data_7UII # _entry.id 7UII # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.414 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7UII pdb_00007uii 10.2210/pdb7uii/pdb WWPDB D_1000264247 ? ? EMDB EMD-26546 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2023-04-12 ? 2 'EM metadata' 1 0 2023-04-12 ? 3 'Half map' 1 0 2023-04-12 1 4 'Half map' 1 0 2023-04-12 2 5 Image 1 0 2023-04-12 ? 6 'Primary map' 1 0 2023-04-12 ? 7 'Structure model' 1 1 2024-06-12 ? 8 'Half map' 1 0 2023-04-12 1 9 'Half map' 1 0 2023-04-12 2 10 Image 1 0 2023-04-12 ? 11 'Primary map' 1 0 2023-04-12 ? 12 'Structure model' 1 2 2025-06-04 ? 13 'EM metadata' 1 1 2025-06-04 ? 14 'Structure model' 1 3 2026-05-13 ? 15 'EM metadata' 1 2 2026-05-13 ? # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'EM metadata' repository 'Initial release' ? ? 3 3 'Half map' repository 'Initial release' ? ? 4 4 'Half map' repository 'Initial release' ? ? 5 5 Image repository 'Initial release' ? ? 6 6 'Primary map' repository 'Initial release' ? ? 7 8 'Half map' repository 'Initial release' ? ? 8 9 'Half map' repository 'Initial release' ? ? 9 10 Image repository 'Initial release' ? ? 10 11 'Primary map' repository 'Initial release' ? ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 7 'Structure model' 'Data collection' 2 12 'Structure model' 'Data collection' 3 12 'Structure model' 'Structure summary' 4 13 'EM metadata' 'Data processing' 5 13 'EM metadata' 'Experimental summary' 6 14 'Structure model' 'Data collection' 7 14 'Structure model' 'Database references' 8 15 'EM metadata' 'Database references' 9 15 'EM metadata' 'Experimental summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 7 'Structure model' chem_comp_atom 2 7 'Structure model' chem_comp_bond 3 12 'Structure model' em_admin 4 12 'Structure model' em_software 5 12 'Structure model' pdbx_entry_details 6 13 'EM metadata' em_admin 7 13 'EM metadata' em_software 8 14 'Structure model' citation 9 14 'Structure model' citation_author 10 14 'Structure model' em_admin 11 15 'EM metadata' citation 12 15 'EM metadata' citation_author 13 15 'EM metadata' em_admin # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 12 'Structure model' '_em_admin.last_update' 2 12 'Structure model' '_em_software.name' 3 12 'Structure model' '_pdbx_entry_details.has_protein_modification' 4 13 'EM metadata' '_em_admin.last_update' 5 13 'EM metadata' '_em_software.name' 6 14 'Structure model' '_citation.country' 7 14 'Structure model' '_citation.journal_abbrev' 8 14 'Structure model' '_citation.journal_id_CSD' 9 14 'Structure model' '_citation.journal_id_ISSN' 10 14 'Structure model' '_citation.journal_volume' 11 14 'Structure model' '_citation.page_first' 12 14 'Structure model' '_citation.page_last' 13 14 'Structure model' '_citation.pdbx_database_id_DOI' 14 14 'Structure model' '_citation.pdbx_database_id_PubMed' 15 14 'Structure model' '_citation.title' 16 14 'Structure model' '_citation.year' 17 14 'Structure model' '_em_admin.last_update' 18 15 'EM metadata' '_citation.country' 19 15 'EM metadata' '_citation.journal_abbrev' 20 15 'EM metadata' '_citation.journal_id_CSD' 21 15 'EM metadata' '_citation.journal_id_ISSN' 22 15 'EM metadata' '_citation.journal_volume' 23 15 'EM metadata' '_citation.page_first' 24 15 'EM metadata' '_citation.page_last' 25 15 'EM metadata' '_citation.pdbx_database_id_DOI' 26 15 'EM metadata' '_citation.pdbx_database_id_PubMed' 27 15 'EM metadata' '_citation.title' 28 15 'EM metadata' '_citation.year' 29 15 'EM metadata' '_em_admin.last_update' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7UII _pdbx_database_status.recvd_initial_deposition_date 2022-03-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name EMDB _pdbx_database_related.details 'Cryo-EM of self-assembled cannula CanA' _pdbx_database_related.db_id EMD-26546 _pdbx_database_related.content_type 'associated EM volume' # _pdbx_contact_author.id 2 _pdbx_contact_author.email egelman@virginia.edu _pdbx_contact_author.name_first Edward _pdbx_contact_author.name_last Egelman _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-4844-5212 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wang, F.' 1 ? 'Miller, J.G.' 2 ? 'Egelman, E.H.' 3 ? 'Conticello, V.P.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nat Commun' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-1723 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 16 _citation.language ? _citation.page_first 9082 _citation.page_last 9082 _citation.title 'Donor strand complementation and calcium ion coordination drive the chaperone-free polymerization of archaeal cannulae.' _citation.year 2025 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41467-025-64120-8 _citation.pdbx_database_id_PubMed 41083437 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sleutel, M.' 1 0000-0003-3247-2187 primary 'Sonani, R.R.' 2 0000-0002-6212-2869 primary 'Miller, J.G.' 3 ? primary 'Wang, F.' 4 0000-0003-1008-663X primary 'Gonzalez Socorro, A.' 5 0009-0003-3121-2209 primary 'Chen, Y.' 6 0009-0008-6401-1266 primary 'Martin, R.' 7 0009-0007-0244-8633 primary 'Demeler, B.' 8 0000-0002-2414-9518 primary 'Rudolph, M.J.' 9 0000-0002-5893-9817 primary 'Alva, V.' 10 0000-0003-1188-473X primary 'Remaut, H.' 11 0000-0002-9775-4102 primary 'Egelman, E.H.' 12 0000-0003-4844-5212 primary 'Conticello, V.P.' 13 0000-0001-6940-6947 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man CanA 19989.492 1 ? ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? 