data_7UEK # _entry.id 7UEK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7UEK pdb_00007uek 10.2210/pdb7uek/pdb WWPDB D_1000262732 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-01-18 2 'Structure model' 1 1 2023-11-01 3 'Structure model' 1 2 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' citation 4 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ISSN' 4 2 'Structure model' '_citation.page_first' 5 2 'Structure model' '_citation.page_last' 6 2 'Structure model' '_citation.pdbx_database_id_PubMed' 7 2 'Structure model' '_citation.title' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7UEK _pdbx_database_status.recvd_initial_deposition_date 2022-03-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 1 _pdbx_contact_author.email possu@stanford.edu _pdbx_contact_author.name_first Po-Ssu _pdbx_contact_author.name_last Huang _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7948-2895 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chu, A.E.' 1 0000-0002-6219-7887 'Fernandez, D.' 2 0000-0002-6221-152X 'Huang, P.-S.' 3 0000-0002-7948-2895 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Biodes Res' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2693-1257 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 2022 _citation.language ? _citation.page_first 9842315 _citation.page_last 9842315 _citation.title 'De Novo Design of a Highly Stable Ovoid TIM Barrel: Unlocking Pocket Shape towards Functional Design.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.34133/2022/9842315 _citation.pdbx_database_id_PubMed 37850141 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chu, A.E.' 1 ? primary 'Fernandez, D.' 2 ? primary 'Liu, J.' 3 ? primary 'Eguchi, R.R.' 4 ? primary 'Huang, P.S.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man OT3 28003.379 1 ? ? ? ? 2 water nat water 18.015 30 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MHHHHHHENLYFQSDAICIYLDESATWKDMKKAMEILYKLGVKKIVVLFKYDEKLIKVAAKVLHDLGAEEAIIILIFDID DEDEFKKQVKKALELMKKLGVDHRIIALRMTDEEKFKKLAKIAAELGADAICIYLDESATWKDMKKAMEILYKLGVKKIV VLFKYDEKLIKVAAKVLHDLGAEEAIIILIFDIDDEDEFKKQVKKALELMKKLGVDHRIIALRMTDEEKFKKLAKIAAEL GA ; _entity_poly.pdbx_seq_one_letter_code_can ;MHHHHHHENLYFQSDAICIYLDESATWKDMKKAMEILYKLGVKKIVVLFKYDEKLIKVAAKVLHDLGAEEAIIILIFDID DEDEFKKQVKKALELMKKLGVDHRIIALRMTDEEKFKKLAKIAAELGADAICIYLDESATWKDMKKAMEILYKLGVKKIV VLFKYDEKLIKVAAKVLHDLGAEEAIIILIFDIDDEDEFKKQVKKALELMKKLGVDHRIIALRMTDEEKFKKLAKIAAEL GA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 GLU n 1 9 ASN n 1 10 LEU n 1 11 TYR n 1 12 PHE n 1 13 GLN n 1 14 SER n 1 15 ASP n 1 16 ALA n 1 17 ILE n 1 18 CYS n 1 19 ILE n 1 20 TYR n 1 21 LEU n 1 22 ASP n 1 23 GLU n 1 24 SER n 1 25 ALA n 1 26 THR n 1 27 TRP n 1 28 LYS n 1 29 ASP n 1 30 MET n 1 31 LYS n 1 32 LYS n 1 33 ALA n 1 34 MET n 1 35 GLU n 1 36 ILE n 1 37 LEU n 1 38 TYR n 1 39 LYS n 1 40 LEU n 1 41 GLY n 1 42 VAL n 1 43 LYS n 1 44 LYS n 1 45 ILE n 1 46 VAL n 1 47 VAL n 1 48 LEU n 1 49 PHE n 1 50 LYS n 1 51 TYR n 1 52 ASP n 1 53 GLU n 1 54 LYS n 1 55 LEU n 1 56 ILE n 1 57 LYS n 1 58 VAL n 1 59 ALA n 1 60 ALA n 1 61 LYS n 1 62 VAL n 1 63 LEU n 1 64 HIS n 1 65 ASP n 1 66 LEU n 1 67 GLY n 1 68 ALA n 1 69 GLU n 1 70 GLU n 1 71 ALA n 1 72 ILE n 1 73 ILE n 1 74 ILE n 1 75 LEU n 1 76 ILE n 1 77 PHE n 1 78 ASP n 1 79 ILE n 1 