data_7UF5 # _entry.id 7UF5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7UF5 pdb_00007uf5 10.2210/pdb7uf5/pdb WWPDB D_1000264078 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7UF5 _pdbx_database_status.recvd_initial_deposition_date 2022-03-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kenjic, N.' 1 ? 'Meneely, K.M.' 2 ? 'Lamb, A.L.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 144 _citation.language ? _citation.page_first 12769 _citation.page_last 12780 _citation.title 'Evidence for the Chemical Mechanism of RibB (3,4-Dihydroxy-2-butanone 4-phosphate Synthase) of Riboflavin Biosynthesis.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.2c03376 _citation.pdbx_database_id_PubMed 35802469 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kenjic, N.' 1 ? primary 'Meneely, K.M.' 2 ? primary 'Wherritt, D.J.' 3 ? primary 'Denler, M.C.' 4 ? primary 'Jackson, T.A.' 5 ? primary 'Moran, G.R.' 6 ? primary 'Lamb, A.L.' 7 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7UF5 _cell.details ? _cell.formula_units_Z ? _cell.length_a 60.912 _cell.length_a_esd ? _cell.length_b 78.990 _cell.length_b_esd ? _cell.length_c 90.367 _cell.length_c_esd ? _cell.volume 434795.297 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7UF5 _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall 'C 2c 2' _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '3,4-dihydroxy-2-butanone 4-phosphate synthase' 23589.953 1 4.1.99.12 ? ? ? 2 non-polymer syn '(2R)-2-(dihydroxymethyl)-2-hydroxy-3-oxobutyl dihydrogen phosphate' 230.110 1 ? ? ? ? 3 non-polymer syn '(2R)-2-hydroxy-3-oxobutyl dihydrogen phosphate' 184.084 1 ? ? ? ? 4 non-polymer syn 'FORMIC ACID' 46.025 1 ? ? ? ? 5 non-polymer syn 'MANGANESE (II) ION' 54.938 1 ? ? ? ? 6 water nat water 18.015 64 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'DHBP synthase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MNQSSLLAEFGDPITRVENALQALREGRGVLLLDDEDRENEGDIIYAVESLTTAQMALMIRECSGIVCLCLTEAQADRLA LPPMVVNNNSANQTAFTVSIEAKHGVTTGVSAQDRVTTIKTAANPQAKPEDLARPGHVFPLRARAGGVLARRGHTEGTVD LMQMAGLQPAGVLCELTNPDGSMAKTPEIIEFGKLHNMPVLTIEDMVQYRIQFDLKLA ; _entity_poly.pdbx_seq_one_letter_code_can ;MNQSSLLAEFGDPITRVENALQALREGRGVLLLDDEDRENEGDIIYAVESLTTAQMALMIRECSGIVCLCLTEAQADRLA LPPMVVNNNSANQTAFTVSIEAKHGVTTGVSAQDRVTTIKTAANPQAKPEDLARPGHVFPLRARAGGVLARRGHTEGTVD LMQMAGLQPAGVLCELTNPDGSMAKTPEIIEFGKLHNMPVLTIEDMVQYRIQFDLKLA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASN n 1 3 GLN n 1 4 SER n 1 5 SER n 1 6 LEU n 1 7 LEU n 1 8 ALA n 1 9 GLU n 1 10 PHE n 1 11 GLY n 1 12 ASP n 1 13 PRO n 1 14 ILE n 1 15 THR n 1 16 ARG n 1 17 VAL n 1 18 GLU n 1 19 ASN n 1 20 ALA n 1 21 LEU n 1 22 GLN n 1 23 ALA n 1 24 LEU n 1 25 ARG n 1 26 GLU n 1 27 GLY n 1 28 ARG n 1 29 GLY n 1 30 VAL n 1 31 LEU n 1 32 LEU n 1 33 LEU n 1 34 ASP n 1 35 ASP n 1 36 GLU n 1 37 ASP n 1 38 ARG n 1 39 GLU n 1 40 ASN n 1 41 GLU n 1 42 GLY n 1 43 ASP n 1 44 ILE n 1 45 ILE n 1 46 TYR n 1 47 ALA n 1 48 VAL n 1 49 GLU n 1 50 SER n 1 51 LEU n 1 52 THR n 1 53 THR n 1 54 ALA n 1 55 GLN n 1 56 MET n 1 57 ALA n 1 58 LEU n 1 59 MET n 1 60 ILE n 1 61 ARG n 1 62 GLU n 1 63 CYS n 1 64 SER n 1 65 GLY n 1 66 ILE n 1 67 VAL n 1 68 CYS n 1 69 LEU n 1 70 CYS n 1 71 LEU n 1 72 THR n 1 73 GLU n 1 74 ALA n 1 75 GLN n 1 76 ALA n 1 77 ASP n 1 78 ARG n 1 79 LEU n 1 80 ALA n 1 81 LEU n 1 82 PRO n 1 83 PRO n 1 84 MET n 1 85 VAL n 1 86 VAL n 1 87 ASN n 1 88 ASN n 1 89 ASN n 1 90 SER n 1 91 ALA n 1 92 ASN n 1 93 GLN n 1 94 THR n 1 95 ALA n 1 96 PHE n 1 97 THR n 1 98 VAL n 1 99 SER n 1 100 ILE n 1 101 GLU n 1 102 ALA n 1 103 LYS n 1 104 HIS n 1 105 GLY n 1 106 VAL n 1 107 THR n 1 108 THR n 1 109 GLY n 1 110 VAL n 1 111 SER n 1 112 ALA n 1 113 GLN n 1 114 ASP n 1 115 ARG n 1 116 VAL n 1 117 THR n 1 118 THR n 1 119 ILE n 1 120 LYS n 1 121 THR n 1 122 ALA n 1 123 ALA n 1 124 ASN n 1 125 PRO n 1 126 GLN n 1 127 ALA n 1 128 LYS n 1 129 PRO n 1 130 GLU n 1 131 ASP n 1 132 LEU n 1 133 ALA n 1 134 ARG n 1 135 PRO n 1 136 GLY n 1 137 HIS n 1 138 VAL n 1 139 PHE n 1 140 PRO n 1 141 LEU n 1 142 ARG n 1 143 ALA n 1 144 ARG n 1 145 ALA n 1 146 GLY n 1 147 GLY n 1 148 VAL n 1 149 LEU n 1 150 ALA n 1 151 ARG n 1 152 ARG n 1 153 GLY n 1 154 HIS n 1 155 THR n 1 156 GLU n 1 157 GLY n 1 158 THR n 1 159 VAL n 1 160 ASP n 1 161 LEU n 1 162 MET n 1 163 GLN n 1 164 MET n 1 165 ALA n 1 166 GLY n 1 167 LEU n 1 168 GLN n 1 169 PRO n 1 170 ALA n 1 171 GLY n 1 172 VAL n 1 173 LEU n 1 174 CYS n 1 175 GLU n 1 176 LEU n 1 177 THR n 1 178 ASN n 1 179 PRO n 1 180 ASP n 1 181 GLY n 1 182 SER n 1 183 MET n 1 184 ALA n 1 185 LYS n 1 186 THR n 1 187 PRO n 1 188 GLU n 1 189 ILE n 1 190 ILE n 1 191 GLU n 1 192 PHE n 1 193 GLY n 1 194 LYS n 1 195 LEU n 1 196 HIS n 1 197 ASN n 1 198 MET n 1 199 PRO n 1 200 VAL n 1 201 LEU n 1 202 THR n 1 203 ILE n 1 204 GLU n 1 205 ASP n 1 206 MET n 1 207 VAL n 1 208 GLN n 1 209 TYR n 1 210 ARG n 1 211 ILE n 1 212 GLN n 1 213 PHE n 1 214 ASP n 1 215 LEU n 1 216 LYS n 1 217 LEU n 1 218 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 