data_7UI8 # _entry.id 7UI8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7UI8 pdb_00007ui8 10.2210/pdb7ui8/pdb WWPDB D_1000264238 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-04-05 2 'Structure model' 1 1 2023-10-25 3 'Structure model' 1 2 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' 3 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model 4 3 'Structure model' pdbx_entry_details 5 3 'Structure model' pdbx_modification_feature # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7UI8 _pdbx_database_status.recvd_initial_deposition_date 2022-03-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 3 _pdbx_contact_author.email p.young@auckland.ac.nz _pdbx_contact_author.name_first Paul _pdbx_contact_author.name_last Young _pdbx_contact_author.name_mi G _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7325-1869 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wardega, J.K.' 1 ? 'Squire, C.J.' 2 ? 'Young, P.G.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Intramolecular ester bond-containing repeat domain from E. columbae adhesin (split and religated)' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wardega, J.K.' 1 ? primary 'Squire, C.J.' 2 ? primary 'Young, P.G.' 3 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Split ester bond-containing adhesin repeat domain' 13678.986 1 ? ? 'C-terminal portion of domain' ? 2 polymer syn GLY-ASP-THR-LYS-HIS-GLU-VAL-ARG-HIS-GLU-ASN-PRO-GLN-ASP-GLU-ALA-GLN-THR-ILE-VAL-VAL-ASN-LYS 2649.845 1 ? ? ? 'complementary strand to complete split domain chain A' 3 water nat water 18.015 10 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GAKEYTNPKEGQLATTVSVKNNESTTPVRLLSKDTQGVEVTDTVSYSDLVGGKVYELTGTLMQIKADGSTEAIASASKEV TAETSGKGTWELTFAPQNLKAGEKYVVYEVAKSKENLVDSNKDDESHG ; ;GAKEYTNPKEGQLATTVSVKNNESTTPVRLLSKDTQGVEVTDTVSYSDLVGGKVYELTGTLMQIKADGSTEAIASASKEV TAETSGKGTWELTFAPQNLKAGEKYVVYEVAKSKENLVDSNKDDESHG ; A ? 2 'polypeptide(L)' no no GDTKHEVRHENPQDEAQTIVVNK GDTKHEVRHENPQDEAQTIVVNK B ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 LYS n 1 4 GLU n 1 5 TYR n 1 6 THR n 1 7 ASN n 1 8 PRO n 1 9 LYS n 1 10 GLU n 1 11 GLY n 1 12 GLN n 1 13 LEU n 1 14 ALA n 1 15 THR n 1 16 THR n 1 17 VAL n 1 18 SER n 1 19 VAL n 1 20 LYS n 1 21 ASN n 1 22 ASN n 1 23 GLU n 1 24 SER n 1 25 THR n 1 26 THR n 1 27 PRO n 1 28 VAL n 1 29 ARG n 1 30 LEU n 1 31 LEU n 1 32 SER n 1 33 LYS n 1 34 ASP n 1 35 THR n 1 36 GLN n 1 37 GLY n 1 38 VAL n 1 39 GLU n 1 40 VAL n 1 41 THR n 1 42 ASP n 1 43 THR n 1 44 VAL n 1 45 SER n 1 46 TYR n 1 47 SER n 1 48 ASP n 1 49 LEU n 1 50 VAL n 1 51 GLY n 1 52 GLY n 1 53 LYS n 1 54 VAL n 1 55 TYR n 1 56 GLU n 1 57 LEU n 1 58 THR n 1 59 GLY n 1 60 THR n 1 61 LEU n 1 62 MET n 1 63 GLN n 1 64 ILE n 1 65 LYS n 1 66 ALA n 1 67 ASP n 1 68 GLY n 1 69 SER n 1 70 THR n 1 71 GLU n 1 72 ALA n 1 73 ILE n 1 74 ALA n 1 75 SER n 1 76 ALA n 1 77 SER n 1 78 LYS n 1 79 GLU n 1 80 VAL n 1 81 THR n 1 82 ALA n 1 83 GLU n 1 84 THR n 1 85 SER n 1 86 GLY n 1 87 LYS n 1 88 GLY n 1 89 THR n 1 90 TRP n 1 91 GLU n 1 92 LEU n 1 93 THR n 1 94 PHE n 1 95 ALA n 1 96 PRO n 1 97 GLN n 1 98 ASN n 1 99 LEU n 1 100 LYS n 1 101 ALA n 1 102 GLY n 1 103 GLU n 1 104 LYS n 1 105 TYR n 1 106 VAL n 1 107 VAL n 1 108 TYR n 1 109 GLU n 1 110 VAL n 1 111 ALA n 1 112 LYS n 1 113 SER n 1 114 LYS n 1 115 GLU n 1 116 ASN n 1 117 LEU n 1 118 VAL n 1 119 ASP n 1 120 SER n 1 121 ASN n 1 122 LYS n 1 123 ASP n 1 124 ASP n 1 125 GLU n 1 126 SER n 1 127 HIS n 1 128 GLY n 2 1 GLY n 2 2 ASP n 2 3 THR n 2 4 LYS n 2 5 HIS n 2 6 GLU n 2 7 VAL n 2 8 ARG n 2 9 HIS n 2 10 GLU n 2 11 ASN n 2 12 PRO n 2 13 GLN n 2 14 ASP n 2 15 GLU n 2 16 ALA n 2 17 GLN n 2 18 THR n 2 19 ILE n 2 20 VAL n 2 21 VAL n 2 22 ASN n 2 23 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 128 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene I568_02374 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterococcus columbae' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1355 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pPROEXT-HTa _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 23 _pdbx_entity_src_syn.organism_scientific 