80 ASP n 1 81 ASP n 1 82 GLU n 1 83 ASP n 1 84 GLU n 1 85 PHE n 1 86 LYS n 1 87 LYS n 1 88 GLN n 1 89 VAL n 1 90 LYS n 1 91 LYS n 1 92 ALA n 1 93 LEU n 1 94 GLU n 1 95 LEU n 1 96 MET n 1 97 LYS n 1 98 LYS n 1 99 LEU n 1 100 GLY n 1 101 VAL n 1 102 ASP n 1 103 HIS n 1 104 ARG n 1 105 ILE n 1 106 ILE n 1 107 ALA n 1 108 LEU n 1 109 ARG n 1 110 MET n 1 111 THR n 1 112 ASP n 1 113 GLU n 1 114 GLU n 1 115 LYS n 1 116 PHE n 1 117 LYS n 1 118 LYS n 1 119 LEU n 1 120 ALA n 1 121 LYS n 1 122 ILE n 1 123 ALA n 1 124 ALA n 1 125 GLU n 1 126 LEU n 1 127 GLY n 1 128 ALA n 1 129 ASP n 1 130 ALA n 1 131 ILE n 1 132 CYS n 1 133 ILE n 1 134 TYR n 1 135 LEU n 1 136 ASP n 1 137 GLU n 1 138 SER n 1 139 ALA n 1 140 THR n 1 141 TRP n 1 142 LYS n 1 143 ASP n 1 144 MET n 1 145 LYS n 1 146 LYS n 1 147 ALA n 1 148 MET n 1 149 GLU n 1 150 ILE n 1 151 LEU n 1 152 TYR n 1 153 LYS n 1 154 LEU n 1 155 GLY n 1 156 VAL n 1 157 LYS n 1 158 LYS n 1 159 ILE n 1 160 VAL n 1 161 VAL n 1 162 LEU n 1 163 PHE n 1 164 LYS n 1 165 TYR n 1 166 ASP n 1 167 GLU n 1 168 LYS n 1 169 LEU n 1 170 ILE n 1 171 LYS n 1 172 VAL n 1 173 ALA n 1 174 ALA n 1 175 LYS n 1 176 VAL n 1 177 LEU n 1 178 HIS n 1 179 ASP n 1 180 LEU n 1 181 GLY n 1 182 ALA n 1 183 GLU n 1 184 GLU n 1 185 ALA n 1 186 ILE n 1 187 ILE n 1 188 ILE n 1 189 LEU n 1 190 ILE n 1 191 PHE n 1 192 ASP n 1 193 ILE n 1 194 ASP n 1 195 ASP n 1 196 GLU n 1 197 ASP n 1 198 GLU n 1 199 PHE n 1 200 LYS n 1 201 LYS n 1 202 GLN n 1 203 VAL n 1 204 LYS n 1 205 LYS n 1 206 ALA n 1 207 LEU n 1 208 GLU n 1 209 LEU n 1 210 MET n 1 211 LYS n 1 212 LYS n 1 213 LEU n 1 214 GLY n 1 215 VAL n 1 216 ASP n 1 217 HIS n 1 218 ARG n 1 219 ILE n 1 220 ILE n 1 221 ALA n 1 222 LEU n 1 223 ARG n 1 224 MET n 1 225 THR n 1 226 ASP n 1 227 GLU n 1 228 GLU n 1 229 LYS n 1 230 PHE n 1 231 LYS n 1 232 LYS n 1 233 LEU n 1 234 ALA n 1 235 LYS n 1 236 ILE n 1 237 ALA n 1 238 ALA n 1 239 GLU n 1 240 LEU n 1 241 GLY n 1 242 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 242 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'synthetic construct' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 32630 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -13 ? ? ? A . n A 1 2 HIS 2 -12 ? ? ? A . n A 1 3 HIS 3 -11 ? ? ? A . n A 1 4 HIS 4 -10 ? ? ? A . n A 1 5 HIS 5 -9 ? ? ? A . n A 1 6 HIS 6 -8 ? ? ? A . n A 1 7 HIS 7 -7 ? ? ? A . n A 1 8 GLU 8 -6 ? ? ? A . n A 1 9 ASN 9 -5 ? ? ? A . n A 1 10 LEU 10 -4 ? ? ? A . n A 1 11 TYR 11 -3 ? ? ? A . n A 1 12 PHE 12 -2 ? ? ? A . n A 1 13 GLN 13 -1 ? ? ? A . n A 1 14 SER 14 0 ? ? ? A . n A 1 15 ASP 15 1 1 ASP ASP A . n A 1 16 ALA 16 2 2 ALA ALA A . n A 1 17 ILE 17 3 3 ILE ILE A . n A 1 18 CYS 18 4 4 CYS CYS A . n A 1 19 ILE 19 5 5 ILE ILE A . n A 1 20 TYR 20 6 6 TYR TYR A . n A 1 21 LEU 21 7 7 LEU LEU A . n A 1 22 ASP 22 8 8 ASP ASP A . n A 1 23 GLU 23 9 9 GLU GLU A . n A 1 24 SER 24 10 10 SER SER A . n A 1 25 ALA 25 11 11 ALA ALA A . n A 1 26 THR 26 12 12 THR THR A . n A 1 27 TRP 27 13 13 TRP TRP A . n A 1 28 LYS 28 14 14 LYS LYS A . n A 1 29 ASP 29 15 15 ASP ASP A . n A 1 30 MET 30 16 16 MET MET A . n A 1 31 LYS 31 17 17 LYS LYS A . n A 1 32 LYS 32 18 18 LYS LYS A . n A 1 33 ALA 33 19 19 ALA ALA A . n A 1 34 MET 34 20 20 MET MET A . n A 1 35 GLU 35 21 21 GLU GLU A . n A 1 36 ILE 36 22 22 ILE ILE A . n A 1 37 