3 water nat water 18.015 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTTQSPLNSFYATGTAQAVSEPIDVESHLGSITPAAGAQGSDDIGYAIVWIKDQVNDVKLKVTLANAEQLKPYFKYLQIQ ITSGYETNSTALGNFSETKAVISLDNPSAVIVLDKEDIAVLYPDKTGYTNTSIWVPGEPDKIIVYNETKPVAILNFKAFY EAKEGMLFDSLPVIFNFQVLQVG ; _entity_poly.pdbx_seq_one_letter_code_can ;MTTQSPLNSFYATGTAQAVSEPIDVESHLGSITPAAGAQGSDDIGYAIVWIKDQVNDVKLKVTLANAEQLKPYFKYLQIQ ITSGYETNSTALGNFSETKAVISLDNPSAVIVLDKEDIAVLYPDKTGYTNTSIWVPGEPDKIIVYNETKPVAILNFKAFY EAKEGMLFDSLPVIFNFQVLQVG ; _entity_poly.pdbx_strand_id a _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 THR n 1 4 GLN n 1 5 SER n 1 6 PRO n 1 7 LEU n 1 8 ASN n 1 9 SER n 1 10 PHE n 1 11 TYR n 1 12 ALA n 1 13 THR n 1 14 GLY n 1 15 THR n 1 16 ALA n 1 17 GLN n 1 18 ALA n 1 19 VAL n 1 20 SER n 1 21 GLU n 1 22 PRO n 1 23 ILE n 1 24 ASP n 1 25 VAL n 1 26 GLU n 1 27 SER n 1 28 HIS n 1 29 LEU n 1 30 GLY n 1 31 SER n 1 32 ILE n 1 33 THR n 1 34 PRO n 1 35 ALA n 1 36 ALA n 1 37 GLY n 1 38 ALA n 1 39 GLN n 1 40 GLY n 1 41 SER n 1 42 ASP n 1 43 ASP n 1 44 ILE n 1 45 GLY n 1 46 TYR n 1 47 ALA n 1 48 ILE n 1 49 VAL n 1 50 TRP n 1 51 ILE n 1 52 LYS n 1 53 ASP n 1 54 GLN n 1 55 VAL n 1 56 ASN n 1 57 ASP n 1 58 VAL n 1 59 LYS n 1 60 LEU n 1 61 LYS n 1 62 VAL n 1 63 THR n 1 64 LEU n 1 65 ALA n 1 66 ASN n 1 67 ALA n 1 68 GLU n 1 69 GLN n 1 70 LEU n 1 71 LYS n 1 72 PRO n 1 73 TYR n 1 74 PHE n 1 75 LYS n 1 76 TYR n 1 77 LEU n 1 78 GLN n 1 79 ILE n 1 80 GLN n 1 81 ILE n 1 82 THR n 1 83 SER n 1 84 GLY n 1 85 TYR n 1 86 GLU n 1 87 THR n 1 88 ASN n 1 89 SER n 1 90 THR n 1 91 ALA n 1 92 LEU n 1 93 GLY n 1 94 ASN n 1 95 PHE n 1 96 SER n 1 97 GLU n 1 98 THR n 1 99 LYS n 1 100 ALA n 1 101 VAL n 1 102 ILE n 1 103 SER n 1 104 LEU n 1 105 ASP n 1 106 ASN n 1 107 PRO n 1 108 SER n 1 109 ALA n 1 110 VAL n 1 111 ILE n 1 112 VAL n 1 113 LEU n 1 114 ASP n 1 115 LYS n 1 116 GLU n 1 117 ASP n 1 118 ILE n 1 119 ALA n 1 120 VAL n 1 121 LEU n 1 122 TYR n 1 123 PRO n 1 124 ASP n 1 125 LYS n 1 126 THR n 1 127 GLY n 1 128 TYR n 1 129 THR n 1 130 ASN n 1 131 THR n 1 132 SER n 1 133 ILE n 1 134 TRP n 1 135 VAL n 1 136 PRO n 1 137 GLY n 1 138 GLU n 1 139 PRO n 1 140 ASP n 1 141 LYS n 1 142 ILE n 1 143 ILE n 1 144 VAL n 1 145 TYR n 1 146 ASN n 1 147 GLU n 1 148 THR n 1 149 LYS n 1 150 PRO n 1 151 VAL n 1 152 ALA n 1 153 ILE n 1 154 LEU n 1 155 ASN n 1 156 PHE n 1 157 LYS n 1 158 ALA n 1 159 PHE n 1 160 TYR n 1 161 GLU n 1 162 ALA n 1 163 LYS n 1 164 GLU n 1 165 GLY n 1 166 MET n 1 167 LEU n 1 168 PHE n 1 169 ASP n 1 170 SER n 1 171 LEU n 1 172 PRO n 1 173 VAL n 1 174 ILE n 1 175 PHE n 1 176 ASN n 1 177 PHE n 1 178 GLN n 1 179 VAL n 1 180 LEU n 1 181 GLN n 1 182 VAL n 1 183 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 183 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrodictium abyssi' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 54256 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? a . n A 1 2 THR 2 2 2 THR THR a . n A 1 3 THR 3 3 3 THR THR a . n A 1 4 GLN 4 4 4 GLN GLN a . n A 1 5 SER 5 5 5 SER SER a . n A 1 6 PRO 6 6 6 PRO PRO a . n A 1 7 LEU 7 7 7 LEU LEU a . n A 1 8 ASN 8 8 8 ASN ASN a . n A 1 9 SER 9 9 9 SER SER a . n A 1 10 PHE 10 10 10 PHE PHE a . n A 1 11 TYR 11 11 11 TYR TYR a . n A 1 12 ALA 12 12 12 ALA ALA a . n A 1 13 THR 13 13 13 THR THR a . n A 1 14 GLY 14 14 14 GLY GLY a . n A 1 15 THR 15 15 15 THR THR a . n A 1 16 ALA 16 16 16 ALA ALA a . n A 1 17 GLN 17 17 17 GLN GLN a . n A 1 18 ALA 18 18 18 ALA ALA a . n A 1 19 VAL 19 19 19 VAL VAL a . n A 1 20 SER 20 20 20 SER SER a . n A 1 21 GLU 21 21 21 GLU GLU a . n A 1 22 PRO 22 22 22 PRO PRO a . n A 1 23 ILE 23 23 23 ILE ILE a . n A 1 24 ASP 24 24 24 ASP ASP a . n A 1 25 VAL 25 25 25 VAL VAL a . n A 1 26 GLU 26 26 26 GLU GLU a . n A 1 27 SER 27 27 27 SER SER a . n A 1 28 HIS 28 28 28 HIS HIS a . n A 1 29 LEU 29 29 29 LEU LEU a . n A 1 30 GLY 30 30 30 GLY GLY a . n A 1 31 SER 31 31 31 SER SER a . n A 1 32 ILE 32 32 32 ILE ILE a . n A 1 33 THR 33 33 33 THR THR a . n A 1 34 PRO 34 34 34 PRO PRO a . n A 1 35 ALA 35 35 35 ALA ALA a . n A 1 36 ALA 36 36 36 ALA ALA a . n A 1 37 GLY 37 37 37 GLY GLY a . n A 1 38 ALA 38 38 38 ALA ALA a . n A 1 39 GLN 39 39 39 GLN GLN a . n A 1 40 GLY 40 40 40 GLY GLY a . n A 1 41 SER 41 41 41 SER SER a . n A 1 42 ASP 42 42 42 ASP ASP a . n A 1 43 ASP 43 43 43 ASP ASP a . n A 1 44 ILE 44 44 44 ILE ILE a . n A 1 45 GLY 45 45 45 GLY GLY a . n A 1 46 TYR 46 46 46 TYR TYR a . n A 1 47 ALA 47 47 47 ALA ALA a . n A 1 48 ILE 48 48 48 ILE ILE a . n A 1 49 VAL 49 49 49 VAL VAL a . n A 1 50 TRP 50 50 50 TRP TRP a . n A 1 51 ILE 51 51 51 ILE ILE a . n A 1 52 LYS 52 52 52 LYS LYS a . n A 1 53 ASP 53 53 53 ASP ASP a . n A 1 54 GLN 54 54 54 GLN GLN a . n A 1 55 VAL 55 55 55 VAL VAL a . n A 1 56 ASN 56 56 56 ASN ASN a . n A 1 57 ASP 57 57 57 ASP ASP a . n A 1 58 VAL 58 58 58 VAL VAL a . n A 1 59 LYS 59 59 59 LYS LYS a . n A 1 60 LEU 60 60 60 LEU LEU a . n A 1 61 LYS 61 61 61 LYS LYS a . n A 1 62 VAL 62 62 62 VAL VAL a . n A 1 63 THR 63 63 63 THR THR a . n A 1 64 LEU 64 64 64 LEU LEU a . n A 1 65 ALA 65 65 65 ALA ALA a . n A 1 66 ASN 66 66 66 ASN ASN a . n A 1 67 ALA 67 67 67 ALA ALA a . n A 1 68 GLU 68 68 68 GLU GLU a . n A 1 69 GLN 69 69 69 GLN GLN a . n A 1 70 LEU 70 70 70 LEU LEU a . n A 1 71 LYS 71 71 71 LYS LYS a . n A 1 72 PRO 72 72 72 PRO PRO a . n A 1 73 TYR 73 73 73 TYR TYR a . n A 1 74 PHE 74 74 74 PHE PHE a . n A 1 75 LYS 75 75 75 LYS LYS a . n A 1 76 TYR 76 76 76 TYR TYR a . n A 1 77 LEU 77 77 77 LEU LEU a . n A 1 78 GLN 78 78 78 GLN GLN a . n A 1 79 ILE 79 79 79 ILE ILE a . n A 1 80 GLN 80 80 80 GLN GLN a . n A 1 81 ILE 81 81 81 ILE ILE a . n A 1 82 THR 82 82 82 THR THR a . n A 1 83 SER 83 83 83 SER SER a . n A 1 84 GLY 84 84 84 GLY GLY a . n A 1 85 TYR 85 85 85 TYR TYR a . n A 1 86 GLU 86 86 86 GLU GLU a . n A 1 87 THR 87 87 87 THR THR a . n A 1 88 ASN 88 88 88 ASN ASN a . n A 1 89 SER 89 89 89 SER SER a . n A 1 90 THR 90 90 90 THR THR a . n A 1 91 ALA 91 91 91 ALA ALA a . n A 1 92 LEU 92 92 92 LEU LEU a . n A 1 93 GLY 93 93 93 GLY GLY a . n A 1 94 ASN 94 94 94 ASN ASN a . n A 1 95 PHE 95 95 95 PHE PHE a . n A 1 96 SER 96 96 96 SER SER a . n A 1 97 GLU 97 97 97 GLU GLU a . n A 1 98 THR 98 98 98 THR THR a . n A 1 99 LYS 99 99 99 LYS LYS a . n A 1 100 ALA 100 100 100 ALA ALA a . n A 1 101 VAL 101 101 101 VAL VAL a . n A 1 102 ILE 102 102 102 ILE ILE a . n A 1 103 SER 103 103 103 SER SER a . n A 1 104 LEU 104 104 104 LEU LEU a . n A 1 105 ASP 105 105 105 ASP ASP a . n A 1 106 ASN 106 106 106 ASN ASN a . n A 1 107 PRO 107 107 107 PRO PRO a . n A 1 108 SER 108 108 108 SER SER a . n A 1 109 ALA 109 109 109 ALA ALA a . n A 1 110 VAL 110 110 110 VAL VAL a . n A 1 111 ILE 111 111 111 ILE ILE a . n A 1 112 VAL 112 112 112 VAL VAL a . n A 1 113 LEU 113 113 113 LEU