'Enterococcus columbae' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 1355 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 ALA 2 2 ? ? ? A . n A 1 3 LYS 3 3 ? ? ? A . n A 1 4 GLU 4 4 ? ? ? A . n A 1 5 TYR 5 5 ? ? ? A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 GLN 12 12 12 GLN GLN A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 SER 18 18 18 SER SER A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 ASN 22 22 22 ASN ASN A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ARG 29 29 29 ARG ARG A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 TYR 55 55 55 TYR TYR A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 MET 62 62 62 MET MET A . n A 1 63 GLN 63 63 63 GLN GLN A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 ALA 72 72 72 ALA ALA A . n A 1 73 ILE 73 73 73 ILE ILE A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 SER 75 75 75 SER SER A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 SER 77 77 77 SER SER A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 THR 81 81 81 THR THR A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 TRP 90 90 90 TRP TRP A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 GLN 97 97 97 GLN GLN A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 ALA 101 101 101 ALA ALA A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 TYR 105 105 105 TYR TYR A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 VAL 107 107 107 VAL VAL A . n A 1 108 TYR 108 108 108 TYR TYR A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 LYS 114 114 114 LYS LYS A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 ASN 116 116 116 ASN ASN A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 ASP 119 119 ? ? ? A . n A 1 120 SER 120 120 ? ? ? A . n A 1 121 ASN 121 121 ? ? ? A . n A 1 122 LYS 122 122 ? ? ? A . n A 1 123 ASP 123 123 ? ? ? A . n A 1 124 ASP 124 124 ? ? ? A . n A 1 125 GLU 125 125 ? ? ? A . n A 1 126 SER 126 126 ? ? ? A . n A 1 127 HIS 127 127 ? ? ? A . n A 1 128 GLY 128 128 ? ? ? A . n B 2 1 GLY 1 129 129 GLY GLY B . n B 2 2 ASP 2 130 130 ASP ASP B . n B 2 3 THR 3 131 131 THR THR B . n B 2 4 LYS 4 132 132 LYS LYS B . n B 2 5 HIS 5 133 133 HIS HIS B . n B 2 6 GLU 6 134 134 GLU GLU B . n B 2 7 VAL 7 135 135 VAL VAL B . n B 2 8 ARG 8 136 136 ARG ARG B . n B 2 9 HIS 9 137 137 HIS HIS B . n B 2 10 GLU 10 138 138 GLU GLU B . n B 2 11 ASN 11 139 139 ASN ASN B . n B 2 12 PRO 12 140 140 PRO PRO B . n B 2 13 GLN 13 141 141 GLN GLN B . n B 2 14 ASP 14 142 142 ASP ASP B . n B 2 15 GLU 15 143 143 GLU GLU B . n B 2 16 ALA 16 144 144 ALA ALA B . n B 2 17 GLN 17 145 145 GLN GLN B . n B 2 18 THR 18 146 146 THR THR B . n B 2 19 ILE 19 147 147 ILE ILE B . n B 2 20 VAL 20 148 148 VAL VAL B . n B 2 21 VAL 21 149 149 VAL VAL B . n B 2 22 ASN 22 150 150 ASN ASN B . n B 2 23 LYS 23 151 151 LYS LYS B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 201 9 HOH HOH A . C 3 HOH 2 202 6 HOH HOH A . C 3 HOH 3 203 4 HOH HOH A . C 3 HOH 4 204 8 HOH HOH A . C 3 HOH 5 205 7 HOH HOH A . C 3 HOH 6 206 1 HOH HOH A . C 3 HOH 7 207 3 HOH HOH A . D 3 HOH 1 201 10 HOH HOH B . D 3 HOH 2 202 2 HOH HOH B . D 3 HOH 3 203 5 HOH HOH B . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 56 ? CG ? A GLU 56 CG 2 1 Y 1 A GLU 56 ? CD ? A GLU 56 CD 3 1 Y 1 A GLU 56 ? OE1 ? A GLU 56 OE1 4 1 Y 1 A GLU 56 ? OE2 ? A GLU 56 OE2 5 1 Y 1 A LYS 114 ? CG ? A LYS 114 CG 6 1 Y 1 A LYS 114 ? CD ? A LYS 114 CD 7 1 Y 1 A LYS 114 ? CE ? A LYS 114 CE 8 1 Y 1 A LYS 114 ? NZ ? A LYS 114 NZ 9 1 Y 1 B LYS 151 ? CG ? B LYS 23 CG 10 1 Y 1 B LYS 151 ? CD ? B LYS 23 CD 11 1 Y 1 B LYS 151 ? CE ? B LYS 23 CE 12 1 Y 1 B LYS 151 ? NZ ? B LYS 23 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7UI8 _cell.details ? _cell.formula_units_Z ? _cell.length_a 120.775 _cell.length_a_esd ? _cell.length_b 120.775 _cell.length_b_esd ? _cell.length_c 45.444 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7UI8 _symmetry.cell_setting ? _symmetry.Int_Tables_number 177 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 6 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7UI8 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.93 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 58.02 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '3.2 M ammonium sulfate, 0.1 M sodium citrate, pH 5.