0.707 'X-RAY DIFFRACTION' 1.861 1.943 1446 . 75 1355 98.8935 . 0.141 . 0.209 . 0.138 . . . . . 0.134 . 20 . 0.944 0.935 'X-RAY DIFFRACTION' 1.943 2.038 1367 . 94 1259 98.9759 . 0.134 . 0.188 . 0.130 . . . . . 0.124 . 20 . 0.964 0.955 'X-RAY DIFFRACTION' 2.038 2.148 1326 . 69 1243 98.9442 . 0.145 . 0.201 . 0.143 . . . . . 0.144 . 20 . 0.958 0.943 'X-RAY DIFFRACTION' 2.148 2.278 1236 . 40 1186 99.1909 . 0.153 . 0.188 . 0.152 . . . . . 0.148 . 20 . 0.955 0.957 'X-RAY DIFFRACTION' 2.278 2.435 1196 . 57 1129 99.1639 . 0.163 . 0.276 . 0.158 . . . . . 0.154 . 20 . 0.957 0.926 'X-RAY DIFFRACTION' 2.435 2.629 1089 . 52 1030 99.3572 . 0.177 . 0.225 . 0.175 . . . . . 0.173 . 20 . 0.948 0.939 'X-RAY DIFFRACTION' 2.629 2.879 1015 . 42 970 99.7044 . 0.182 . 0.222 . 0.181 . . . . . 0.179 . 20 . 0.946 0.946 'X-RAY DIFFRACTION' 2.879 3.218 917 . 56 859 99.7819 . 0.175 . 0.224 . 0.171 . . . . . 0.176 . 20 . 0.953 0.939 'X-RAY DIFFRACTION' 3.218 3.713 801 . 40 761 100.0000 . 0.183 . 0.200 . 0.182 . . . . . 0.190 . 20 . 0.960 0.954 'X-RAY DIFFRACTION' 3.713 4.541 693 . 33 660 100.0000 . 0.156 . 0.197 . 0.154 . . . . . 0.166 . 20 . 0.969 0.961 'X-RAY DIFFRACTION' 4.541 6.394 545 . 23 522 100.0000 . 0.189 . 0.331 . 0.185 . . . . . 0.202 . 20 . 0.961 0.903 'X-RAY DIFFRACTION' 6.394 48.533 314 . 13 301 100.0000 . 0.218 . 0.188 . 0.220 . . . . . 0.226 . 20 . 0.926 0.944 # _struct.entry_id 7UC3 _struct.title 'Intramolecular ester bond-containing repeat domain from G. bergeri adhesin' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7UC3 _struct_keywords.text 'Repeat domain, adhesin, intramolecular ester bond, Ig-like fold, CELL ADHESION' _struct_keywords.pdbx_keywords 'CELL ADHESION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code U2Q1B9_9BACL _struct_ref.pdbx_db_accession U2Q1B9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;RVTNKKIVSSLQTTVEADGQSSTAEKSAEVTENKDGVNVVDTIHYKGLIPKQKYEVVGILYEVKDGKLVDPNKPITISNG TGEYTVSDSGEGEWKLNFGKIDGVEARKSYVVYEEVTSVENLVDTDNDGNPDKKHEVEHKDPKDKSQTFVVKP ; _struct_ref.pdbx_align_begin 731 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7UC3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 155 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession U2Q1B9 _struct_ref_seq.db_align_beg 731 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 883 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 155 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7UC3 GLY A 1 ? UNP U2Q1B9 ? ? 'expression tag' 1 1 1 7UC3 ALA A 2 ? UNP U2Q1B9 ? ? 'expression tag' 2 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 146 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id SER _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 148 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 146 _struct_conf.end_auth_comp_id SER _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 148 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A THR 15 OG1 ? ? ? 