LEU a . n A 1 114 ASP 114 114 114 ASP ASP a . n A 1 115 LYS 115 115 115 LYS LYS a . n A 1 116 GLU 116 116 116 GLU GLU a . n A 1 117 ASP 117 117 117 ASP ASP a . n A 1 118 ILE 118 118 118 ILE ILE a . n A 1 119 ALA 119 119 119 ALA ALA a . n A 1 120 VAL 120 120 120 VAL VAL a . n A 1 121 LEU 121 121 121 LEU LEU a . n A 1 122 TYR 122 122 122 TYR TYR a . n A 1 123 PRO 123 123 123 PRO PRO a . n A 1 124 ASP 124 124 124 ASP ASP a . n A 1 125 LYS 125 125 125 LYS LYS a . n A 1 126 THR 126 126 126 THR THR a . n A 1 127 GLY 127 127 127 GLY GLY a . n A 1 128 TYR 128 128 128 TYR TYR a . n A 1 129 THR 129 129 129 THR THR a . n A 1 130 ASN 130 130 130 ASN ASN a . n A 1 131 THR 131 131 131 THR THR a . n A 1 132 SER 132 132 132 SER SER a . n A 1 133 ILE 133 133 133 ILE ILE a . n A 1 134 TRP 134 134 134 TRP TRP a . n A 1 135 VAL 135 135 135 VAL VAL a . n A 1 136 PRO 136 136 136 PRO PRO a . n A 1 137 GLY 137 137 137 GLY GLY a . n A 1 138 GLU 138 138 138 GLU GLU a . n A 1 139 PRO 139 139 139 PRO PRO a . n A 1 140 ASP 140 140 140 ASP ASP a . n A 1 141 LYS 141 141 141 LYS LYS a . n A 1 142 ILE 142 142 142 ILE ILE a . n A 1 143 ILE 143 143 143 ILE ILE a . n A 1 144 VAL 144 144 144 VAL VAL a . n A 1 145 TYR 145 145 145 TYR TYR a . n A 1 146 ASN 146 146 146 ASN ASN a . n A 1 147 GLU 147 147 147 GLU GLU a . n A 1 148 THR 148 148 148 THR THR a . n A 1 149 LYS 149 149 149 LYS LYS a . n A 1 150 PRO 150 150 150 PRO PRO a . n A 1 151 VAL 151 151 151 VAL VAL a . n A 1 152 ALA 152 152 152 ALA ALA a . n A 1 153 ILE 153 153 153 ILE ILE a . n A 1 154 LEU 154 154 154 LEU LEU a . n A 1 155 ASN 155 155 155 ASN ASN a . n A 1 156 PHE 156 156 156 PHE PHE a . n A 1 157 LYS 157 157 157 LYS LYS a . n A 1 158 ALA 158 158 158 ALA ALA a . n A 1 159 PHE 159 159 159 PHE PHE a . n A 1 160 TYR 160 160 160 TYR TYR a . n A 1 161 GLU 161 161 161 GLU GLU a . n A 1 162 ALA 162 162 162 ALA ALA a . n A 1 163 LYS 163 163 163 LYS LYS a . n A 1 164 GLU 164 164 164 GLU GLU a . n A 1 165 GLY 165 165 165 GLY GLY a . n A 1 166 MET 166 166 166 MET MET a . n A 1 167 LEU 167 167 167 LEU LEU a . n A 1 168 PHE 168 168 168 PHE PHE a . n A 1 169 ASP 169 169 169 ASP ASP a . n A 1 170 SER 170 170 170 SER SER a . n A 1 171 LEU 171 171 171 LEU LEU a . n A 1 172 PRO 172 172 172 PRO PRO a . n A 1 173 VAL 173 173 173 VAL VAL a . n A 1 174 ILE 174 174 174 ILE ILE a . n A 1 175 PHE 175 175 175 PHE PHE a . n A 1 176 ASN 176 176 176 ASN ASN a . n A 1 177 PHE 177 177 177 PHE PHE a . n A 1 178 GLN 178 178 178 GLN GLN a . n A 1 179 VAL 179 179 179 VAL VAL a . n A 1 180 LEU 180 180 180 LEU LEU a . n A 1 181 GLN 181 181 181 GLN GLN a . n A 1 182 VAL 182 182 182 VAL VAL a . n A 1 183 GLY 183 183 183 GLY GLY a . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id CA _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id CA _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 201 201 CA CA a . C 2 CA 1 202 202 CA CA a . D 3 HOH 1 301 301 HOH HOH a . D 3 HOH 2 302 302 HOH HOH a . # _software.citation_id ? _software.classification refinement _software.compiler_name ? _software.compiler_version ? _software.contact_author ? _software.contact_author_email ? _software.date ? _software.description ? _software.dependencies ? _software.hardware ? _software.language ? _software.location ? _software.mods ? _software.name PHENIX _software.os ? _software.os_version ? _software.type ? _software.version 1.19.2_4158: _software.pdbx_ordinal 1 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 7UII _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.00 _cell.length_a_esd ? _cell.length_b 1.00 _cell.length_b_esd ? _cell.length_c 1.00 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7UII _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7UII _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _refine.pdbx_refine_id 'ELECTRON MICROSCOPY' _refine.entry_id 7UII _refine.pdbx_diffrn_id ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low ? _refine.ls_d_res_high . _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs ? _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'ELECTRON MICROSCOPY' ? 0.002 ? 80360 ? f_bond_d ? ? 'ELECTRON MICROSCOPY' ? 0.590 ? 109816 ? f_angle_d ? ? 'ELECTRON MICROSCOPY' ? 5.793 ? 10696 ? f_dihedral_angle_d ? ? 'ELECTRON MICROSCOPY' ? 0.051 ? 12880 ? f_chiral_restr ? ? 'ELECTRON MICROSCOPY' ? 0.004 ? 14112 ? f_plane_restr ? ? # _struct.entry_id 7UII _struct.title 'Cryo-EM of self-assembled cannula CanA' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7UII _struct_keywords.text 'self-assemble, cannula, helical tube, donor strand, PROTEIN FIBRIL' _struct_keywords.pdbx_keywords 'PROTEIN FIBRIL' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7UII _struct_ref.pdbx_db_accession 7UII _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7UII _struct_ref_seq.pdbx_strand_id a _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 183 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7UII _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 183 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 183 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 'representative helical assembly' ? 93-meric 93 2 'helical asymmetric unit' ? monomeric 1 3 'helical asymmetric unit, std helical frame' ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 '(1-93)' A,B,C,D 2 47 A,B,C,D 3 H A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support microscopy _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] H 'identity operation' 1_555 x,y,z 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 1 'helical symmetry operation' ? ? 0.30300200 -0.95298992 0.00000000 0.00000 0.95298992 0.30300200 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -73.14000 2 'helical symmetry operation' ? ? -0.19740070 0.98032289 0.00000000 0.00000 -0.98032289 -0.19740070 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -71.55000 3 'helical symmetry operation' ? ? 0.08945058 -0.99599126 0.00000000 0.00000 0.99599126 0.08945058 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -69.96000 4 'helical symmetry operation' ? ? 