218 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ribB, D6U24_02240, ERS013198_00268, ERS013199_01247, ERS013202_00910, ERS013207_00669, FXE67_08125' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Vibrio cholerae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 666 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0H6NPW4_VIBCL _struct_ref.pdbx_db_accession A0A0H6NPW4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNQSSLLAEFGDPITRVENALQALREGRGVLLLDDEDRENEGDIIYAVESLTTAQMALMIRECSGIVCLCLTEAQADRLA LPPMVVNNNSANQTAFTVSIEAKHGVTTGVSAQDRVTTIKTAANPQAKPEDLARPGHVFPLRARAGGVLARRGHTEGTVD LMQMAGLQPAGVLCELTNPDGSMAKTPEIIEFGKLHNMPVLTIEDMVQYRIQFDLKLA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7UF5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 218 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0H6NPW4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 218 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 218 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FMT non-polymer . 'FORMIC ACID' ? 'C H2 O2' 46.025 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MN non-polymer . 'MANGANESE (II) ION' ? 'Mn 2' 54.938 N4O non-polymer . '(2R)-2-hydroxy-3-oxobutyl dihydrogen phosphate' ? 'C4 H9 O6 P' 184.084 N52 non-polymer . '(2R)-2-(dihydroxymethyl)-2-hydroxy-3-oxobutyl dihydrogen phosphate' ? 'C5 H11 O8 P' 230.110 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7UF5 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.30 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.61 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M lithium acetate, 12-18% w/v PEG3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-02-08 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97946 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRL BEAMLINE BL9-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97946 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL9-2 _diffrn_source.pdbx_synchrotron_site SSRL # _reflns.B_iso_Wilson_estimate 32.63 _reflns.entry_id 7UF5 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.10 _reflns.d_resolution_low 39.49 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13068 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.6 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.054 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.10 _reflns_shell.d_res_low 2.16 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1038 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.351 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 38.53 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7UF5 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.10 _refine.ls_d_res_low 39.49 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13043 _refine.ls_number_reflns_R_free 1305 _refine.ls_number_reflns_R_work 11738 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.91 _refine.ls_percent_reflns_R_free 10.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2086 _refine.ls_R_factor_R_free 0.2311 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2061 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB entry 4P8E' _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.9166 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2407 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 39.49 _refine_hist.number_atoms_solvent 64 _refine_hist.number_atoms_total 1665 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1572 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 29 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0151 ? 1624 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 2.1381 ? 2203 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.1859 ? 261 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0071 ? 289 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.1274 ? 607 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.10 2.18 . . 141 1275 99.93 . . . 0.3282 . 0.2614 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.18 2.28 . . 142 1281 99.79 . . . 0.3103 . 0.2358 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.28 2.40 . . 144 1287 99.86 . . . 0.2757 . 0.2284 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.40 2.55 . . 143 1279 99.79 . . . 0.2405 . 0.2332 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.55 2.75 . . 144 1299 100.00 . . . 0.2433 . 0.2316 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.75 3.03 . . 144 1299 100.00 . . . 0.2570 . 0.2182 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.03 3.47 . . 145 1307 99.93 . . . 0.2385 . 0.2164 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.47 4.36 . . 148 1327 99.93 . . . 0.1980 . 0.1819 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.37 39.49 . . 154 1384 99.94 . . . 0.1978 . 