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 S 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-03-07 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.95366 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.95366 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX2 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate 53.6 _reflns.entry_id 7UI8 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.37 _reflns.d_resolution_low 45.44 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8323 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 18.6 _reflns.pdbx_Rmerge_I_obs 0.187 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.54 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.193 _reflns.pdbx_Rpim_I_all 0.045 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.37 _reflns_shell.d_res_low 2.46 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.9 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 206 _reflns_shell.percent_possible_all 94.5 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 17.6 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared 0.43 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 0.593 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.806 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.035 _refine.aniso_B[1][2] 0.017 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] 0.035 _refine.aniso_B[2][3] -0.000 _refine.aniso_B[3][3] -0.113 _refine.B_iso_max ? _refine.B_iso_mean 59.756 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.946 _refine.correlation_coeff_Fo_to_Fc_free 0.919 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7UI8 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.373 _refine.ls_d_res_low 40.003 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8247 _refine.ls_number_reflns_R_free 401 _refine.ls_number_reflns_R_work 7846 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.956 _refine.ls_percent_reflns_R_free 4.862 _refine.ls_R_factor_all 0.228 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2614 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2260 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'BABINET MODEL PLUS MASK' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4NI6 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.287 _refine.pdbx_overall_ESU_R_Free 0.229 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 11.298 _refine.overall_SU_ML 0.234 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1016 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 10 _refine_hist.number_atoms_total 1026 _refine_hist.d_res_high 2.373 _refine_hist.d_res_low 40.003 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 0.013 1028 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.015 971 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.299 1.655 1394 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.130 1.588 2248 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.257 5.000 134 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 45.379 26.279 43 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.439 15.000 179 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 23.493 15.000 2 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.037 0.200 146 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 0.020 1161 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 195 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.182 0.200 155 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.167 0.200 860 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.139 0.200 472 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.069 0.200 545 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.120 0.200 30 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.163 0.200 12 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.188 0.200 52 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.131 