0.01956389 0.99980861 0.00000000 0.00000 -0.99980861 0.01956389 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -68.37000 5 'helical symmetry operation' ? ? -0.12834558 -0.99172951 0.00000000 0.00000 0.99172951 -0.12834558 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -66.78000 6 'helical symmetry operation' ? ? 0.23560011 0.97185008 0.00000000 0.00000 -0.97185008 0.23560011 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -65.19000 7 'helical symmetry operation' ? ? -0.34005131 -0.94040688 0.00000000 0.00000 0.94040688 -0.34005131 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -63.60000 8 'helical symmetry operation' ? ? 0.44045632 0.89777404 0.00000000 0.00000 -0.89777404 0.44045632 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -62.01000 9 'helical symmetry operation' ? ? -0.53562047 -0.84445883 0.00000000 0.00000 0.84445883 -0.53562047 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -60.42000 10 'helical symmetry operation' ? ? 0.62441142 0.78109563 0.00000000 0.00000 -0.78109563 0.62441142 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -58.83000 11 'helical symmetry operation' ? ? -0.70577266 -0.70843839 0.00000000 0.00000 0.70843839 -0.70577266 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -57.24000 12 'helical symmetry operation' ? ? 0.77873611 0.62735163 0.00000000 0.00000 -0.62735163 0.77873611 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -55.65000 13 'helical symmetry operation' ? ? -0.84243359 -0.53880019 0.00000000 0.00000 0.53880019 -0.84243359 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -54.06000 14 'helical symmetry operation' ? ? 0.89610718 0.44383771 0.00000000 0.00000 -0.44383771 0.89610718 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -52.47000 15 'helical symmetry operation' ? ? -0.93911824 -0.34359413 0.00000000 0.00000 0.34359413 -0.93911824 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -50.88000 16 'helical symmetry operation' ? ? 0.97095499 0.23926222 0.00000000 0.00000 -0.23926222 0.97095499 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -49.29000 17 'helical symmetry operation' ? ? -0.99123861 -0.13208339 0.00000000 0.00000 0.13208339 -0.99123861 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -47.70000 18 'helical symmetry operation' ? ? 0.99972775 0.02333293 0.00000000 0.00000 -0.02333293 0.99972775 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -46.11000 19 'helical symmetry operation' ? ? -0.99632140 0.08569515 0.00000000 0.00000 -0.08569515 -0.99632140 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -44.52000 20 'helical symmetry operation' ? ? 0.98106010 -0.19370358 0.00000000 0.00000 0.19370358 0.98106010 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -42.93000 21 'helical symmetry operation' ? ? -0.95412543 0.29940717 0.00000000 0.00000 -0.29940717 -0.95412543 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -41.34000 22 'helical symmetry operation' ? ? 0.91583789 -0.40154821 0.00000000 0.00000 0.40154821 0.91583789 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -39.75000 23 'helical symmetry operation' ? ? -0.86665304 0.49891133 0.00000000 0.00000 -0.49891133 -0.86665304 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -38.16000 24 'helical symmetry operation' ? ? 0.80715612 -0.59033804 0.00000000 0.00000 0.59033804 0.80715612 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -36.57000 25 'helical symmetry operation' ? ? -0.73805507 0.67474048 0.00000000 0.00000 -0.67474048 -0.73805507 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -34.98000 26 'helical symmetry operation' ? ? 0.66017211 -0.75111436 0.00000000 0.00000 0.75111436 0.66017211 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -33.39000 27 'helical symmetry operation' ? ? -0.57443394 0.81855095 0.00000000 0.00000 -0.81855095 -0.57443394 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -31.80000 28 'helical symmetry operation' ? ? 0.48186073 -0.87624782 0.00000000 0.00000 0.87624782 0.48186073 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -30.21000 29 'helical symmetry operation' ? ? -0.38355400 0.92351845 0.00000000 0.00000 -0.92351845 -0.38355400 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -28.62000 30 'helical symmetry operation' ? ? 0.28068346 -0.95980039 0.00000000 0.00000 0.95980039 0.28068346 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -27.03000 31 'helical symmetry operation' ? ? -0.17447315 0.98466193 0.00000000 0.00000 -0.98466193 -0.17447315 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -25.44000 32 'helical symmetry operation' ? ? 0.06618683 -0.99780725 0.00000000 0.00000 0.99780725 0.06618683 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -23.85000 33 'helical symmetry operation' ? ? 0.04288704 0.99907993 0.00000000 0.00000 -0.99907993 0.04288704 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -22.26000 34 'helical symmetry operation' ? ? -0.15145059 -0.98846483 0.00000000 0.00000 0.98846483 -0.15145059 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -20.67000 35 'helical symmetry operation' ? ? 0.25821208 0.96608826 0.00000000 0.00000 -0.96608826 0.25821208 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -19.08000 36 'helical symmetry operation' ? ? -0.36190118 -0.93221646 0.00000000 0.00000 0.93221646 -0.36190118 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -17.49000 37 'helical symmetry operation' ? ? 0.46128411 0.88725248 0.00000000 0.00000 -0.88725248 0.46128411 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -15.90000 38 'helical symmetry operation' ? ? -0.55517835 -0.83173133 0.00000000 0.00000 0.83173133 -0.55517835 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -14.31000 39 'helical symmetry operation' ? ? 0.64246667 0.76631363 0.00000000 0.00000 -0.76631363 0.64246667 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -12.72000 40 'helical symmetry operation' ? ? -0.72211046 -0.69177777 0.00000000 0.00000 0.69177777 -0.72211046 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -11.13000 41 'helical symmetry operation' ? ? 