0.1824 . . . . . . . . . . . # _struct.entry_id 7UF5 _struct.title 'RibB from Vibrio cholera bound with intermediate 2 in the reaction cycle and the products DHBP and formate' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7UF5 _struct_keywords.text 'RibB, riboflavin, 3, 4-dihydroxy-2-butanone 4-phosphate synthase, LYASE' _struct_keywords.pdbx_keywords LYASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 2 ? ALA A 8 ? ASN A 2 ALA A 8 1 ? 7 HELX_P HELX_P2 AA2 GLU A 9 ? GLY A 11 ? GLU A 9 GLY A 11 5 ? 3 HELX_P HELX_P3 AA3 ASP A 12 ? GLU A 26 ? ASP A 12 GLU A 26 1 ? 15 HELX_P HELX_P4 AA4 THR A 52 ? CYS A 63 ? THR A 52 CYS A 63 1 ? 12 HELX_P HELX_P5 AA5 THR A 72 ? LEU A 79 ? THR A 72 LEU A 79 1 ? 8 HELX_P HELX_P6 AA6 SER A 111 ? ASN A 124 ? SER A 111 ASN A 124 1 ? 14 HELX_P HELX_P7 AA7 LYS A 128 ? GLU A 130 ? LYS A 128 GLU A 130 5 ? 3 HELX_P HELX_P8 AA8 GLY A 146 ? ALA A 150 ? GLY A 146 ALA A 150 5 ? 5 HELX_P HELX_P9 AA9 GLY A 153 ? ALA A 165 ? GLY A 153 ALA A 165 1 ? 13 HELX_P HELX_P10 AB1 LYS A 185 ? HIS A 196 ? LYS A 185 HIS A 196 1 ? 12 HELX_P HELX_P11 AB2 ILE A 203 ? PHE A 213 ? ILE A 203 PHE A 213 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 39 OE1 ? ? ? 1_555 E MN . MN ? ? A GLU 39 A MN 304 1_555 ? ? ? ? ? ? ? 2.432 ? ? metalc2 metalc ? ? A HIS 154 ND1 ? ? ? 1_555 E MN . MN ? ? A HIS 154 A MN 304 1_555 ? ? ? ? ? ? ? 2.458 ? ? metalc3 metalc ? ? B N52 . O08 A ? ? 1_555 E MN . MN ? ? A N52 301 A MN 304 1_555 ? ? ? ? ? ? ? 2.168 ? ? metalc4 metalc ? ? B N52 . O10 A ? ? 1_555 E MN . MN ? ? A N52 301 A MN 304 1_555 ? ? ? ? ? ? ? 1.760 ? ? metalc5 metalc ? ? B N52 . O14 A ? ? 1_555 E MN . MN ? ? A N52 301 A MN 304 1_555 ? ? ? ? ? ? ? 2.448 ? ? metalc6 metalc ? ? C N4O . O09 B ? ? 1_555 E MN . MN ? ? A N4O 302 A MN 304 1_555 ? ? ? ? ? ? ? 2.183 ? ? metalc7 metalc ? ? C N4O . O11 B ? ? 1_555 E MN . MN ? ? A N4O 302 A MN 304 1_555 ? ? ? ? ? ? ? 2.619 ? ? metalc8 metalc ? ? E MN . MN ? ? ? 1_555 F HOH . O ? ? A MN 304 A HOH 424 1_555 ? ? ? ? ? ? ? 2.420 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ARG _struct_mon_prot_cis.label_seq_id 134 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ARG _struct_mon_prot_cis.auth_seq_id 134 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 135 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 135 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.61 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 100 ? ALA A 102 ? ILE A 100 ALA A 102 AA1 2 LEU A 132 ? ARG A 142 ? LEU A 132 ARG A 142 AA1 3 CYS A 68 ? LEU A 71 ? CYS A 68 LEU A 71 AA1 4 GLY A 171 ? GLU A 175 ? GLY A 171 GLU A 175 AA1 5 GLY A 42 ? ALA A 47 ? GLY A 42 ALA A 47 AA1 6 VAL A 30 ? LEU A 33 ? VAL A 30 LEU A 33 AA1 7 VAL A 200 ? THR A 202 ? VAL A 200 THR A 202 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 101 ? N GLU A 101 O ALA A 133 ? O ALA A 133 AA1 2 3 O LEU A 141 ? O LEU A 141 N LEU A 71 ? N LEU A 71 AA1 3 4 N CYS A 68 ? N CYS A 68 O LEU A 173 ? O LEU A 173 AA1 4 5 O VAL A 172 ? O VAL A 172 N TYR A 46 ? N TYR A 46 AA1 5 6 O ILE A 45 ? O ILE A 45 N VAL A 30 ? N VAL A 30 AA1 6 7 N LEU A 33 ? N LEU A 33 O LEU A 201 ? O LEU A 201 # _atom_sites.entry_id 7UF5 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.016417 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012660 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011066 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? H ? ? 0.51345 0.48472 ? ? 24.73122 6.32584 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? MN ? ? 20.23591 4.67902 ? ? 2.76514 44.01191 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _database_PDB_caveat.text 'N52 A 301 HAS WRONG CHIRALITY AT ATOM C03' # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 GLU 18 18 18 GLU GLU A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 GLU 36 36 36 GLU GLU A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 ALA 54 54 54 ALA ALA A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 MET 59 59 59 MET MET A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 CYS 63 63 63 CYS CYS A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 GLY 65 65 65 GLY GLY A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 CYS 68 68 68 CYS CYS A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 CYS 70 70 70 CYS CYS A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 ASP 77 77 77 ASP ASP A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 ALA 80 80 80 ALA ALA A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 MET 84 84 84 MET MET A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 ASN 87 87 ? ? ? A . n A 1 88 ASN 88 88 ? ? ? A . n A 1 89 ASN 89 89 ? ? ? A . n A 1 90 SER 90 90 ? ? ? A . n A 1 91 ALA 91 91 ? ? ? A . n A 1 92 ASN 92 92 ? ? ? A . n A 1 93 GLN 93 93 ? ? ? A . n A 1 94 THR 94 94 ? ? ? A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 THR 97 97 97 THR THR A . n A 1 98 VAL 98 98 98 VAL VAL A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 HIS 104 104 104 HIS HIS A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 SER 111 111 111 SER SER A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 GLN 113 113 113 GLN GLN A . n A 1 114 ASP 114 114 114 ASP ASP A . n A 1 115 ARG 115 115 115 ARG ARG