LEU 37 23 23 LEU LEU A . n A 1 38 TYR 38 24 24 TYR TYR A . n A 1 39 LYS 39 25 25 LYS LYS A . n A 1 40 LEU 40 26 26 LEU LEU A . n A 1 41 GLY 41 27 27 GLY GLY A . n A 1 42 VAL 42 28 28 VAL VAL A . n A 1 43 LYS 43 29 29 LYS LYS A . n A 1 44 LYS 44 30 30 LYS LYS A . n A 1 45 ILE 45 31 31 ILE ILE A . n A 1 46 VAL 46 32 32 VAL VAL A . n A 1 47 VAL 47 33 33 VAL VAL A . n A 1 48 LEU 48 34 34 LEU LEU A . n A 1 49 PHE 49 35 35 PHE PHE A . n A 1 50 LYS 50 36 36 LYS LYS A . n A 1 51 TYR 51 37 37 TYR TYR A . n A 1 52 ASP 52 38 38 ASP ASP A . n A 1 53 GLU 53 39 39 GLU GLU A . n A 1 54 LYS 54 40 40 LYS LYS A . n A 1 55 LEU 55 41 41 LEU LEU A . n A 1 56 ILE 56 42 42 ILE ILE A . n A 1 57 LYS 57 43 43 LYS LYS A . n A 1 58 VAL 58 44 44 VAL VAL A . n A 1 59 ALA 59 45 45 ALA ALA A . n A 1 60 ALA 60 46 46 ALA ALA A . n A 1 61 LYS 61 47 47 LYS LYS A . n A 1 62 VAL 62 48 48 VAL VAL A . n A 1 63 LEU 63 49 49 LEU LEU A . n A 1 64 HIS 64 50 50 HIS HIS A . n A 1 65 ASP 65 51 51 ASP ASP A . n A 1 66 LEU 66 52 52 LEU LEU A . n A 1 67 GLY 67 53 53 GLY GLY A . n A 1 68 ALA 68 54 54 ALA ALA A . n A 1 69 GLU 69 55 55 GLU GLU A . n A 1 70 GLU 70 56 56 GLU GLU A . n A 1 71 ALA 71 57 57 ALA ALA A . n A 1 72 ILE 72 58 58 ILE ILE A . n A 1 73 ILE 73 59 59 ILE ILE A . n A 1 74 ILE 74 60 60 ILE ILE A . n A 1 75 LEU 75 61 61 LEU LEU A . n A 1 76 ILE 76 62 62 ILE ILE A . n A 1 77 PHE 77 63 63 PHE PHE A . n A 1 78 ASP 78 64 64 ASP ASP A . n A 1 79 ILE 79 65 65 ILE ILE A . n A 1 80 ASP 80 66 66 ASP ASP A . n A 1 81 ASP 81 67 67 ASP ASP A . n A 1 82 GLU 82 68 68 GLU GLU A . n A 1 83 ASP 83 69 69 ASP ASP A . n A 1 84 GLU 84 70 70 GLU GLU A . n A 1 85 PHE 85 71 71 PHE PHE A . n A 1 86 LYS 86 72 72 LYS LYS A . n A 1 87 LYS 87 73 73 LYS LYS A . n A 1 88 GLN 88 74 74 GLN GLN A . n A 1 89 VAL 89 75 75 VAL VAL A . n A 1 90 LYS 90 76 76 LYS LYS A . n A 1 91 LYS 91 77 77 LYS LYS A . n A 1 92 ALA 92 78 78 ALA ALA A . n A 1 93 LEU 93 79 79 LEU LEU A . n A 1 94 GLU 94 80 80 GLU GLU A . n A 1 95 LEU 95 81 81 LEU LEU A . n A 1 96 MET 96 82 82 MET MET A . n A 1 97 LYS 97 83 83 LYS LYS A . n A 1 98 LYS 98 84 84 LYS LYS A . n A 1 99 LEU 99 85 85 LEU LEU A . n A 1 100 GLY 100 86 86 GLY GLY A . n A 1 101 VAL 101 87 87 VAL VAL A . n A 1 102 ASP 102 88 88 ASP ASP A . n A 1 103 HIS 103 89 89 HIS HIS A . n A 1 104 ARG 104 90 90 ARG ARG A . n A 1 105 ILE 105 91 91 ILE ILE A . n A 1 106 ILE 106 92 92 ILE ILE A . n A 1 107 ALA 107 93 93 ALA ALA A . n A 1 108 LEU 108 94 94 LEU LEU A . n A 1 109 ARG 109 95 95 ARG ARG A . n A 1 110 MET 110 96 96 MET MET A . n A 1 111 THR 111 97 97 THR THR A . n A 1 112 ASP 112 98 98 ASP ASP A . n A 1 113 GLU 113 99 99 GLU GLU A . n A 1 114 GLU 114 100 100 GLU GLU A . n A 1 115 LYS 115 101 101 LYS LYS A . n A 1 116 PHE 116 102 102 PHE PHE A . n A 1 117 LYS 117 103 103 LYS LYS A . n A 1 118 LYS 118 104 104 LYS LYS A . n A 1 119 LEU 119 105 105 LEU LEU A . n A 1 120 ALA 120 106 106 ALA ALA A . n A 1 121 LYS 121 107 107 LYS LYS A . n A 1 122 ILE 122 108 108 ILE ILE A . n A 1 123 ALA 123 109 109 ALA ALA A . n A 1 124 ALA 124 110 110 ALA ALA A . n A 1 125 GLU 125 111 111 GLU GLU A . n A 1 126 LEU 126 112 112 LEU LEU A . n A 1 127 GLY 127 113 113 GLY GLY A . n A 1 128 ALA 128 114 114 ALA ALA A . n A 1 129 ASP 129 115 115 ASP ASP A . n A 1 130 ALA 130 116 116 ALA ALA A . n A 1 