0.79316205 0.60901064 0.00000000 0.00000 -0.60901064 0.79316205 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -9.54000 42 'helical symmetry operation' ? ? -0.85477603 -0.51899706 0.00000000 0.00000 0.51899706 -0.85477603 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -7.95000 43 'helical symmetry operation' ? ? 0.90621925 0.42280807 0.00000000 0.00000 -0.42280807 0.90621925 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -6.36000 44 'helical symmetry operation' ? ? -0.94687963 -0.32158820 0.00000000 0.00000 0.32158820 -0.94687963 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -4.77000 45 'helical symmetry operation' ? ? 0.97627334 0.21654185 0.00000000 0.00000 -0.21654185 0.97627334 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -3.18000 46 'helical symmetry operation' ? ? -0.99405064 -0.10891892 0.00000000 0.00000 0.10891892 -0.99405064 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 -1.59000 47 'identity operation' 1_555 x,y,z 1.00000000 0.00000000 0.00000000 0.00000 0.00000000 1.00000000 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 0.00000 48 'helical symmetry operation' ? ? -0.99405064 0.10891892 0.00000000 0.00000 -0.10891892 -0.99405064 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 1.59000 49 'helical symmetry operation' ? ? 0.97627334 -0.21654185 0.00000000 0.00000 0.21654185 0.97627334 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 3.18000 50 'helical symmetry operation' ? ? -0.94687963 0.32158820 0.00000000 0.00000 -0.32158820 -0.94687963 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 4.77000 51 'helical symmetry operation' ? ? 0.90621925 -0.42280807 0.00000000 0.00000 0.42280807 0.90621925 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 6.36000 52 'helical symmetry operation' ? ? -0.85477603 0.51899706 0.00000000 0.00000 -0.51899706 -0.85477603 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 7.95000 53 'helical symmetry operation' ? ? 0.79316205 -0.60901064 0.00000000 0.00000 0.60901064 0.79316205 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 9.54000 54 'helical symmetry operation' ? ? -0.72211046 0.69177777 0.00000000 0.00000 -0.69177777 -0.72211046 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 11.13000 55 'helical symmetry operation' ? ? 0.64246667 -0.76631363 0.00000000 0.00000 0.76631363 0.64246667 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 12.72000 56 'helical symmetry operation' ? ? -0.55517835 0.83173133 0.00000000 0.00000 -0.83173133 -0.55517835 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 14.31000 57 'helical symmetry operation' ? ? 0.46128411 -0.88725248 0.00000000 0.00000 0.88725248 0.46128411 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 15.90000 58 'helical symmetry operation' ? ? -0.36190118 0.93221646 0.00000000 0.00000 -0.93221646 -0.36190118 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 17.49000 59 'helical symmetry operation' ? ? 0.25821208 -0.96608826 0.00000000 0.00000 0.96608826 0.25821208 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 19.08000 60 'helical symmetry operation' ? ? -0.15145059 0.98846483 0.00000000 0.00000 -0.98846483 -0.15145059 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 20.67000 61 'helical symmetry operation' ? ? 0.04288704 -0.99907993 0.00000000 0.00000 0.99907993 0.04288704 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 22.26000 62 'helical symmetry operation' ? ? 0.06618683 0.99780725 0.00000000 0.00000 -0.99780725 0.06618683 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 23.85000 63 'helical symmetry operation' ? ? -0.17447315 -0.98466193 0.00000000 0.00000 0.98466193 -0.17447315 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 25.44000 64 'helical symmetry operation' ? ? 0.28068346 0.95980039 0.00000000 0.00000 -0.95980039 0.28068346 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 27.03000 65 'helical symmetry operation' ? ? -0.38355400 -0.92351845 0.00000000 0.00000 0.92351845 -0.38355400 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 28.62000 66 'helical symmetry operation' ? ? 0.48186073 0.87624782 0.00000000 0.00000 -0.87624782 0.48186073 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 30.21000 67 'helical symmetry operation' ? ? -0.57443394 -0.81855095 0.00000000 0.00000 0.81855095 -0.57443394 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 31.80000 68 'helical symmetry operation' ? ? 0.66017211 0.75111436 0.00000000 0.00000 -0.75111436 0.66017211 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 33.39000 69 'helical symmetry operation' ? ? -0.73805507 -0.67474048 0.00000000 0.00000 0.67474048 -0.73805507 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 34.98000 70 'helical symmetry operation' ? ? 0.80715612 0.59033804 0.00000000 0.00000 -0.59033804 0.80715612 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 36.57000 71 'helical symmetry operation' ? ? -0.86665304 -0.49891133 0.00000000 0.00000 0.49891133 -0.86665304 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 38.16000 72 'helical symmetry operation' ? ? 0.91583789 0.40154821 0.00000000 0.00000 -0.40154821 0.91583789 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 39.75000 73 'helical symmetry operation' ? ? -0.95412543 -0.29940717 0.00000000 0.00000 0.29940717 -0.95412543 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 41.34000 74 'helical symmetry operation' ? ? 0.98106010 0.19370358 0.00000000 0.00000 -0.19370358 0.98106010 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 42.93000 75 'helical symmetry operation' ? ? -0.99632140 -0.08569515 0.00000000 0.00000 0.08569515 -0.99632140 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 44.52000 76 'helical symmetry operation' ? ? 0.99972775 -0.02333293 0.00000000 0.00000 0.02333293 0.99972775 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 46.11000 77 'helical symmetry operation' ? ? -0.99123861 0.13208339 0.00000000 0.00000 -0.13208339 -0.99123861 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 47.70000 78 'helical symmetry operation' ? ? 