1_555 A GLN 149 CD ? ? A THR 15 A GLN 149 1_555 ? ? ? ? ? ? ? 1.312 sing ? metalc1 metalc ? ? A ASP 126 OD1 ? ? ? 1_555 B MG . MG ? ? A ASP 126 A MG 201 1_555 ? ? ? ? ? ? ? 2.371 ? ? metalc2 metalc ? ? A ASP 128 OD1 ? ? ? 1_555 B MG . MG ? ? A ASP 128 A MG 201 1_555 ? ? ? ? ? ? ? 2.385 ? ? metalc3 metalc ? ? A ASP 130 OD1 ? ? ? 1_555 B MG . MG ? ? A ASP 130 A MG 201 1_555 ? ? ? ? ? ? ? 2.302 ? ? metalc4 metalc ? ? A ASN 132 O ? ? ? 1_555 B MG . MG ? ? A ASN 132 A MG 201 1_555 ? ? ? ? ? ? ? 2.322 ? ? metalc5 metalc ? ? A ASP 134 OD2 ? ? ? 1_555 B MG . MG ? ? A ASP 134 A MG 201 1_555 ? ? ? ? ? ? ? 2.271 ? ? metalc6 metalc ? ? B MG . MG ? ? ? 1_555 C HOH . O ? ? A MG 201 A HOH 351 1_555 ? ? ? ? ? ? ? 2.500 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 126 ? A ASP 126 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 OD1 ? A ASP 128 ? A ASP 128 ? 1_555 77.0 ? 2 OD1 ? A ASP 126 ? A ASP 126 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 OD1 ? A ASP 130 ? A ASP 130 ? 1_555 91.7 ? 3 OD1 ? A ASP 128 ? A ASP 128 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 OD1 ? A ASP 130 ? A ASP 130 ? 1_555 84.8 ? 4 OD1 ? A ASP 126 ? A ASP 126 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? A ASN 132 ? A ASN 132 ? 1_555 86.4 ? 5 OD1 ? A ASP 128 ? A ASP 128 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? A ASN 132 ? A ASN 132 ? 1_555 160.2 ? 6 OD1 ? A ASP 130 ? A ASP 130 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? A ASN 132 ? A ASN 132 ? 1_555 84.8 ? 7 OD1 ? A ASP 126 ? A ASP 126 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 OD2 ? A ASP 134 ? A ASP 134 ? 1_555 89.7 ? 8 OD1 ? A ASP 128 ? A ASP 128 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 OD2 ? A ASP 134 ? A ASP 134 ? 1_555 93.0 ? 9 OD1 ? A ASP 130 ? A ASP 130 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 OD2 ? A ASP 134 ? A ASP 134 ? 1_555 177.1 ? 10 O ? A ASN 132 ? A ASN 132 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 OD2 ? A ASP 134 ? A ASP 134 ? 1_555 97.8 ? 11 OD1 ? A ASP 126 ? A ASP 126 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? C HOH . ? A HOH 351 ? 1_555 154.5 ? 12 OD1 ? A ASP 128 ? A ASP 128 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? C HOH . ? A HOH 351 ? 1_555 77.6 ? 13 OD1 ? A ASP 130 ? A ASP 130 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? C HOH . ? A HOH 351 ? 1_555 88.6 ? 14 O ? A ASN 132 ? A ASN 132 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? C HOH . ? A HOH 351 ? 1_555 118.9 ? 15 OD2 ? A ASP 134 ? A ASP 134 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O ? C HOH . ? A HOH 351 ? 