A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 THR 117 117 117 THR THR A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 ALA 122 122 122 ALA ALA A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 PRO 125 125 125 PRO PRO A . n A 1 126 GLN 126 126 126 GLN GLN A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 ARG 134 134 134 ARG ARG A . n A 1 135 PRO 135 135 135 PRO PRO A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 HIS 137 137 137 HIS HIS A . n A 1 138 VAL 138 138 138 VAL VAL A . n A 1 139 PHE 139 139 139 PHE PHE A . n A 1 140 PRO 140 140 140 PRO PRO A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 ARG 142 142 142 ARG ARG A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 ARG 144 144 144 ARG ARG A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 ARG 151 151 151 ARG ARG A . n A 1 152 ARG 152 152 152 ARG ARG A . n A 1 153 GLY 153 153 153 GLY GLY A . n A 1 154 HIS 154 154 154 HIS HIS A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 GLU 156 156 156 GLU GLU A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 THR 158 158 158 THR THR A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 ASP 160 160 160 ASP ASP A . n A 1 161 LEU 161 161 161 LEU LEU A . n A 1 162 MET 162 162 162 MET MET A . n A 1 163 GLN 163 163 163 GLN GLN A . n A 1 164 MET 164 164 164 MET MET A . n A 1 165 ALA 165 165 165 ALA ALA A . n A 1 166 GLY 166 166 166 GLY GLY A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 GLN 168 168 168 GLN GLN A . n A 1 169 PRO 169 169 169 PRO PRO A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 LEU 173 173 173 LEU LEU A . n A 1 174 CYS 174 174 174 CYS CYS A . n A 1 175 GLU 175 175 175 GLU GLU A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 THR 177 177 177 THR THR A . n A 1 178 ASN 178 178 178 ASN ASN A . n A 1 179 PRO 179 179 179 PRO PRO A . n A 1 180 ASP 180 180 180 ASP ASP A . n A 1 181 GLY 181 181 181 GLY GLY A . n A 1 182 SER 182 182 182 SER SER A . n A 1 183 MET 183 183 183 MET MET A . n A 1 184 ALA 184 184 184 ALA ALA A . n A 1 185 LYS 185 185 185 LYS LYS A . n A 1 186 THR 186 186 186 THR THR A . n A 1 187 PRO 187 187 187 PRO PRO A . n A 1 188 GLU 188 188 188 GLU GLU A . n A 1 189 ILE 189 189 189 ILE ILE A . n A 1 190 ILE 190 190 190 ILE ILE A . n A 1 191 GLU 191 191 191 GLU GLU A . n A 1 192 PHE 192 192 192 PHE PHE A . n A 1 193 GLY 193 193 193 GLY GLY A . n A 1 194 LYS 194 194 194 LYS LYS A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 HIS 196 196 196 HIS HIS A . n A 1 197 ASN 197 197 197 ASN ASN A . n A 1 198 MET 198 198 198 MET MET A . n A 1 199 PRO 199 199 199 PRO PRO A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 LEU 201 201 201 LEU LEU A . n A 1 202 THR 202 202 202 THR THR A . n A 1 203 ILE 203 203 203 ILE ILE A . n A 1 204 GLU 204 204 204 GLU GLU A . n A 1 205 ASP 205 205 205 ASP ASP A . n A 1 206 MET 206 206 206 MET MET A . n A 1 207 VAL 207 207 207 VAL VAL A . n A 1 208 GLN 208 208 208 GLN GLN A . n A 1 209 TYR 209 209 209 TYR TYR A . n A 1 210 ARG 210 210 210 ARG ARG A . n A 1 211 ILE 211 211 211 ILE ILE A . n A 1 212 GLN 212 212 212 GLN GLN A . n A 1 213 PHE 213 213 213 PHE PHE A . n A 1 214 ASP 214 214 214 ASP ASP A . n A 1 215 LEU 215 215 215 LEU LEU A . n A 1 216 LYS 216 216 216 LYS LYS A . n A 1 217 LEU 217 217 217 LEU LEU A . n A 1 218 ALA 218 218 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email audrey.lamb@utsa.edu _pdbx_contact_author.name_first Audrey _pdbx_contact_author.name_last Lamb _pdbx_contact_author.name_mi L _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-2352-2130 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 N52 1 301 1 N52 IN2 A . C 3 N4O 1 302 1 N4O DBP A . D 4 FMT 1 303 1 FMT FMT A . E 5 MN 1 304 1 MN MN A . F 6 HOH 1 401 64 HOH HOH A . F 6 HOH 2 402 1 HOH HOH A . F 6 HOH 3 403 3 HOH HOH A . F 6 HOH 4 404 17 HOH HOH A . F 6 HOH 5 405 32 HOH HOH A . F 6 HOH 6 406 15 HOH HOH A . F 6 HOH 7 407 39 HOH HOH A . F 6 HOH 8 408 2 HOH HOH A . F 6 HOH 9 409 8 HOH HOH A . F 6 HOH 10 410 19 HOH HOH A . F 6 HOH 11 411 4 HOH HOH A . F 6 HOH 12 412 29 HOH HOH A . F 6 HOH 13 413 7 HOH HOH A . F 6 HOH 14 414 16 HOH HOH A . F 6 HOH 15 415 25 HOH HOH A . F 6 HOH 16 416 18 HOH HOH A . F 6 HOH 17 417 22 HOH HOH A . F 6 HOH 18 418 60 HOH HOH A . F 6 HOH 19 419 62 HOH HOH A . F 6 HOH 20 420 6 HOH HOH A . F 6 HOH 21 421 21 HOH HOH A . F 6 HOH 22 422 34 HOH HOH A . F 6 HOH 23 423 45 HOH HOH A . F 6 HOH 24 424 63 HOH HOH A . F 6 HOH 25 425 9 HOH HOH A . F 6 HOH 26 426 42 HOH HOH A . F 6 HOH 27 427 41 HOH HOH A . F 6 HOH 28 428 27 HOH HOH A . F 6 HOH 29 429 23 HOH HOH A . F 6 HOH 30 430 5 HOH HOH A . F 6 HOH 31 431 35 HOH HOH A . F 6 HOH 32 432 10 HOH HOH A . F 6 HOH 33 433 12 HOH HOH A . F 6 HOH 34 434 43 HOH HOH A . F 6 HOH 35 435 13 HOH HOH A . F 6 HOH 36 436 31 HOH HOH A . F 6 HOH 37 437 36 HOH HOH A . F 6 HOH 38 438 50 HOH HOH A . F 6 HOH 39 439 14 HOH HOH A . F 6 HOH 40 440 54 HOH HOH A . F 6 HOH 41 441 44 HOH HOH A . F 6 HOH 42 442 26 HOH HOH A . F 6 HOH 43 443 30 HOH HOH A . F 6 HOH 44 444 40 HOH HOH A . F 6 HOH 45 445 11 HOH HOH A . F 6 HOH 46 446 38 HOH HOH A . F 6 HOH 47 447 20 HOH HOH A . F 6 HOH 48 448 61 HOH HOH A . F 6 HOH 49 449 28 HOH HOH A . F 6 HOH 50 450 53 HOH HOH A . F 6 HOH 51 451 37 HOH HOH A . F 6 HOH 52 452 59 HOH HOH A . F 6 HOH 53 453 57 HOH HOH A . F 6 HOH 54 454 56 HOH HOH A . F 6 HOH 55 455 52 HOH HOH A . F 6 HOH 56 456 33 HOH HOH A . F 6 HOH 57 457 55 HOH HOH A . F 6 HOH 58 458 51 HOH HOH A . F 6 HOH 59 459 47 HOH HOH A . F 6 HOH 60 460 58 HOH HOH A . F 6 HOH 61 461 46 HOH HOH A . F 6 HOH 62 462 24 HOH HOH A . F 6 HOH 63 463 49 HOH HOH A . F 6 HOH 64 464 48 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3410 ? 