0.97095499 -0.23926222 0.00000000 0.00000 0.23926222 0.97095499 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 49.29000 79 'helical symmetry operation' ? ? -0.93911824 0.34359413 0.00000000 0.00000 -0.34359413 -0.93911824 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 50.88000 80 'helical symmetry operation' ? ? 0.89610718 -0.44383771 0.00000000 0.00000 0.44383771 0.89610718 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 52.47000 81 'helical symmetry operation' ? ? -0.84243359 0.53880019 0.00000000 0.00000 -0.53880019 -0.84243359 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 54.06000 82 'helical symmetry operation' ? ? 0.77873611 -0.62735163 0.00000000 0.00000 0.62735163 0.77873611 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 55.65000 83 'helical symmetry operation' ? ? -0.70577266 0.70843839 0.00000000 0.00000 -0.70843839 -0.70577266 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 57.24000 84 'helical symmetry operation' ? ? 0.62441142 -0.78109563 0.00000000 0.00000 0.78109563 0.62441142 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 58.83000 85 'helical symmetry operation' ? ? -0.53562047 0.84445883 0.00000000 0.00000 -0.84445883 -0.53562047 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 60.42000 86 'helical symmetry operation' ? ? 0.44045632 -0.89777404 0.00000000 0.00000 0.89777404 0.44045632 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 62.01000 87 'helical symmetry operation' ? ? -0.34005131 0.94040688 0.00000000 0.00000 -0.94040688 -0.34005131 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 63.60000 88 'helical symmetry operation' ? ? 0.23560011 -0.97185008 0.00000000 0.00000 0.97185008 0.23560011 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 65.19000 89 'helical symmetry operation' ? ? -0.12834558 0.99172951 0.00000000 0.00000 -0.99172951 -0.12834558 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 66.78000 90 'helical symmetry operation' ? ? 0.01956389 -0.99980861 0.00000000 0.00000 0.99980861 0.01956389 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 68.37000 91 'helical symmetry operation' ? ? 0.08945058 0.99599126 0.00000000 0.00000 -0.99599126 0.08945058 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 69.96000 92 'helical symmetry operation' ? ? -0.19740070 -0.98032289 0.00000000 0.00000 0.98032289 -0.19740070 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 71.55000 93 'helical symmetry operation' ? ? 0.30300200 0.95298992 0.00000000 0.00000 -0.95298992 0.30300200 0.00000000 0.00000 0.00000000 0.00000000 1.00000000 73.14000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ASN _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 66 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LYS _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 71 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASN _struct_conf.beg_auth_asym_id a _struct_conf.beg_auth_seq_id 66 _struct_conf.end_auth_comp_id LYS _struct_conf.end_auth_asym_id a _struct_conf.end_auth_seq_id 71 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLY 37 O ? ? ? 1_555 B CA . CA ? ? a GLY 37 a CA 201 1_555 ? ? ? ? ? ? ? 2.761 ? ? metalc2 metalc ? ? A GLN 39 O ? ? ? 1_555 C CA . CA ? ? a GLN 39 a CA 202 1_555 ? ? ? ? ? ? ? 2.406 ? ? metalc3 metalc ? ? A GLU 161 OE2 ? ? ? 1_555 B CA . CA ? ? a GLU 161 a CA 201 1_555 ? ? ? ? ? ? ? 2.653 ? ? metalc4 metalc ? ? A GLU 164 OE1 ? ? ? 1_555 B CA . CA ? ? a GLU 164 a CA 201 1_555 ? ? ? ? ? ? ? 2.665 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A GLY 37 ? a GLY 37 ? 1_555 CA ? B CA . ? a CA 201 ? 1_555 OE2 ? A GLU 161 ? a GLU 161 ? 1_555 73.0 ? 2 O ? A GLY 37 ? a GLY 37 ? 1_555 CA ? B CA . ? a CA 201 ? 1_555 OE1 ? A GLU 164 ? a GLU 164 ? 1_555 76.8 ? 3 OE2 ? A GLU 161 ? a GLU 161 ? 1_555 CA ? B CA . ? a CA 201 ? 1_555 OE1 ? A GLU 164 ? a GLU 164 ? 1_555 147.1 ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 6 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 23 ? HIS A 28 ? ILE a 23 HIS a 28 AA1 2 GLN A 39 ? ILE A 51 ? GLN a 39 ILE a 51 AA1 3 VAL A 151 ? ALA A 162 ? VAL a 151 ALA a 162 AA1 4 PHE A 74 ? THR A 87 ? PHE a 74 THR a 87 AA1 5 PHE A 95 ? SER A 103 ? PHE a 95 SER a 103 AA2 1 ILE A 23 ? HIS A 28 ? ILE a 23 HIS a 28 AA2 2 GLN A 39 ? ILE A 51 ? GLN a 39 ILE a 51 AA2 3 VAL A 151 ? ALA A 162 ? VAL a 151 ALA a 162 AA2 4 PHE A 74 ? THR A 87 ? PHE a 74 THR a 87 AA2 5 SER A 132 ? TRP A 134 ? SER a 132 TRP a 134 AA2 6 ILE A 142 ? TYR A 145 ? ILE a 142 TYR a 145 AA3 1 SER A 108 ? LEU A 113 ? SER a 108 LEU a 113 AA3 2 VAL A 58 ? LEU A 64 ? VAL a 58 LEU a 64 AA3 3 PHE A 175 ? VAL A 182 ? PHE a 175 VAL a 182 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N HIS A 28 ? N HIS a 28 O TYR A 46 ? O TYR a 46 AA1 2 3 N VAL A 49 ? N VAL a 49 O ALA A 152 ? O ALA a 152 AA1 3 4 O PHE A 159 ? O PHE a 159 N GLN A 78 ? N GLN a 78 AA1 4 5 N SER A 83 ? N SER a 83 O GLU A 97 ? O GLU a 97 AA2 1 2 N HIS A 28 ? N HIS a 28 O TYR A 46 ? O TYR a 46 AA2 2 3 N VAL A 49 ? N VAL a 49 O ALA A 152 ? O ALA a 152 AA2 3 4 O PHE A 159 ? O PHE a 159 N GLN A 78 ? N GLN a 78 AA2 4 5 N GLU A 86 ? N GLU a 86 O TRP A 134 ? O TRP a 134 AA2 5 6 N ILE A 133 ? N ILE a 133 O ILE A 143 ? O ILE a 143 AA3 1 2 O ILE A 111 ? O ILE a 111 N LEU A 60 ? N LEU a 60 AA3 2 3 N LYS A 59 ? N LYS a 59 O LEU A 180 ? O LEU a 180 # _pdbx_entry_details.entry_id 7UII _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN a 54 ? ? 38.73 49.20 2 1 THR a 90 ? ? 