0.200 2 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 2.321 6.248 542 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.317 6.246 541 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.631 9.365 674 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.630 9.367 675 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 3.296 6.674 486 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 3.293 6.675 487 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 5.197 9.825 720 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 5.194 9.825 720 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 6.610 71.721 1004 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 6.605 71.537 1001 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.373 2.739 2819 . 143 2594 97.0912 . 0.335 . 0.361 . 0.334 . . . . . 0.325 . 4 . 0.693 0.675 'X-RAY DIFFRACTION' 2.739 3.350 2422 . 110 2312 100.0000 . 0.254 . 0.286 . 0.252 . . . . . 0.228 . 4 . 0.900 0.868 'X-RAY DIFFRACTION' 3.350 4.722 1920 . 95 1825 100.0000 . 0.186 . 0.228 . 0.183 . . . . . 0.166 . 4 . 0.957 0.943 'X-RAY DIFFRACTION' 4.722 40.003 1168 . 53 1115 100.0000 . 0.218 . 0.244 . 0.217 . . . . . 0.206 . 4 . 0.952 0.927 # _struct.entry_id 7UI8 _struct.title 'Intramolecular ester bond-containing repeat domain from E. columbae adhesin (split and religated)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7UI8 _struct_keywords.text 'Repeat domain, adhesin, intramolecular ester bond, Ig-like fold, CELL ADHESION' _struct_keywords.pdbx_keywords 'CELL ADHESION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP S1N325_9ENTE S1N325 ? 1 ;KEYTNPKEGQLATTVSVKNNESTTPVRLLSKDTQGVEVTDTVSYSDLVGGKVYELTGTLMQIKADGSTEAIASASKEVTA ETSGKGTWELTFAPQNLKAGEKYVVYEVAKSKENLVDSNKDDE ; 502 2 UNP S1N325_9ENTE S1N325 ? 2 PDTKHEVRHENPQDEAQTIVVNK 625 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7UI8 A 3 ? 125 ? S1N325 502 ? 624 ? 3 125 2 2 7UI8 B 1 ? 23 ? S1N325 625 ? 647 ? 129 151 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7UI8 GLY A 1 ? UNP S1N325 ? ? 'expression tag' 1 1 1 7UI8 ALA A 2 ? UNP S1N325 ? ? 'expression tag' 2 2 1 7UI8 SER A 126 ? UNP S1N325 ? ? 'expression tag' 126 3 1 7UI8 HIS A 127 ? UNP S1N325 ? ? 'expression tag' 127 4 1 7UI8 GLY A 128 ? UNP S1N325 ? ? 'expression tag' 128 5 2 7UI8 GLY B 1 ? UNP S1N325 PRO 625 conflict 129 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3020 ? 1 MORE -15 ? 1 'SSA (A^2)' 7150 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 31 ? THR A 35 ? LEU A 31 THR A 35 5 ? 5 HELX_P HELX_P2 AA2 ASP B 14 ? ALA B 16 ? ASP B 142 ALA B 144 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag none _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id THR _struct_conn.ptnr1_label_seq_id 15 _struct_conn.ptnr1_label_atom_id OG1 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id GLN _struct_conn.ptnr2_label_seq_id 17 _struct_conn.ptnr2_label_atom_id CD _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id THR _struct_conn.ptnr1_auth_seq_id 15 _struct_conn.ptnr2_auth_asym_id B _struct_conn.ptnr2_auth_comp_id GLN _struct_conn.ptnr2_auth_seq_id 145 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.313 _struct_conn.pdbx_value_order sing _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id THR _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 15 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id GLN _pdbx_modification_feature.modified_residue_label_asym_id B _pdbx_modification_feature.modified_residue_label_seq_id 17 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id THR _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 15 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id GLN _pdbx_modification_feature.modified_residue_auth_asym_id B _pdbx_modification_feature.modified_residue_auth_seq_id 145 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom OG1 _pdbx_modification_feature.modified_residue_id_linking_atom CD _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Non-standard linkage' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id THR _struct_mon_prot_cis.label_seq_id 