1 MORE -34 ? 1 'SSA (A^2)' 15720 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_555 -x,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 45.1835000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 414 ? F HOH . 2 1 A HOH 459 ? F HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 39 ? A GLU 39 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 ND1 ? A HIS 154 ? A HIS 154 ? 1_555 106.4 ? 2 OE1 ? A GLU 39 ? A GLU 39 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O08 A B N52 . ? A N52 301 ? 1_555 92.2 ? 3 ND1 ? A HIS 154 ? A HIS 154 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O08 A B N52 . ? A N52 301 ? 1_555 94.3 ? 4 OE1 ? A GLU 39 ? A GLU 39 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O10 A B N52 . ? A N52 301 ? 1_555 90.9 ? 5 ND1 ? A HIS 154 ? A HIS 154 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O10 A B N52 . ? A N52 301 ? 1_555 160.7 ? 6 O08 A B N52 . ? A N52 301 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O10 A B N52 . ? A N52 301 ? 1_555 93.4 ? 7 OE1 ? A GLU 39 ? A GLU 39 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O14 A B N52 . ? A N52 301 ? 1_555 141.5 ? 8 ND1 ? A HIS 154 ? A HIS 154 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O14 A B N52 . ? A N52 301 ? 1_555 108.5 ? 9 O08 A B N52 . ? A N52 301 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O14 A B N52 . ? A N52 301 ? 1_555 100.8 ? 10 O10 A B N52 . ? A N52 301 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O14 A B N52 . ? A N52 301 ? 1_555 52.6 ? 11 OE1 ? A GLU 39 ? A GLU 39 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O09 B C N4O . ? A N4O 302 ? 1_555 91.4 ? 12 ND1 ? A HIS 154 ? A HIS 154 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O09 B C N4O . ? A N4O 302 ? 1_555 98.6 ? 13 O08 A B N52 . ? A N52 301 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O09 B C N4O . ? A N4O 302 ? 1_555 4.4 ? 14 O10 A B N52 . ? A N52 301 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O09 B C N4O . ? A N4O 302 ? 1_555 89.2 ? 15 O14 A B N52 . ? A N52 301 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O09 B C N4O . ? A N4O 302 ? 1_555 98.9 ? 16 OE1 ? A GLU 39 ? A GLU 39 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O11 B C N4O . ? A N4O 302 ? 1_555 162.6 ? 17 ND1 ? A HIS 154 ? A HIS 154 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O11 B C N4O . ? A N4O 302 ? 1_555 88.0 ? 18 O08 A B N52 . ? A N52 301 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O11 B C N4O . ? A N4O 302 ? 1_555 96.5 ? 19 O10 A B N52 . ? A N52 301 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O11 B C N4O . ? A N4O 302 ? 1_555 73.5 ? 20 O14 A B N52 . ? A N52 301 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O11 B C N4O . ? A N4O 302 ? 1_555 21.5 ? 21 O09 B C N4O . ? A N4O 302 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O11 B C N4O . ? A N4O 302 ? 1_555 96.2 ? 22 OE1 ? A GLU 39 ? A GLU 39 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O ? F HOH . ? A HOH 424 ? 1_555 90.2 ? 23 ND1 ? A HIS 154 ? A HIS 154 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O ? F HOH . ? A HOH 424 ? 1_555 80.1 ? 24 O08 A B N52 . ? A N52 301 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O ? F HOH . ? A HOH 424 ? 1_555 174.3 ? 25 O10 A B N52 . ? A N52 301 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O ? F HOH . ? A HOH 424 ? 1_555 91.7 ? 26 O14 A B N52 . ? A N52 301 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O ? F HOH . ? A HOH 424 ? 1_555 80.4 ? 27 O09 B C N4O . ? A N4O 302 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O ? F HOH . ? A HOH 424 ? 1_555 178.2 ? 28 O11 B C N4O . ? A N4O 302 ? 1_555 MN ? E MN . ? A MN 304 ? 1_555 O ? F HOH . ? A HOH 424 ? 1_555 82.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-07-20 2 'Structure model' 1 1 2022-08-03 3 'Structure model' 1 2 2023-10-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation_author.identifier_ORCID' # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z+1/2 4 -x,-y,z+1/2 5 x+1/2,y+1/2,z 6 x+1/2,-y+1/2,-z 7 -x+1/2,y+1/2,-z+1/2 8 -x+1/2,-y+1/2,z+1/2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 1.20.1_4487 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 7UF5 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 39 ? ? C A FMT 303 ? C 1.61 2 1 OE2 A GLU 39 ? ? O12 A N52 301 ? A 2.09 3 1 O12 A N52 301 ? A O A HOH 401 ? ? 