56.51 3.24 3 1 ASP a 114 ? ? -119.91 -168.50 4 1 ASP a 124 ? ? -96.84 33.33 5 1 SER a 170 ? ? -144.81 34.00 # _pdbx_helical_symmetry.entry_id 7UII _pdbx_helical_symmetry.number_of_operations 93 _pdbx_helical_symmetry.rotation_per_n_subunits -173.747000 _pdbx_helical_symmetry.rise_per_n_subunits 1.590000 _pdbx_helical_symmetry.n_subunits_divisor 1 _pdbx_helical_symmetry.dyad_axis no _pdbx_helical_symmetry.circular_symmetry 1 # _em_3d_fitting.entry_id 7UII _em_3d_fitting.id 1 _em_3d_fitting.details ? _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_protocol ? _em_3d_fitting.ref_space ? _em_3d_fitting.target_criteria ? _em_3d_fitting.method ? # _em_3d_reconstruction.entry_id 7UII _em_3d_reconstruction.id 1 _em_3d_reconstruction.algorithm ? _em_3d_reconstruction.details ? _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.num_particles 659059 _em_3d_reconstruction.resolution 2.6 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.symmetry_type HELICAL _em_3d_reconstruction.method ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.magnification_calibration ? # _em_buffer.id 1 _em_buffer.details ? _em_buffer.pH 7.4 _em_buffer.specimen_id 1 _em_buffer.name ? # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.details ? _em_entity_assembly.name CanA _em_entity_assembly.source RECOMBINANT _em_entity_assembly.type COMPLEX _em_entity_assembly.entity_id_list 1 _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? # _em_imaging.id 1 _em_imaging.entry_id 7UII _em_imaging.accelerating_voltage 300 _em_imaging.alignment_procedure ? _em_imaging.c2_aperture_diameter ? _em_imaging.calibrated_defocus_max ? _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_magnification ? _em_imaging.cryogen ? _em_imaging.details ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.microscope_model 'FEI TITAN KRIOS' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs ? _em_imaging.nominal_defocus_max 2500 _em_imaging.nominal_defocus_min 1000 _em_imaging.nominal_magnification ? _em_imaging.recording_temperature_maximum ? _em_imaging.recording_temperature_minimum ? _em_imaging.residual_tilt ? _em_imaging.specimen_holder_model ? _em_imaging.specimen_id 1 _em_imaging.citation_id ? _em_imaging.date ? _em_imaging.temperature ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.astigmatism ? _em_imaging.detector_distance ? _em_imaging.electron_beam_tilt_params ? _em_imaging.specimen_holder_type ? # _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.chamber_temperature ? _em_vitrification.cryogen_name ETHANE _em_vitrification.details ? _em_vitrification.humidity ? _em_vitrification.instrument ? _em_vitrification.entry_id 7UII _em_vitrification.citation_id ? _em_vitrification.method ? _em_vitrification.temp ? _em_vitrification.time_resolved_state ? # _em_experiment.entry_id 7UII _em_experiment.id 1 _em_experiment.aggregation_state FILAMENT _em_experiment.reconstruction_method HELICAL _em_experiment.entity_assembly_id 1 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id a _pdbx_unobs_or_zero_occ_residues.auth_comp_id MET _pdbx_unobs_or_zero_occ_residues.auth_seq_id 1 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id MET _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CA CA CA N N 47 GLN N N N N 48 GLN CA C N S 49 GLN C C N N 50 GLN O O N N 51 GLN CB C N N 52 GLN CG C N N 53 GLN CD C N N 54 GLN OE1 O N N 55 GLN NE2 N N N 56 GLN OXT O N N 57 GLN H H N N 58 GLN H2 H N N 59 GLN HA H N N 60 GLN HB2 H N N 61 GLN HB3 H N N 62 GLN HG2 H N N 63 GLN HG3 H N N 64 GLN HE21 H N N 65 GLN HE22 H N N 66 GLN HXT H N N 67 GLU N N N N 68 GLU CA C N S 69 GLU C C N N 70 GLU O O N N 71 GLU CB C N N 72 GLU CG C N N 73 GLU CD C N N 74 GLU OE1 O N N 75 GLU OE2 O N N 76 GLU OXT O N N 77 GLU H H N N 78 GLU H2 H N N 79 GLU HA H N N 80 GLU HB2 H N N 81 GLU HB3 H N N 82 GLU HG2 H N N 83 GLU HG3 H N N 84 GLU HE2 H N N 85 GLU HXT H N N 86 GLY N N N N 87 GLY CA C N N 88 GLY C C N N 89 GLY O O N N 90 GLY OXT O N N 91 GLY H H N N 92 GLY H2 H N N 93 GLY HA2 H N N 94 GLY HA3 H N N 95 GLY HXT H N N 96 HIS N N N N 97 HIS CA C N S 98 HIS C C N N 99 HIS O O N N 100 HIS CB C N N 101 HIS CG C Y N 102 HIS ND1 N Y N 103 HIS CD2 C Y N 104 HIS CE1 C Y N 105 HIS NE2 N Y N 106 HIS OXT O N N 107 HIS H H N N 108 HIS H2 H N N 109 HIS HA H N N 110 HIS HB2 H N N 111 HIS HB3 H N N 112 HIS HD1 H N N 113 HIS HD2 H N N 114 HIS HE1 H N N 115 HIS HE2 H N N 116 HIS HXT H N N 117 HOH O O N N 118 HOH H1 H N N 119 HOH H2 H N N 120 ILE N N N N 121 ILE CA C N S 122 ILE C C N N 123 ILE O O N N 124 ILE CB C N S 125 ILE CG1 C N N 126 ILE CG2 C N N 127 ILE CD1 C N N 128 ILE OXT O N N 129 ILE H H N N 130 ILE H2 H N N 131 ILE HA H N N 132 ILE HB H N N 133 ILE HG12 H N N 134 ILE HG13 H N N 135 ILE HG21 H N N 136 ILE HG22 H N N 137 ILE HG23 H N N 138 ILE HD11 H N N 139 ILE HD12 H N N 140 ILE HD13 H N N 141 ILE HXT H N N 142 LEU N N N N 143 LEU CA C N S 144 LEU C C N N 145 LEU O O N N 146 LEU CB C N N 147 LEU CG C N N 148 LEU CD1 C N N 149 LEU CD2 C N N 150 LEU OXT O N N 151 LEU H H N N 152 LEU H2 H N N 153 LEU HA H N N 154 LEU HB2 H N N 155 LEU HB3 H N N 156 LEU HG H N N 157 LEU HD11 H N N 158 LEU HD12 H N N 159 LEU HD13 H N N 160 LEU HD21 H N N 161 LEU HD22 H N N 162 LEU HD23 H N N 163 LEU HXT H N N 164 LYS N N N N 165 LYS CA C N S 166 LYS C C N N 167 LYS O O N N 168 LYS CB C N N 169 LYS CG C N N 170 LYS CD C N N 171 LYS CE C N N 172 LYS NZ N N N 173 LYS OXT O N N 174 LYS H H N N 175 LYS H2 H N N 176 LYS HA H N N 177 LYS HB2 H N N 178 LYS HB3 H N N 179 LYS HG2 H N N 180 LYS HG3 H N N 181 LYS HD2 H N N 182 LYS HD3 H N N 183 LYS HE2 H N N 184 LYS HE3 H N N 185 LYS HZ1 H N N 186 LYS HZ2 H N N 187 LYS HZ3 H N N 188 LYS HXT H N N 189 MET N N N N 190 MET CA C N S 191 MET C C N N 192 MET O O N N 193 MET CB C N N 194 MET CG C N N 195 MET SD S N N 196 MET CE C N N 197 MET OXT O N N 198 MET H H N N 199 MET H2 H N N 200 MET HA H N N 201 MET HB2 H N N 202 MET HB3 H N N 203 MET HG2 H N N 204 MET HG3 H N N 205 MET HE1 H N N 206 MET HE2 H N N 207 MET HE3 H N N 208 MET HXT H N N 209 PHE N N N N 210 PHE CA C N S 211 PHE C C N N 212 PHE O O N N 213 PHE CB C N N 214 PHE CG C Y N 215 PHE CD1 C Y N 216 PHE CD2 C Y N 217 PHE CE1 C Y N 218 PHE CE2 C Y N 219 PHE CZ C Y N 220 PHE OXT O N N 221 PHE H H N N 222 PHE H2 H N N 223 PHE HA H N N 224 PHE HB2 H N N 225 PHE HB3 H N N 226 PHE HD1 H N N 227 PHE HD2 H N N 228 PHE HE1 H N N 229 PHE HE2 H N N 230 PHE HZ H N N 231 PHE HXT H N N 232 PRO N N N N 233 PRO CA C N S 234 PRO C C N N 235 PRO O O N N 236 PRO CB C N N 237 PRO CG C N N 238 PRO CD C N N 239 PRO OXT O N N 240 PRO H H N N 241 PRO HA H N N 242 PRO HB2 H N N 243 PRO HB3 H N N 244 PRO HG2 H N N 245 PRO HG3 H N N 246 PRO HD2 H N N 247 PRO HD3 H N N 248 PRO HXT H N N 249 SER N N N N 250 SER CA C N S 251 SER C C N N 252 SER O O N N 253 SER CB C N N 254 SER OG O N N 255 SER OXT O N N 256 SER H H N N 257 SER H2 H N N 258 SER HA H N N 259 SER HB2 H N N 260 SER HB3 H N N 261 SER HG H N N 262 SER HXT H N N 263 