131 ILE 131 117 117 ILE ILE A . n A 1 132 CYS 132 118 118 CYS CYS A . n A 1 133 ILE 133 119 119 ILE ILE A . n A 1 134 TYR 134 120 120 TYR TYR A . n A 1 135 LEU 135 121 121 LEU LEU A . n A 1 136 ASP 136 122 122 ASP ASP A . n A 1 137 GLU 137 123 123 GLU GLU A . n A 1 138 SER 138 124 124 SER SER A . n A 1 139 ALA 139 125 125 ALA ALA A . n A 1 140 THR 140 126 126 THR THR A . n A 1 141 TRP 141 127 127 TRP TRP A . n A 1 142 LYS 142 128 128 LYS LYS A . n A 1 143 ASP 143 129 129 ASP ASP A . n A 1 144 MET 144 130 130 MET MET A . n A 1 145 LYS 145 131 131 LYS LYS A . n A 1 146 LYS 146 132 132 LYS LYS A . n A 1 147 ALA 147 133 133 ALA ALA A . n A 1 148 MET 148 134 134 MET MET A . n A 1 149 GLU 149 135 135 GLU GLU A . n A 1 150 ILE 150 136 136 ILE ILE A . n A 1 151 LEU 151 137 137 LEU LEU A . n A 1 152 TYR 152 138 138 TYR TYR A . n A 1 153 LYS 153 139 139 LYS LYS A . n A 1 154 LEU 154 140 140 LEU LEU A . n A 1 155 GLY 155 141 141 GLY GLY A . n A 1 156 VAL 156 142 142 VAL VAL A . n A 1 157 LYS 157 143 143 LYS LYS A . n A 1 158 LYS 158 144 144 LYS LYS A . n A 1 159 ILE 159 145 145 ILE ILE A . n A 1 160 VAL 160 146 146 VAL VAL A . n A 1 161 VAL 161 147 147 VAL VAL A . n A 1 162 LEU 162 148 148 LEU LEU A . n A 1 163 PHE 163 149 149 PHE PHE A . n A 1 164 LYS 164 150 150 LYS LYS A . n A 1 165 TYR 165 151 151 TYR TYR A . n A 1 166 ASP 166 152 152 ASP ASP A . n A 1 167 GLU 167 153 153 GLU GLU A . n A 1 168 LYS 168 154 154 LYS LYS A . n A 1 169 LEU 169 155 155 LEU LEU A . n A 1 170 ILE 170 156 156 ILE ILE A . n A 1 171 LYS 171 157 157 LYS LYS A . n A 1 172 VAL 172 158 158 VAL VAL A . n A 1 173 ALA 173 159 159 ALA ALA A . n A 1 174 ALA 174 160 160 ALA ALA A . n A 1 175 LYS 175 161 161 LYS LYS A . n A 1 176 VAL 176 162 162 VAL VAL A . n A 1 177 LEU 177 163 163 LEU LEU A . n A 1 178 HIS 178 164 164 HIS HIS A . n A 1 179 ASP 179 165 165 ASP ASP A . n A 1 180 LEU 180 166 166 LEU LEU A . n A 1 181 GLY 181 167 167 GLY GLY A . n A 1 182 ALA 182 168 168 ALA ALA A . n A 1 183 GLU 183 169 169 GLU GLU A . n A 1 184 GLU 184 170 170 GLU GLU A . n A 1 185 ALA 185 171 171 ALA ALA A . n A 1 186 ILE 186 172 172 ILE ILE A . n A 1 187 ILE 187 173 173 ILE ILE A . n A 1 188 ILE 188 174 174 ILE ILE A . n A 1 189 LEU 189 175 175 LEU LEU A . n A 1 190 ILE 190 176 176 ILE ILE A . n A 1 191 PHE 191 177 177 PHE PHE A . n A 1 192 ASP 192 178 178 ASP ASP A . n A 1 193 ILE 193 179 179 ILE ILE A . n A 1 194 ASP 194 180 180 ASP ASP A . n A 1 195 ASP 195 181 181 ASP ASP A . n A 1 196 GLU 196 182 182 GLU GLU A . n A 1 197 ASP 197 183 183 ASP ASP A . n A 1 198 GLU 198 184 184 GLU GLU A . n A 1 199 PHE 199 185 185 PHE PHE A . n A 1 200 LYS 200 186 186 LYS LYS A . n A 1 201 LYS 201 187 187 LYS LYS A . n A 1 202 GLN 202 188 188 GLN GLN A . n A 1 203 VAL 203 189 189 VAL VAL A . n A 1 204 LYS 204 190 190 LYS LYS A . n A 1 205 LYS 205 191 191 LYS LYS A . n A 1 206 ALA 206 192 192 ALA ALA A . n A 1 207 LEU 207 193 193 LEU LEU A . n A 1 208 GLU 208 194 194 GLU GLU A . n A 1 209 LEU 209 195 195 LEU LEU A . n A 1 210 MET 210 196 196 MET MET A . n A 1 211 LYS 211 197 197 LYS LYS A . n A 1 212 LYS 212 198 198 LYS LYS A . n A 1 213 LEU 213 199 199 LEU LEU A . n A 1 214 GLY 214 200 200 GLY GLY A . n A 1 215 VAL 215 201 201 VAL VAL A . n A 1 216 ASP 216 202 202 ASP ASP A . n A 1 217 HIS 217 203 203 HIS