2.15 4 1 O2 A FMT 303 ? C O A HOH 401 ? ? 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 38 ? ? -97.68 -108.62 2 1 THR A 107 ? ? -111.49 -87.54 3 1 ARG A 152 ? ? -91.44 57.42 4 1 ASP A 214 ? ? 26.39 56.55 # _pdbx_validate_chiral.id 1 _pdbx_validate_chiral.PDB_model_num 1 _pdbx_validate_chiral.auth_atom_id C03 _pdbx_validate_chiral.label_alt_id A _pdbx_validate_chiral.auth_asym_id A _pdbx_validate_chiral.auth_comp_id N52 _pdbx_validate_chiral.auth_seq_id 301 _pdbx_validate_chiral.PDB_ins_code ? _pdbx_validate_chiral.details PLANAR _pdbx_validate_chiral.omega . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ASN 87 ? A ASN 87 3 1 Y 1 A ASN 88 ? A ASN 88 4 1 Y 1 A ASN 89 ? A ASN 89 5 1 Y 1 A SER 90 ? A SER 90 6 1 Y 1 A ALA 91 ? A ALA 91 7 1 Y 1 A ASN 92 ? A ASN 92 8 1 Y 1 A GLN 93 ? A GLN 93 9 1 Y 1 A THR 94 ? A THR 94 10 1 Y 1 A ALA 218 ? A ALA 218 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FMT C C N N 88 FMT O1 O N N 89 FMT O2 O N N 90 FMT H H N N 91 FMT HO2 H N N 92 GLN N N N N 93 GLN CA C N S 94 GLN C C N N 95 GLN O O N N 96 GLN CB C N N 97 GLN CG C N N 98 GLN CD C N N 99 GLN OE1 O N N 100 GLN NE2 N N N 101 GLN OXT O N N 102 GLN H H N N 103 GLN H2 H N N 104 GLN HA H N N 105 GLN HB2 H N N 106 GLN HB3 H N N 107 GLN HG2 H N N 108 GLN HG3 H N N 109 GLN HE21 H N N 110 GLN HE22 H N N 111 GLN HXT H N N 112 GLU N N N N 113 GLU CA C N S 114 GLU C C N N 115 GLU O O N N 116 GLU CB C N N 117 GLU CG C N N 118 GLU CD C N N 119 GLU OE1 O N N 120 GLU OE2 O N N 121 GLU OXT O N N 122 GLU H H N N 123 GLU H2 H N N 124 GLU HA H N N 125 GLU HB2 H N N 126 GLU HB3 H N N 127 GLU HG2 H N N 128 GLU HG3 H N N 129 GLU HE2 H N N 130 GLU HXT H N N 131 GLY N N N N 132 GLY CA C N N 133 GLY C C N N 134 GLY O O N N 135 GLY OXT O N N 136 GLY H H N N 137 GLY H2 H N N 138 GLY HA2 H N N 139 GLY HA3 H N N 140 GLY HXT H N N 141 HIS N N N N 142 HIS CA C N S 143 HIS C C N N 144 HIS O O N N 145 HIS CB C N N 146 HIS CG C Y N 147 HIS ND1 N Y N 148 HIS CD2 C Y N 149 HIS CE1 C Y N 150 HIS NE2 N Y N 151 HIS OXT O N N 152 HIS H H N N 153 HIS H2 H N N 154 HIS HA H N N 155 HIS HB2 H N N 156 HIS HB3 H N N 157 HIS HD1 H N N 158 HIS HD2 H N N 159 HIS HE1 H N N 160 HIS HE2 H N N 161 HIS HXT H N N 162 HOH O O N N 163 HOH H1 H N N 164 HOH H2 H N N 165 ILE N N N N 166 ILE CA C N S 167 ILE C C N N 168 ILE O O N N 169 ILE CB C N S 170 ILE CG1 C N N 171 ILE CG2 C N N 172 ILE CD1 C N N 173 ILE OXT O N N 174 ILE H H N N 175 ILE H2 H N N 176 ILE HA H N N 177 ILE HB H N N 178 ILE HG12 H N N 179 ILE HG13 H N N 180 ILE HG21 H N N 181 ILE HG22 H N N 182 ILE HG23 H N N 183 ILE HD11 H N N 184 ILE HD12 H N N 185 ILE HD13 H N N 186 ILE HXT H N N 187 LEU N N N N 188 LEU CA C N S 189 LEU C C N N 190 LEU O O N N 191 LEU CB C N N 192 LEU CG C N N 193 LEU CD1 C N N 194 LEU CD2 C N N 195 LEU OXT O N N 196 LEU H H N N 197 LEU H2 H N N 198 LEU HA H N N 199 LEU HB2 H N N 200 LEU HB3 H N N 201 LEU HG H N N 202 LEU HD11 H N N 203 LEU HD12 H N N 204 LEU HD13 H N N 205 LEU HD21 H N N 206 LEU HD22 H N N 207 LEU HD23 H N N 208 LEU HXT H N N 209 LYS N N N N 210 LYS CA C N S 211 LYS C C N N 212 LYS O O N N 213 LYS CB C N N 214 LYS CG C N N 215 LYS CD C N N 216 LYS CE C N N 217 LYS NZ N N N 218 LYS OXT O N N 219 LYS H H N N 220 LYS H2 H N N 221 LYS HA H N N 222 LYS HB2 H N N 223 LYS HB3 H N N 224 LYS HG2 H N N 225 LYS HG3 H N N 226 LYS HD2 H N N 227 LYS HD3 H N N 228 LYS HE2 H N N 229 LYS HE3 H N N 230 LYS HZ1 H N N 231 LYS HZ2 H N N 232 LYS HZ3 H N N 233 LYS HXT H N N 234 MET N N N N 235 MET CA C N S 236 MET C C N N 237 MET O O N N 238 MET CB C N N 239 MET CG C N N 240 MET SD S N N 241 MET CE C N N 242 MET OXT O N N 243 MET H H N N 244 MET H2 H N N 245 MET HA H N N 246 MET HB2 H N N 247 MET HB3 H N N 248 MET HG2 H N N 249 MET HG3 H N N 250 MET HE1 H N N 251 MET HE2 H N N 252 MET HE3 H N N 253 MET HXT H N N 254 MN MN MN N N 255 N4O C01 C N N 256 N4O C02 C N N 257 N4O C03 C N R 258 N4O C05 C N N 259 N4O O04 O N N 260 N4O O06 O N N 261 N4O O08 O N N 262 N4O O09 O N N 263 N4O O10 O N N 264 N4O O11 O N N 265 N4O P07 P N N 266 N4O H012 H N N 267 N4O H013 H N N 268 N4O H011 H N N 269 N4O H031 H N N 270 N4O H052 H N N 271 N4O H051 H N N 272 N4O H041 H N N 273 N4O H1 H N N 274 N4O H2 H N N 275 N52 C11 C N N 276 N52 C01 C N N 277 N52 C02 C N N 278 N52 C03 C N R 279 N52 C04 C N N 280 N52 O05 O N N 281 N52 O07 O N N 282 N52 O08 O N N 283 N52 O09 O N N 284 N52 O10 O N N 285 N52 O12 O N N 286 N52 O13 O N N 287 N52 O14 O N N 288 N52 P06 P N N 289 N52 H012 H N N 290 N52 H013 H N N 291 N52 H011 H N N 292 N52 H041 H N N 293 N52 H042 H N N 294 N52 H1 H N N 295 N52 H2 H N N 296 N52 H101 H N N 297 N52 H121 H N N 298 N52 H131 H N N 299 N52 H111 H N N 300 PHE N N N N 301 PHE CA C N S 302 PHE C C N N 303 PHE O O N N 304 PHE CB C N N 305 PHE CG C Y N 306 PHE CD1 C Y N 307 PHE CD2 C Y N 308 PHE CE1 C Y N 309 PHE CE2 C Y N 310 PHE CZ C Y N 311 PHE OXT O N N 312 PHE H H N N 313 PHE H2 H N N 314 PHE HA H N N 315 PHE HB2 H N N 316 