26 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id THR _struct_mon_prot_cis.auth_seq_id 26 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 27 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 27 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -3.09 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 5 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 12 ? VAL A 19 ? GLN A 12 VAL A 19 AA1 2 VAL A 40 ? SER A 47 ? VAL A 40 SER A 47 AA1 3 GLY A 88 ? THR A 93 ? GLY A 88 THR A 93 AA2 1 VAL A 28 ? LEU A 30 ? VAL A 28 LEU A 30 AA2 2 THR B 18 ? VAL B 21 ? THR B 146 VAL B 149 AA2 3 LYS A 104 ? SER A 113 ? LYS A 104 SER A 113 AA2 4 VAL A 54 ? ILE A 64 ? VAL A 54 ILE A 64 AA2 5 THR A 70 ? THR A 81 ? THR A 70 THR A 81 AA3 1 VAL A 28 ? LEU A 30 ? VAL A 28 LEU A 30 AA3 2 THR B 18 ? VAL B 21 ? THR B 146 VAL B 149 AA3 3 LYS A 104 ? SER A 113 ? LYS A 104 SER A 113 AA3 4 GLU B 6 ? HIS B 9 ? GLU B 134 HIS B 137 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ALA A 14 ? N ALA A 14 O SER A 45 ? O SER A 45 AA1 2 3 N ASP A 42 ? N ASP A 42 O LEU A 92 ? O LEU A 92 AA2 1 2 N VAL A 28 ? N VAL A 28 O VAL B 20 ? O VAL B 148 AA2 2 3 O ILE B 19 ? O ILE B 147 N TYR A 105 ? N TYR A 105 AA2 3 4 O LYS A 112 ? O LYS A 112 N GLU A 56 ? N GLU A 56 AA2 4 5 N GLN A 63 ? N GLN A 63 O GLU A 71 ? O GLU A 71 AA3 1 2 N VAL A 28 ? N VAL A 28 O VAL B 20 ? O VAL B 148 AA3 2 3 O ILE B 19 ? O ILE B 147 N TYR A 105 ? N TYR A 105 AA3 3 4 N GLU A 109 ? N GLU A 109 O HIS B 9 ? O HIS B 137 # _pdbx_entry_details.entry_id 7UI8 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 83 ? ? -47.38 151.78 2 1 ALA A 95 ? ? -47.20 153.09 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A ALA 2 ? A ALA 2 3 1 Y 1 A LYS 3 ? A LYS 3 4 1 Y 1 A GLU 4 ? A GLU 4 5 1 Y 1 A TYR 5 ? A TYR 5 6 1 Y 1 A ASP 119 ? A ASP 119 7 1 Y 1 A SER 120 ? A SER 120 8 1 Y 1 A ASN 121 ? A ASN 121 9 1 Y 1 A LYS 122 ? A LYS 122 10 1 Y 1 A ASP 123 ? A ASP 123 11 1 Y 1 A ASP 124 ? A ASP 124 12 1 Y 1 A GLU 125 ? A GLU 125 13 1 Y 1 A SER 126 ? A SER 126 14 1 Y 1 A HIS 127 ? A HIS 127 15 1 Y 1 A GLY 128 ? A GLY 128 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 THR N N N N 290 THR CA C N S 291 THR C C N N 292 THR O O N N 293 THR CB C N R 294 THR OG1 O N N 295 THR CG2 C N N 296 THR OXT O N N 297 THR H H N N 298 THR H2 H N N 299 THR HA H N N 300 THR HB H N N 301 THR HG1 H N N 302 THR HG21 H N N 303 THR HG22 H N N 304 THR HG23 H N N 305 THR HXT H N N 306 TRP N N N N 307 TRP CA C N S 308 TRP C C N N 309 TRP O O N N 310 TRP CB C N N 311 TRP CG C Y N 312 TRP CD1 C Y N 313 TRP CD2 C Y N 314 TRP NE1 N Y N 315 TRP CE2 C Y N 316 TRP CE3 C Y N 317 TRP CZ2 C Y N 318 TRP CZ3 C Y N 319 TRP CH2 C Y N 320 TRP OXT O N N 321 TRP H H N N 322 TRP H2 H N N 323 TRP HA H N N 324 TRP HB2 H N N 325 TRP HB3 H N N 326 TRP HD1 H N N 327 TRP HE1 H N N 328 TRP HE3 H N N 329 TRP HZ2 H N N 330 TRP HZ3 H N N 331 TRP HH2 H N N 332 TRP HXT H N N 333 TYR N N N N 334 TYR CA C N S 335 TYR C C N N 336 TYR O O N N 337 TYR CB C N N 338 TYR CG C Y N 339 TYR CD1 C Y N 340 TYR CD2 C Y N 341 TYR CE1 C Y N 342 TYR CE2 C Y N 343 TYR CZ C Y N 344 TYR OH O N N 345 TYR OXT O N N 346 TYR H H N N 347 TYR H2 H N N 348 TYR HA H N N 349 TYR HB2 H N N 350 TYR HB3 H N N 351 TYR HD1 H N N 352 TYR HD2 H N N 353 TYR HE1 H N N 354 TYR HE2 H N N 355 TYR HH H N N 356 TYR HXT H N N 357 VAL N N N N 358 VAL CA C N S 359 VAL C C N N 360 VAL O O N N 361 VAL CB C N N 362 VAL CG1 C N N 363 VAL CG2 C N N 364 VAL OXT O N N 365 VAL H H N N 366 VAL H2 H N N 367 VAL HA H N N 368 VAL HB H N N 369 VAL HG11 H N N 370 VAL HG12 H N N 371 VAL HG13 H N N 372 VAL HG21 H N N 373 VAL HG22 H N N 374 VAL HG23 H N N 375 VAL HXT H N N 376 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4NI6 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7UI8 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008280 _atom_sites.fract_transf_matrix[1][2] 0.004780 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009561 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.022005 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.056 # loop_