HIS A . n A 1 218 ARG 218 204 204 ARG ARG A . n A 1 219 ILE 219 205 205 ILE ILE A . n A 1 220 ILE 220 206 206 ILE ILE A . n A 1 221 ALA 221 207 207 ALA ALA A . n A 1 222 LEU 222 208 208 LEU LEU A . n A 1 223 ARG 223 209 209 ARG ARG A . n A 1 224 MET 224 210 210 MET MET A . n A 1 225 THR 225 211 211 THR THR A . n A 1 226 ASP 226 212 212 ASP ASP A . n A 1 227 GLU 227 213 213 GLU GLU A . n A 1 228 GLU 228 214 214 GLU GLU A . n A 1 229 LYS 229 215 215 LYS LYS A . n A 1 230 PHE 230 216 216 PHE PHE A . n A 1 231 LYS 231 217 217 LYS LYS A . n A 1 232 LYS 232 218 218 LYS LYS A . n A 1 233 LEU 233 219 219 LEU LEU A . n A 1 234 ALA 234 220 220 ALA ALA A . n A 1 235 LYS 235 221 221 LYS LYS A . n A 1 236 ILE 236 222 222 ILE ILE A . n A 1 237 ALA 237 223 223 ALA ALA A . n A 1 238 ALA 238 224 224 ALA ALA A . n A 1 239 GLU 239 225 225 GLU GLU A . n A 1 240 LEU 240 226 226 LEU LEU A . n A 1 241 GLY 241 227 227 GLY GLY A . n A 1 242 ALA 242 228 228 ALA ALA A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 17 HOH HOH A . B 2 HOH 2 302 8 HOH HOH A . B 2 HOH 3 303 14 HOH HOH A . B 2 HOH 4 304 16 HOH HOH A . B 2 HOH 5 305 28 HOH HOH A . B 2 HOH 6 306 26 HOH HOH A . B 2 HOH 7 307 9 HOH HOH A . B 2 HOH 8 308 10 HOH HOH A . B 2 HOH 9 309 2 HOH HOH A . B 2 HOH 10 310 3 HOH HOH A . B 2 HOH 11 311 6 HOH HOH A . B 2 HOH 12 312 1 HOH HOH A . B 2 HOH 13 313 27 HOH HOH A . B 2 HOH 14 314 24 HOH HOH A . B 2 HOH 15 315 19 HOH HOH A . B 2 HOH 16 316 7 HOH HOH A . B 2 HOH 17 317 22 HOH HOH A . B 2 HOH 18 318 12 HOH HOH A . B 2 HOH 19 319 4 HOH HOH A . B 2 HOH 20 320 29 HOH HOH A . B 2 HOH 21 321 11 HOH HOH A . B 2 HOH 22 322 13 HOH HOH A . B 2 HOH 23 323 25 HOH HOH A . B 2 HOH 24 324 21 HOH HOH A . B 2 HOH 25 325 30 HOH HOH A . B 2 HOH 26 326 5 HOH HOH A . B 2 HOH 27 327 20 HOH HOH A . B 2 HOH 28 328 23 HOH HOH A . B 2 HOH 29 329 15 HOH HOH A . B 2 HOH 30 330 18 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.15.2_3472 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7UEK _cell.details ? _cell.formula_units_Z ? _cell.length_a 44.848 _cell.length_a_esd ? _cell.length_b 65.526 _cell.length_b_esd ? _cell.length_c 77.686 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7UEK _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7UEK _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.23 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.65 _exptl_crystal.description '100s um straight rod' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 305 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Buffer: 20 mM Tris, 150 mM sodium chloride, pH 8.0. Screen: 0.3 M magnesium chloride, 0.3 M calcium chloride, 1 M Tris Bicine, 10% PEG8000, 25% ethylene glycol, pH 8.5 ; _exptl_crystal_grow.pdbx_pH_range 8.0-8.5 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-03-26 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97946 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL9-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97946 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL9-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7UEK _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.100 _reflns.d_resolution_low 38.8430 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13666 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.5 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.9 _reflns.pdbx_Rmerge_I_obs 0.048 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.100 2.160 ? ? 