PHE HB3 H N N 317 PHE HD1 H N N 318 PHE HD2 H N N 319 PHE HE1 H N N 320 PHE HE2 H N N 321 PHE HZ H N N 322 PHE HXT H N N 323 PRO N N N N 324 PRO CA C N S 325 PRO C C N N 326 PRO O O N N 327 PRO CB C N N 328 PRO CG C N N 329 PRO CD C N N 330 PRO OXT O N N 331 PRO H H N N 332 PRO HA H N N 333 PRO HB2 H N N 334 PRO HB3 H N N 335 PRO HG2 H N N 336 PRO HG3 H N N 337 PRO HD2 H N N 338 PRO HD3 H N N 339 PRO HXT H N N 340 SER N N N N 341 SER CA C N S 342 SER C C N N 343 SER O O N N 344 SER CB C N N 345 SER OG O N N 346 SER OXT O N N 347 SER H H N N 348 SER H2 H N N 349 SER HA H N N 350 SER HB2 H N N 351 SER HB3 H N N 352 SER HG H N N 353 SER HXT H N N 354 THR N N N N 355 THR CA C N S 356 THR C C N N 357 THR O O N N 358 THR CB C N R 359 THR OG1 O N N 360 THR CG2 C N N 361 THR OXT O N N 362 THR H H N N 363 THR H2 H N N 364 THR HA H N N 365 THR HB H N N 366 THR HG1 H N N 367 THR HG21 H N N 368 THR HG22 H N N 369 THR HG23 H N N 370 THR HXT H N N 371 TYR N N N N 372 TYR CA C N S 373 TYR C C N N 374 TYR O O N N 375 TYR CB C N N 376 TYR CG C Y N 377 TYR CD1 C Y N 378 TYR CD2 C Y N 379 TYR CE1 C Y N 380 TYR CE2 C Y N 381 TYR CZ C Y N 382 TYR OH O N N 383 TYR OXT O N N 384 TYR H H N N 385 TYR H2 H N N 386 TYR HA H N N 387 TYR HB2 H N N 388 TYR HB3 H N N 389 TYR HD1 H N N 390 TYR HD2 H N N 391 TYR HE1 H N N 392 TYR HE2 H N N 393 TYR HH H N N 394 TYR HXT H N N 395 VAL N N N N 396 VAL CA C N S 397 VAL C C N N 398 VAL O O N N 399 VAL CB C N N 400 VAL CG1 C N N 401 VAL CG2 C N N 402 VAL OXT O N N 403 VAL H H N N 404 VAL H2 H N N 405 VAL HA H N N 406 VAL HB H N N 407 VAL HG11 H N N 408 VAL HG12 H N N 409 VAL HG13 H N N 410 VAL HG21 H N N 411 VAL HG22 H N N 412 VAL HG23 H N N 413 VAL HXT H N N 414 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 FMT C O1 doub N N 83 FMT C O2 sing N N 84 FMT C H sing N N 85 FMT O2 HO2 sing N N 86 GLN N CA sing N N 87 GLN N H sing N N 88 GLN N H2 sing N N 89 GLN CA C sing N N 90 GLN CA CB sing N N 91 GLN CA HA sing N N 92 GLN C O doub N N 93 GLN C OXT sing N N 94 GLN CB CG sing N N 95 GLN CB HB2 sing N N 96 GLN CB HB3 sing N N 97 GLN CG CD sing N N 98 GLN CG HG2 sing N N 99 GLN CG HG3 sing N N 100 GLN CD OE1 doub N N 101 GLN CD NE2 sing N N 102 GLN NE2 HE21 sing N N 103 GLN NE2 HE22 sing N N 104 GLN OXT HXT sing N N 105 GLU N CA sing N N 106 GLU N H sing N N 107 GLU N H2 sing N N 108 GLU CA C sing N N 109 GLU CA CB sing N N 110 GLU CA HA sing N N 111 GLU C O doub N N 112 GLU C OXT sing N N 113 GLU CB CG sing N N 114 GLU CB HB2 sing N N 115 GLU CB HB3 sing N N 116 GLU CG CD sing N N 117 GLU CG HG2 sing N N 118 GLU CG HG3 sing N N 119 GLU CD OE1 doub N N 120 GLU CD OE2 sing N N 121 GLU OE2 HE2 sing N N 122 GLU OXT HXT sing N N 123 GLY N CA sing N N 124 GLY N H sing N N 125 GLY N H2 sing N N 126 GLY CA C sing N N 127 GLY CA HA2 sing N N 128 GLY CA HA3 sing N N 129 GLY C O doub N N 130 GLY C OXT sing N N 131 GLY OXT HXT sing N N 132 HIS N CA sing N N 133 HIS N H sing N N 134 HIS N H2 sing N N 135 HIS CA C sing N N 136 HIS CA CB sing N N 137 HIS CA HA sing N N 138 HIS C O doub N N 139 HIS C OXT sing N N 140 HIS CB CG sing N N 141 HIS CB HB2 sing N N 142 HIS CB HB3 sing N N 143 HIS CG ND1 sing Y N 144 HIS CG CD2 doub Y N 145 HIS ND1 CE1 doub Y N 146 HIS ND1 HD1 sing N N 147 HIS CD2 NE2 sing Y N 148 HIS CD2 HD2 sing N N 149 HIS CE1 NE2 sing Y N 150 HIS CE1 HE1 sing N N 151 HIS NE2 HE2 sing N N 152 HIS OXT HXT sing N N 153 HOH O H1 sing N N 154 HOH O H2 sing N N 155 ILE N CA sing N N 156 ILE N H sing N N 157 ILE N H2 sing N N 158 ILE CA C sing N N 159 ILE CA CB sing N N 160 ILE CA HA sing N N 161 ILE C O doub N N 162 ILE C OXT sing N N 163 ILE CB CG1 sing N N 164 ILE CB CG2 sing N N 165 ILE CB HB sing N N 166 ILE CG1 CD1 sing N N 167 ILE CG1 HG12 sing N N 168 ILE CG1 HG13 sing N N 169 ILE CG2 HG21 sing N N 170 ILE CG2 HG22 sing N N 171 ILE CG2 HG23 sing N N 172 ILE CD1 HD11 sing N N 173 ILE CD1 HD12 sing N N 174 ILE CD1 HD13 sing N N 175 ILE OXT HXT sing N N 176 LEU N CA sing N N 177 LEU N H sing N N 178 LEU N H2 sing N N 179 LEU CA C sing N N 180 LEU CA CB sing N N 181 LEU CA HA sing N N 182 LEU C O doub N N 183 LEU C OXT sing N N 184 LEU CB CG sing N N 185 LEU CB HB2 sing N N 186 LEU CB HB3 sing N N 187 LEU CG CD1 sing N N 188 LEU CG CD2 sing N N 189 LEU CG HG sing N N 190 LEU CD1 HD11 sing N N 191 LEU CD1 HD12 sing N N 192 LEU CD1 HD13 sing N N 193 LEU CD2 HD21 sing N N 194 LEU CD2 HD22 sing N N 195 LEU CD2 HD23 sing N N 196 LEU OXT HXT sing N N 197 LYS N CA sing N N 198 LYS N H sing N N 199 LYS N H2 sing N N 200 LYS CA C sing N N 201 LYS CA CB sing N N 202 LYS CA HA sing N N 203 LYS C O doub N N 204 LYS C OXT sing N N 205 LYS CB CG sing N N 206 LYS CB HB2 sing N N 207 LYS CB HB3 sing N N 208 LYS CG CD sing N N 209 LYS CG HG2 sing N N 210 LYS CG HG3 sing N N 211 LYS CD CE sing N N 212 LYS CD HD2 sing N N 213 LYS CD HD3 sing N N 214 LYS CE NZ sing N N 215 LYS CE HE2 sing N N 216 LYS CE HE3 sing N N 217 LYS NZ HZ1 sing N N 218 LYS NZ HZ2 sing N N 219 LYS NZ HZ3 sing N N 220 LYS OXT