1_555 89.1 ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id THR _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 15 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id GLN _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 149 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id THR _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 15 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id GLN _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 149 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom OG1 _pdbx_modification_feature.modified_residue_id_linking_atom CD _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Non-standard linkage' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 8 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 8 ? parallel AA2 2 3 ? anti-parallel AA2 2 4 ? anti-parallel AA2 2 5 ? anti-parallel AA2 2 6 ? anti-parallel AA2 6 7 ? anti-parallel AA2 6 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 22 ? SER A 23 ? GLN A 22 SER A 23 AA1 2 SER A 12 ? ALA A 19 ? SER A 12 ALA A 19 AA1 3 VAL A 39 ? LYS A 48 ? VAL A 39 LYS A 48 AA1 4 GLY A 94 ? ILE A 103 ? GLY A 94 ILE A 103 AA2 1 ALA A 30 ? THR A 33 ? ALA A 30 THR A 33 AA2 2 LYS A 55 ? LYS A 66 ? LYS A 55 LYS A 66 AA2 3 LYS A 69 ? LEU A 70 ? LYS A 69 LEU A 70 AA2 4 THR A 78 ? SER A 80 ? THR A 78 SER A 80 AA2 5 TYR A 86 ? THR A 87 ? TYR A 86 THR A 87 AA2 6 SER A 111 ? SER A 120 ? SER A 111 SER A 120 AA2 7 GLU A 138 ? HIS A 141 ? GLU A 138 HIS A 141 AA2 8 THR A 150 ? LYS A 154 ? THR A 150 LYS A 154 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLN A 22 ? O GLN A 22 N ALA A 19 ? N ALA A 19 AA1 2 3 N GLN A 14 ? N GLN A 14 O HIS A 46 ? O HIS A 46 AA1 3 4 N VAL A 39 ? N VAL A 39 O ILE A 103 ? O ILE A 103 AA2 1 8 N VAL A 32 ? N VAL A 32 O LYS A 154 ? O LYS A 154 AA2 2 3 N LYS A 66 ? N LYS A 66 O LYS A 69 ? O LYS A 69 AA2 2 4 N GLY A 60 ? N GLY A 60 O SER A 80 ? O SER A 80 AA2 2 5 N TYR A 56 ? N TYR A 56 O TYR A 86 ? O TYR A 86 AA2 2 6 N GLU A 57 ? N GLU A 57 O THR A 119 ? O THR A 119 AA2 6 7 N VAL A 118 ? N VAL A 118 O VAL A 139 ? O VAL A 139 AA2 6 8 N TYR A 112 ? N TYR A 112 O PHE A 151 ? O PHE A 151 # _pdbx_entry_details.entry_id 7UC3 _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 36 ? ? 78.38 -50.63 2 1 LYS A 53 ? ? 72.33 -4.04 3 1 ASP A 72 ? ? -153.95 66.11 4 1 ARG A 109 ? ? 81.22 5.98 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A ARG 3 ? A ARG 3 4 1 Y 1 A VAL 4 ? A VAL 4 5 1 Y 1 A THR 5 ? A THR 5 6 1 Y 1 A ASN 6 ? A ASN 6 7 1 Y 1 A LYS 7 ? A LYS 7 8 1 Y 1 A LYS 8 ? A LYS 8 9 1 Y 1 A ILE 9 ? A ILE 9 10 1 Y 1 A PRO 155 ? A PRO 155 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MG MG MG N N 216 PHE N N N N 217 PHE CA C N S 218 PHE C C N N 219 PHE O O N N 220 PHE CB C N N 221 PHE CG C Y N 222 PHE CD1 C Y N 223 PHE CD2 C Y N 224 PHE CE1 C Y N 225 PHE CE2 C Y N 226 PHE CZ C Y N 227 PHE OXT O N N 228 PHE H H N N 229 PHE H2 H N N 230 PHE HA H N N 231 PHE HB2 H N N 232 PHE HB3 H N N 233 PHE HD1 H N N 234 PHE HD2 H N N 235 PHE HE1 H N N 236 PHE HE2 H N N 237 PHE HZ H N N 238 PHE HXT H N N 239 PRO N N N N 240 PRO CA C N S 241 PRO C C N N 242 PRO O O N N 243 PRO CB C N N 244 PRO CG C N N 245 PRO CD C N