3571 ? ? ? 1120 99.600 ? ? ? ? 0.301 ? ? ? ? ? ? ? ? 3.200 ? ? ? 2.200 ? ? ? 1 1 0.963 ? ? ? ? ? ? ? ? ? ? 8.910 38.840 ? ? 567 ? ? ? 201 93.800 ? ? ? ? 0.024 ? ? ? ? ? ? ? ? 2.800 ? ? ? 25.700 ? ? ? 2 1 0.999 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 148.190 _refine.B_iso_mean 62.8672 _refine.B_iso_min 27.770 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7UEK _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1000 _refine.ls_d_res_low 38.8430 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13666 _refine.ls_number_reflns_R_free 685 _refine.ls_number_reflns_R_work 12981 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.2700 _refine.ls_percent_reflns_R_free 5.0100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2478 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2251 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'Computational design' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 35.7600 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.1000 _refine_hist.d_res_low 38.8430 _refine_hist.number_atoms_solvent 30 _refine_hist.number_atoms_total 1862 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 228 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 68.63 _refine_hist.pdbx_number_atoms_protein 1832 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1001 2.1751 . . 63 1270 99.0000 . . . 0.3329 0.0000 0.3207 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1751 2.2622 . . 61 1295 98.0000 . . . 0.3388 0.0000 0.2871 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2622 2.3651 . . 61 1289 98.0000 . . . 0.3562 0.0000 0.2684 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3651 2.4898 . . 65 1264 98.0000 . . . 0.3168 0.0000 0.2586 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4898 2.6458 . . 80 1281 98.0000 . . . 0.2672 0.0000 0.2477 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6458 2.8500 . . 66 1292 99.0000 . . . 0.2569 0.0000 0.2384 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8500 3.1367 . . 69 1276 99.0000 . . . 0.3752 0.0000 0.2651 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1367 3.5903 . . 66 1324 99.0000 . . . 0.2898 0.0000 0.2174 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5903 4.5223 . . 71 1319 98.0000 . . . 0.2119 0.0000 0.1940 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.5223 38.843 . . 83 1371 97.0000 . . . 0.1978 0.0000 0.2095 . . . . . . . . . . . # _struct.entry_id 7UEK _struct.title 'Crystal structure of a de novo designed ovoid TIM barrel OT3' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7UEK _struct_keywords.text 'TIM barrel, de novo, oval curvature, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7UEK _struct_ref.pdbx_db_accession 7UEK _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7UEK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 242 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7UEK _struct_ref_seq.db_align_beg -13 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 228 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg -13 _struct_ref_seq.pdbx_auth_seq_align_end 228 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 11410 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 26 ? GLY A 41 ? THR A 12 GLY A 27 1 ? 