HXT sing N N 221 MET N CA sing N N 222 MET N H sing N N 223 MET N H2 sing N N 224 MET CA C sing N N 225 MET CA CB sing N N 226 MET CA HA sing N N 227 MET C O doub N N 228 MET C OXT sing N N 229 MET CB CG sing N N 230 MET CB HB2 sing N N 231 MET CB HB3 sing N N 232 MET CG SD sing N N 233 MET CG HG2 sing N N 234 MET CG HG3 sing N N 235 MET SD CE sing N N 236 MET CE HE1 sing N N 237 MET CE HE2 sing N N 238 MET CE HE3 sing N N 239 MET OXT HXT sing N N 240 N4O O09 P07 doub N N 241 N4O O08 P07 sing N N 242 N4O O10 P07 sing N N 243 N4O P07 O06 sing N N 244 N4O O06 C05 sing N N 245 N4O O11 C02 doub N N 246 N4O C03 C05 sing N N 247 N4O C03 C02 sing N N 248 N4O C03 O04 sing N N 249 N4O C02 C01 sing N N 250 N4O C01 H012 sing N N 251 N4O C01 H013 sing N N 252 N4O C01 H011 sing N N 253 N4O C03 H031 sing N N 254 N4O C05 H052 sing N N 255 N4O C05 H051 sing N N 256 N4O O04 H041 sing N N 257 N4O O08 H1 sing N N 258 N4O O10 H2 sing N N 259 N52 O08 P06 doub N N 260 N52 O07 P06 sing N N 261 N52 P06 O09 sing N N 262 N52 P06 O05 sing N N 263 N52 O12 C11 sing N N 264 N52 O10 C03 sing N N 265 N52 C03 C11 sing N N 266 N52 C03 C04 sing N N 267 N52 C03 C02 sing N N 268 N52 O05 C04 sing N N 269 N52 C11 O13 sing N N 270 N52 O14 C02 doub N N 271 N52 C02 C01 sing N N 272 N52 C01 H012 sing N N 273 N52 C01 H013 sing N N 274 N52 C01 H011 sing N N 275 N52 C04 H041 sing N N 276 N52 C04 H042 sing N N 277 N52 O07 H1 sing N N 278 N52 O09 H2 sing N N 279 N52 O10 H101 sing N N 280 N52 O12 H121 sing N N 281 N52 O13 H131 sing N N 282 N52 C11 H111 sing N N 283 PHE N CA sing N N 284 PHE N H sing N N 285 PHE N H2 sing N N 286 PHE CA C sing N N 287 PHE CA CB sing N N 288 PHE CA HA sing N N 289 PHE C O doub N N 290 PHE C OXT sing N N 291 PHE CB CG sing N N 292 PHE CB HB2 sing N N 293 PHE CB HB3 sing N N 294 PHE CG CD1 doub Y N 295 PHE CG CD2 sing Y N 296 PHE CD1 CE1 sing Y N 297 PHE CD1 HD1 sing N N 298 PHE CD2 CE2 doub Y N 299 PHE CD2 HD2 sing N N 300 PHE CE1 CZ doub Y N 301 PHE CE1 HE1 sing N N 302 PHE CE2 CZ sing Y N 303 PHE CE2 HE2 sing N N 304 PHE CZ HZ sing N N 305 PHE OXT HXT sing N N 306 PRO N CA sing N N 307 PRO N CD sing N N 308 PRO N H sing N N 309 PRO CA C sing N N 310 PRO CA CB sing N N 311 PRO CA HA sing N N 312 PRO C O doub N N 313 PRO C OXT sing N N 314 PRO CB CG sing N N 315 PRO CB HB2 sing N N 316 PRO CB HB3 sing N N 317 PRO CG CD sing N N 318 PRO CG HG2 sing N N 319 PRO CG HG3 sing N N 320 PRO CD HD2 sing N N 321 PRO CD HD3 sing N N 322 PRO OXT HXT sing N N 323 SER N CA sing N N 324 SER N H sing N N 325 SER N H2 sing N N 326 SER CA C sing N N 327 SER CA CB sing N N 328 SER CA HA sing N N 329 SER C O doub N N 330 SER C OXT sing N N 331 SER CB OG sing N N 332 SER CB HB2 sing N N 333 SER CB HB3 sing N N 334 SER OG HG sing N N 335 SER OXT HXT sing N N 336 THR N CA sing N N 337 THR N H sing N N 338 THR N H2 sing N N 339 THR CA C sing N N 340 THR CA CB sing N N 341 THR CA HA sing N N 342 THR C O doub N N 343 THR C OXT sing N N 344 THR CB OG1 sing N N 345 THR CB CG2 sing N N 346 THR CB HB sing N N 347 THR OG1 HG1 sing N N 348 THR CG2 HG21 sing N N 349 THR CG2 HG22 sing N N 350 THR CG2 HG23 sing N N 351 THR OXT HXT sing N N 352 TYR N CA sing N N 353 TYR N H sing N N 354 TYR N H2 sing N N 355 TYR CA C sing N N 356 TYR CA CB sing N N 357 TYR CA HA sing N N 358 TYR C O doub N N 359 TYR C OXT sing N N 360 TYR CB CG sing N N 361 TYR CB HB2 sing N N 362 TYR CB HB3 sing N N 363 TYR CG CD1 doub Y N 364 TYR CG CD2 sing Y N 365 TYR CD1 CE1 sing Y N 366 TYR CD1 HD1 sing N N 367 TYR CD2 CE2 doub Y N 368 TYR CD2 HD2 sing N N 369 TYR CE1 CZ doub Y N 370 TYR CE1 HE1 sing N N 371 TYR CE2 CZ sing Y N 372 TYR CE2 HE2 sing N N 373 TYR CZ OH sing N N 374 TYR OH HH sing N N 375 TYR OXT HXT sing N N 376 VAL N CA sing N N 377 VAL N H sing N N 378 VAL N H2 sing N N 379 VAL CA C sing N N 380 VAL CA CB sing N N 381 VAL CA HA sing N N 382 VAL C O doub N N 383 VAL C OXT sing N N 384 VAL CB CG1 sing N N 385 VAL CB CG2 sing N N 386 VAL CB HB sing N N 387 VAL CG1 HG11 sing N N 388 VAL CG1 HG12 sing N N 389 VAL CG1 HG13 sing N N 390 VAL CG2 HG21 sing N N 391 VAL CG2 HG22 sing N N 392 VAL CG2 HG23 sing N N 393 VAL OXT HXT sing N N 394 # _pdbx_audit_support.funding_organization 'National Science Foundation (NSF, United States)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 1904494 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 N4O ? ? N4O ? ? 'SUBJECT OF INVESTIGATION' ? 2 N52 ? ? N52 ? ? 'SUBJECT OF INVESTIGATION' ? 3 FMT ? ? FMT ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(2R)-2-(dihydroxymethyl)-2-hydroxy-3-oxobutyl dihydrogen phosphate' N52 3 '(2R)-2-hydroxy-3-oxobutyl dihydrogen phosphate' N4O 4 'FORMIC ACID' FMT 5 'MANGANESE (II) ION' MN 6 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4P8E _pdbx_initial_refinement_model.details 'PDB entry 4P8E' # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'C 2 2 21' _space_group.name_Hall 'C 2c 2' _space_group.IT_number 20 _space_group.crystal_system orthorhombic _space_group.id 1 #