N 246 PRO OXT O N N 247 PRO H H N N 248 PRO HA H N N 249 PRO HB2 H N N 250 PRO HB3 H N N 251 PRO HG2 H N N 252 PRO HG3 H N N 253 PRO HD2 H N N 254 PRO HD3 H N N 255 PRO HXT H N N 256 SER N N N N 257 SER CA C N S 258 SER C C N N 259 SER O O N N 260 SER CB C N N 261 SER OG O N N 262 SER OXT O N N 263 SER H H N N 264 SER H2 H N N 265 SER HA H N N 266 SER HB2 H N N 267 SER HB3 H N N 268 SER HG H N N 269 SER HXT H N N 270 THR N N N N 271 THR CA C N S 272 THR C C N N 273 THR O O N N 274 THR CB C N R 275 THR OG1 O N N 276 THR CG2 C N N 277 THR OXT O N N 278 THR H H N N 279 THR H2 H N N 280 THR HA H N N 281 THR HB H N N 282 THR HG1 H N N 283 THR HG21 H N N 284 THR HG22 H N N 285 THR HG23 H N N 286 THR HXT H N N 287 TRP N N N N 288 TRP CA C N S 289 TRP C C N N 290 TRP O O N N 291 TRP CB C N N 292 TRP CG C Y N 293 TRP CD1 C Y N 294 TRP CD2 C Y N 295 TRP NE1 N Y N 296 TRP CE2 C Y N 297 TRP CE3 C Y N 298 TRP CZ2 C Y N 299 TRP CZ3 C Y N 300 TRP CH2 C Y N 301 TRP OXT O N N 302 TRP H H N N 303 TRP H2 H N N 304 TRP HA H N N 305 TRP HB2 H N N 306 TRP HB3 H N N 307 TRP HD1 H N N 308 TRP HE1 H N N 309 TRP HE3 H N N 310 TRP HZ2 H N N 311 TRP HZ3 H N N 312 TRP HH2 H N N 313 TRP HXT H N N 314 TYR N N N N 315 TYR CA C N S 316 TYR C C N N 317 TYR O O N N 318 TYR CB C N N 319 TYR CG C Y N 320 TYR CD1 C Y N 321 TYR CD2 C Y N 322 TYR CE1 C Y N 323 TYR CE2 C Y N 324 TYR CZ C Y N 325 TYR OH O N N 326 TYR OXT O N N 327 TYR H H N N 328 TYR H2 H N N 329 TYR HA H N N 330 TYR HB2 H N N 331 TYR HB3 H N N 332 TYR HD1 H N N 333 TYR HD2 H N N 334 TYR HE1 H N N 335 TYR HE2 H N N 336 TYR HH H N N 337 TYR HXT H N N 338 VAL N N N N 339 VAL CA C N S 340 VAL C C N N 341 VAL O O N N 342 VAL CB C N N 343 VAL CG1 C N N 344 VAL CG2 C N N 345 VAL OXT O N N 346 VAL H H N N 347 VAL H2 H N N 348 VAL HA H N N 349 VAL HB H N N 350 VAL HG11 H N N 351 VAL HG12 H N N 352 VAL HG13 H N N 353 VAL HG21 H N N 354 VAL HG22 H N N 355 VAL HG23 H N N 356 VAL HXT H N N 357 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 PHE N CA sing N N 205 PHE N H sing N N 206 PHE N H2 sing N N 207 PHE CA C sing N N 208 PHE CA CB sing N N 209 PHE CA HA sing N N 210 PHE C O doub N N 211 PHE C OXT sing N N 212 PHE CB CG sing N N 213 PHE CB HB2 sing N N 214 PHE CB HB3 sing N N 215 PHE CG CD1 doub Y N 216 PHE CG CD2 sing Y N 217 PHE CD1 CE1 sing Y N 218 PHE CD1 HD1 sing N N 219 PHE CD2 CE2 doub Y N 220 PHE CD2 HD2 sing N N 221 PHE CE1 CZ doub Y N 222 PHE CE1 HE1 sing N N 223 PHE CE2 CZ sing Y N 224 PHE CE2 HE2 sing N N 225 PHE CZ HZ sing N N 226 PHE OXT HXT sing N N 227 PRO N CA sing N N 228 PRO N CD sing N N 229 PRO N H sing N N 230 PRO CA C sing N N 231 PRO CA CB sing N N 232 PRO CA HA sing N N 233 PRO C O doub N N 234 PRO C OXT sing N N 235 PRO CB CG sing N N 236 PRO CB HB2 sing N N 237 PRO CB HB3 sing N N 238 PRO CG CD sing N N 239 PRO CG HG2 sing N N 240 PRO CG HG3 sing N N 241 PRO CD HD2 sing N N 242 PRO CD HD3 sing N N 243 PRO