16 HELX_P HELX_P2 AA2 ASP A 52 ? GLY A 67 ? ASP A 38 GLY A 53 1 ? 16 HELX_P HELX_P3 AA3 ASP A 81 ? LEU A 99 ? ASP A 67 LEU A 85 1 ? 19 HELX_P HELX_P4 AA4 ASP A 112 ? GLY A 127 ? ASP A 98 GLY A 113 1 ? 16 HELX_P HELX_P5 AA5 THR A 140 ? GLY A 155 ? THR A 126 GLY A 141 1 ? 16 HELX_P HELX_P6 AA6 ASP A 166 ? GLY A 181 ? ASP A 152 GLY A 167 1 ? 16 HELX_P HELX_P7 AA7 ASP A 195 ? LEU A 213 ? ASP A 181 LEU A 199 1 ? 19 HELX_P HELX_P8 AA8 ASP A 226 ? GLY A 241 ? ASP A 212 GLY A 227 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA1 7 8 ? parallel AA1 8 9 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 16 ? LEU A 21 ? ALA A 2 LEU A 7 AA1 2 ILE A 45 ? LYS A 50 ? ILE A 31 LYS A 36 AA1 3 ILE A 72 ? PHE A 77 ? ILE A 58 PHE A 63 AA1 4 ARG A 104 ? ARG A 109 ? ARG A 90 ARG A 95 AA1 5 ALA A 130 ? TYR A 134 ? ALA A 116 TYR A 120 AA1 6 ILE A 159 ? LYS A 164 ? ILE A 145 LYS A 150 AA1 7 ILE A 186 ? ILE A 190 ? ILE A 172 ILE A 176 AA1 8 ARG A 218 ? MET A 224 ? ARG A 204 MET A 210 AA1 9 ALA A 16 ? LEU A 21 ? ALA A 2 LEU A 7 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 19 ? N ILE A 5 O VAL A 46 ? O VAL A 32 AA1 2 3 N VAL A 47 ? N VAL A 33 O ILE A 74 ? O ILE A 60 AA1 3 4 N LEU A 75 ? N LEU A 61 O ALA A 107 ? O ALA A 93 AA1 4 5 N LEU A 108 ? N LEU A 94 O CYS A 132 ? O CYS A 118 AA1 5 6 N ILE A 133 ? N ILE A 119 O VAL A 160 ? O VAL A 146 AA1 6 7 N VAL A 161 ? N VAL A 147 O ILE A 188 ? O ILE A 174 AA1 7 8 N LEU A 189 ? N LEU A 175 O ALA A 221 ? O ALA A 207 AA1 8 9 O LEU A 222 ? O LEU A 208 N CYS A 18 ? N CYS A 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 9 ? ? 51.42 -13.21 2 1 ALA A 54 ? ? -102.33 77.32 3 1 THR A 97 ? ? 39.87 -130.53 4 1 THR A 211 ? ? -124.35 -80.54 # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 4.9297 _pdbx_refine_tls.origin_y 0.2408 _pdbx_refine_tls.origin_z -9.9014 _pdbx_refine_tls.T[1][1] 0.2321 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0127 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0468 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.2220 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0030 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.3764 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 3.2564 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.6238 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.3034 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 5.1054 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.5393 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 1.6989 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.0160 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.0436 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.2739 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0158 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.0370 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.0924 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.0889 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.0725 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.0148 _pdbx_refine_tls.S[3][3]_esd ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 1 ? ? ? A 228 ? ? all 2 'X-RAY DIFFRACTION' 