OXT HXT sing N N 244 SER N CA sing N N 245 SER N H sing N N 246 SER N H2 sing N N 247 SER CA C sing N N 248 SER CA CB sing N N 249 SER CA HA sing N N 250 SER C O doub N N 251 SER C OXT sing N N 252 SER CB OG sing N N 253 SER CB HB2 sing N N 254 SER CB HB3 sing N N 255 SER OG HG sing N N 256 SER OXT HXT sing N N 257 THR N CA sing N N 258 THR N H sing N N 259 THR N H2 sing N N 260 THR CA C sing N N 261 THR CA CB sing N N 262 THR CA HA sing N N 263 THR C O doub N N 264 THR C OXT sing N N 265 THR CB OG1 sing N N 266 THR CB CG2 sing N N 267 THR CB HB sing N N 268 THR OG1 HG1 sing N N 269 THR CG2 HG21 sing N N 270 THR CG2 HG22 sing N N 271 THR CG2 HG23 sing N N 272 THR OXT HXT sing N N 273 TRP N CA sing N N 274 TRP N H sing N N 275 TRP N H2 sing N N 276 TRP CA C sing N N 277 TRP CA CB sing N N 278 TRP CA HA sing N N 279 TRP C O doub N N 280 TRP C OXT sing N N 281 TRP CB CG sing N N 282 TRP CB HB2 sing N N 283 TRP CB HB3 sing N N 284 TRP CG CD1 doub Y N 285 TRP CG CD2 sing Y N 286 TRP CD1 NE1 sing Y N 287 TRP CD1 HD1 sing N N 288 TRP CD2 CE2 doub Y N 289 TRP CD2 CE3 sing Y N 290 TRP NE1 CE2 sing Y N 291 TRP NE1 HE1 sing N N 292 TRP CE2 CZ2 sing Y N 293 TRP CE3 CZ3 doub Y N 294 TRP CE3 HE3 sing N N 295 TRP CZ2 CH2 doub Y N 296 TRP CZ2 HZ2 sing N N 297 TRP CZ3 CH2 sing Y N 298 TRP CZ3 HZ3 sing N N 299 TRP CH2 HH2 sing N N 300 TRP OXT HXT sing N N 301 TYR N CA sing N N 302 TYR N H sing N N 303 TYR N H2 sing N N 304 TYR CA C sing N N 305 TYR CA CB sing N N 306 TYR CA HA sing N N 307 TYR C O doub N N 308 TYR C OXT sing N N 309 TYR CB CG sing N N 310 TYR CB HB2 sing N N 311 TYR CB HB3 sing N N 312 TYR CG CD1 doub Y N 313 TYR CG CD2 sing Y N 314 TYR CD1 CE1 sing Y N 315 TYR CD1 HD1 sing N N 316 TYR CD2 CE2 doub Y N 317 TYR CD2 HD2 sing N N 318 TYR CE1 CZ doub Y N 319 TYR CE1 HE1 sing N N 320 TYR CE2 CZ sing Y N 321 TYR CE2 HE2 sing N N 322 TYR CZ OH sing N N 323 TYR OH HH sing N N 324 TYR OXT HXT sing N N 325 VAL N CA sing N N 326 VAL N H sing N N 327 VAL N H2 sing N N 328 VAL CA C sing N N 329 VAL CA CB sing N N 330 VAL CA HA sing N N 331 VAL C O doub N N 332 VAL C OXT sing N N 333 VAL CB CG1 sing N N 334 VAL CB CG2 sing N N 335 VAL CB HB sing N N 336 VAL CG1 HG11 sing N N 337 VAL CG1 HG12 sing N N 338 VAL CG1 HG13 sing N N 339 VAL CG2 HG21 sing N N 340 VAL CG2 HG22 sing N N 341 VAL CG2 HG23 sing N N 342 VAL OXT HXT sing N N 343 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4NI6 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7UC3 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.031704 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000329 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.021438 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020604 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 MG 12 12 5.427 2.828 2.176 79.261 1.228 0.381 2.310 7.194 0.935 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 # loop_ # loop_ #