1 ? ? B 1 ? ? ? B 39 ? ? all # _phasing.method MR # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -13 ? A MET 1 2 1 Y 1 A HIS -12 ? A HIS 2 3 1 Y 1 A HIS -11 ? A HIS 3 4 1 Y 1 A HIS -10 ? A HIS 4 5 1 Y 1 A HIS -9 ? A HIS 5 6 1 Y 1 A HIS -8 ? A HIS 6 7 1 Y 1 A HIS -7 ? A HIS 7 8 1 Y 1 A GLU -6 ? A GLU 8 9 1 Y 1 A ASN -5 ? A ASN 9 10 1 Y 1 A LEU -4 ? A LEU 10 11 1 Y 1 A TYR -3 ? A TYR 11 12 1 Y 1 A PHE -2 ? A PHE 12 13 1 Y 1 A GLN -1 ? A GLN 13 14 1 Y 1 A SER 0 ? A SER 14 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 SER N CA sing N N 260 SER N H sing N N 261 SER N H2 sing N N 262 SER CA C sing N N 263 SER CA CB sing N N 264 SER CA HA sing N N 265 SER C O doub N N 266 SER C OXT sing N N 267 SER CB OG sing N N 268 SER CB HB2 sing N N 269 SER CB HB3 sing N N 270 SER OG HG sing N N 271 SER OXT HXT sing N N 272 THR N CA sing N N 273 THR N H sing N N 274 THR N H2 sing N N 275 THR CA C sing N N 276 THR CA CB sing N N 277 THR CA HA sing N N 278 THR C O doub N N 279 THR C OXT sing N N 280 THR CB OG1 sing N N 281 THR CB CG2 sing N N 282 THR CB HB sing N N 283 THR OG1 HG1 sing N N 284 THR CG2 HG21 sing N N 285 THR CG2 HG22 sing N N 286 THR CG2 HG23 sing N N 287 THR OXT HXT sing N N 288 TRP N CA sing N N 289 TRP N H sing N N 290 TRP N H2 sing N N 291 TRP CA C sing N N 292 TRP CA CB sing N N 293 TRP CA HA sing N N 294 TRP C O doub N N 295 TRP C OXT sing N N 296 TRP CB CG sing N N 297 TRP CB HB2 sing N N 298 TRP CB HB3 sing N N 299 TRP CG CD1 doub Y N 300 TRP CG CD2 sing Y N 301 TRP CD1 NE1 sing Y N 302 TRP CD1 HD1 sing N N 303 TRP CD2 CE2 doub Y N 304 TRP CD2 CE3 sing Y N 305 TRP NE1 CE2 sing Y N 306 TRP NE1 HE1 sing N N 307 TRP CE2 CZ2 sing Y N 308 TRP CE3 CZ3 doub Y N 309 TRP CE3 HE3 sing N N 310 TRP CZ2 CH2 doub Y N 311 TRP CZ2 HZ2 sing N N 312 TRP CZ3 CH2 sing Y N 313 TRP CZ3 HZ3 sing N N 314 TRP CH2 HH2 sing N N 315 TRP OXT HXT sing N N 316 TYR N CA sing N N 317 TYR N H sing N N 318 TYR N H2 sing N N 319 TYR CA C sing N N 320 TYR CA CB sing N N 321 TYR CA HA sing N N 322 TYR C O doub N N 323 TYR C OXT sing N N 324 TYR CB CG sing N N 325 TYR CB HB2 sing N N 326 TYR CB HB3 sing N N 327 TYR CG CD1 doub Y N 328 TYR CG CD2 sing Y N 329 TYR CD1 CE1 sing Y N 330 TYR CD1 HD1 sing N N 331 TYR CD2 CE2 doub Y N 332 TYR CD2 HD2 sing N N 333 TYR CE1 CZ doub Y N 334 TYR CE1 HE1 sing N N 335 TYR CE2 CZ sing Y N 336 TYR CE2 HE2 sing N N 337 TYR CZ OH sing N N 338 TYR OH HH sing N N 339 TYR OXT HXT sing N N 340 VAL N CA sing N N 341 VAL N H sing N N 342 VAL N H2 sing N N 343 VAL CA C sing N N 344 VAL CA CB sing N N 345 VAL CA HA sing N N 346 VAL C O doub N N 347 VAL C OXT sing N N 348 VAL CB CG1 sing N N 349 VAL CB CG2 sing N N 350 VAL CB HB sing N N 351 VAL CG1 HG11 sing N N 352 VAL CG1 HG12 sing N N 353 VAL CG1 HG13 sing N N 354 VAL CG2 HG21 sing N N 355 VAL CG2 HG22 sing N N 356 VAL CG2 HG23 sing N N 357 VAL OXT HXT sing N N 358 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'in silico model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.details 'Computational design' # _atom_sites.entry_id 7UEK _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.022298 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015261 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012872 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_