THR N N N N 264 THR CA C N S 265 THR C C N N 266 THR O O N N 267 THR CB C N R 268 THR OG1 O N N 269 THR CG2 C N N 270 THR OXT O N N 271 THR H H N N 272 THR H2 H N N 273 THR HA H N N 274 THR HB H N N 275 THR HG1 H N N 276 THR HG21 H N N 277 THR HG22 H N N 278 THR HG23 H N N 279 THR HXT H N N 280 TRP N N N N 281 TRP CA C N S 282 TRP C C N N 283 TRP O O N N 284 TRP CB C N N 285 TRP CG C Y N 286 TRP CD1 C Y N 287 TRP CD2 C Y N 288 TRP NE1 N Y N 289 TRP CE2 C Y N 290 TRP CE3 C Y N 291 TRP CZ2 C Y N 292 TRP CZ3 C Y N 293 TRP CH2 C Y N 294 TRP OXT O N N 295 TRP H H N N 296 TRP H2 H N N 297 TRP HA H N N 298 TRP HB2 H N N 299 TRP HB3 H N N 300 TRP HD1 H N N 301 TRP HE1 H N N 302 TRP HE3 H N N 303 TRP HZ2 H N N 304 TRP HZ3 H N N 305 TRP HH2 H N N 306 TRP HXT H N N 307 TYR N N N N 308 TYR CA C N S 309 TYR C C N N 310 TYR O O N N 311 TYR CB C N N 312 TYR CG C Y N 313 TYR CD1 C Y N 314 TYR CD2 C Y N 315 TYR CE1 C Y N 316 TYR CE2 C Y N 317 TYR CZ C Y N 318 TYR OH O N N 319 TYR OXT O N N 320 TYR H H N N 321 TYR H2 H N N 322 TYR HA H N N 323 TYR HB2 H N N 324 TYR HB3 H N N 325 TYR HD1 H N N 326 TYR HD2 H N N 327 TYR HE1 H N N 328 TYR HE2 H N N 329 TYR HH H N N 330 TYR HXT H N N 331 VAL N N N N 332 VAL CA C N S 333 VAL C C N N 334 VAL O O N N 335 VAL CB C N N 336 VAL CG1 C N N 337 VAL CG2 C N N 338 VAL OXT O N N 339 VAL H H N N 340 VAL H2 H N N 341 VAL HA H N N 342 VAL HB H N N 343 VAL HG11 H N N 344 VAL HG12 H N N 345 VAL HG13 H N N 346 VAL HG21 H N N 347 VAL HG22 H N N 348 VAL HG23 H N N 349 VAL HXT H N N 350 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 GLN N CA sing N N 44 GLN N H sing N N 45 GLN N H2 sing N N 46 GLN CA C sing N N 47 GLN CA CB sing N N 48 GLN CA HA sing N N 49 GLN C O doub N N 50 GLN C OXT sing N N 51 GLN CB CG sing N N 52 GLN CB HB2 sing N N 53 GLN CB HB3 sing N N 54 GLN CG CD sing N N 55 GLN CG HG2 sing N N 56 GLN CG HG3 sing N N 57 GLN CD OE1 doub N N 58 GLN CD NE2 sing N N 59 GLN NE2 HE21 sing N N 60 GLN NE2 HE22 sing N N 61 GLN OXT HXT sing N N 62 GLU N CA sing N N 63 GLU N H sing N N 64 GLU N H2 sing N N 65 GLU CA C sing N N 66 GLU CA CB sing N N 67 GLU CA HA sing N N 68 GLU C O doub N N 69 GLU C OXT sing N N 70 GLU CB CG sing N N 71 GLU CB HB2 sing N N 72 GLU CB HB3 sing N N 73 GLU CG CD sing N N 74 GLU CG HG2 sing N N 75 GLU CG HG3 sing N N 76 GLU CD OE1 doub N N 77 GLU CD OE2 sing N N 78 GLU OE2 HE2 sing N N 79 GLU OXT HXT sing N N 80 GLY N CA sing N N 81 GLY N H sing N N 82 GLY N H2 sing N N 83 GLY CA C sing N N 84 GLY CA HA2 sing N N 85 GLY CA HA3 sing N N 86 GLY C O doub N N 87 GLY C OXT sing N N 88 GLY OXT HXT sing N N 89 HIS N CA sing N N 90 HIS N H sing N N 91 HIS N H2 sing N N 92 HIS CA C sing N N 93 HIS CA CB sing N N 94 HIS CA HA sing N N 95 HIS C O doub N N 96 HIS C OXT sing N N 97 HIS CB CG sing N N 98 HIS CB HB2 sing N N 99 HIS CB HB3 sing N N 100 HIS CG ND1 sing Y N 101 HIS CG CD2 doub Y N 102 HIS ND1 CE1 doub Y N 103 HIS ND1 HD1 sing N N 104 HIS CD2 NE2 sing Y N 105 HIS CD2 HD2 sing N N 106 HIS CE1 NE2 sing Y N 107 HIS CE1 HE1 sing N N 108 HIS NE2 HE2 sing N N 109 HIS OXT HXT sing N N 110 HOH O H1 sing N N 111 HOH O H2 sing N N 112 ILE N CA sing N N 113 ILE N H sing N N 114 ILE N H2 sing N N 115 ILE CA C sing N N 116 ILE CA CB sing N N 117 ILE CA HA sing N N 118 ILE C O doub N N 119 ILE C OXT sing N N 120 ILE CB CG1 sing N N 121 ILE CB CG2 sing N N 122 ILE CB HB sing N N 123 ILE CG1 CD1 sing N N 124 ILE CG1 HG12 sing N N 125 ILE CG1 HG13 sing N N 126 ILE CG2 HG21 sing N N 127 ILE CG2 HG22 sing N N 128 ILE CG2 HG23 sing N N 129 ILE CD1 HD11 sing N N 130 ILE CD1 HD12 sing N N 131 ILE CD1 HD13 sing N N 132 ILE OXT HXT sing N N 133 LEU N CA sing N N 134 LEU N H sing N N 135 LEU N H2 sing N N 136 LEU CA C sing N N 137 LEU CA CB sing N N 138 LEU CA HA sing N N 139 LEU C O doub N N 140 LEU C OXT sing N N 141 LEU CB CG sing N N 142 LEU CB HB2 sing N N 143 LEU CB HB3 sing N N 144 LEU CG CD1 sing N N 145 LEU CG CD2 sing N N 146 LEU CG HG sing N N 147 LEU CD1 HD11 sing N N 148 LEU CD1 HD12 sing N N 149 LEU CD1 HD13 sing N N 150 LEU CD2 HD21 sing N N 151 LEU CD2 HD22 sing N N 152 LEU CD2 HD23 sing N N 153 LEU OXT HXT sing N N 154 LYS N CA sing N N 155 LYS N H sing N N 156 LYS N H2 sing N N 157 LYS CA C sing N N 158 LYS CA CB sing N N 159 LYS CA HA sing N N 160 LYS C O doub N N 161 LYS C OXT sing N N 162 LYS CB CG sing N N 163 LYS CB HB2 sing N N 164 LYS CB HB3 sing N N 165 LYS CG CD sing N N 166 LYS CG HG2 sing N N 167 LYS CG HG3 sing N N 168 LYS CD CE sing N N 169 LYS CD HD2 sing N N 170 LYS CD HD3 sing N N 171 LYS CE NZ sing N N 172 LYS CE HE2 sing N N 173 LYS CE HE3 sing N N 174 LYS NZ HZ1 sing N N 175 LYS NZ HZ2 sing N N 176 LYS NZ HZ3 sing N N 177 LYS OXT HXT sing N N 178 MET N CA sing N N 179 MET N H sing N N 180 MET N H2 sing N N 181 MET CA C sing N N 182 MET CA CB sing N N 183 MET CA HA sing N N 184 MET C O doub N N 185 MET C OXT sing N N 186 MET CB CG sing N N 187 MET CB HB2 sing N N 188 MET CB HB3 sing N N 189 MET CG SD sing N N 190 MET CG HG2 sing N N 191 MET CG HG3 sing N N 192 MET SD CE sing N N 193 MET CE HE1 sing N N 194 MET CE HE2 sing N N 195 MET CE HE3 sing N N 196 MET OXT HXT sing N N 197 PHE N CA sing N N 198 PHE N H sing N N 199 PHE N H2 sing N N 200 PHE CA C sing N N 201 PHE CA CB sing N N 202 PHE CA HA sing N N 203 PHE C O doub N N 204 PHE C OXT sing N N 205 PHE CB CG sing N N 206 PHE CB HB2 sing N N 207 PHE CB HB3 sing N N 208 PHE CG CD1 doub Y N 209 PHE CG CD2 sing Y N 210 PHE CD1 CE1 sing Y N 211 PHE CD1 HD1 sing N N 212 PHE CD2 CE2 doub Y N 213 PHE CD2 HD2 sing N N 214 PHE CE1 CZ doub Y N 215 PHE CE1 HE1 sing N N 216 PHE CE2 CZ sing Y N 217 PHE CE2 HE2 sing N N 218 PHE CZ HZ sing N N 219 PHE OXT HXT sing N N 220 PRO N CA sing N N 221 PRO N CD sing N N 222 PRO N H sing N N 223 PRO CA C sing N N 224 PRO CA CB sing N N 225 PRO CA HA sing N N 226 PRO C O doub N N 227 PRO C OXT sing N N 228 PRO CB CG sing N N 229 PRO CB HB2 sing N N 230 PRO CB HB3 sing N N 231 PRO CG CD sing N N 232 PRO CG HG2 sing N N 233 PRO CG HG3 sing N N 234 PRO CD HD2 sing N N 235 PRO CD HD3 sing N N 236 PRO OXT HXT sing N N 237 SER N CA sing N N 238 SER N H sing N N 239 SER N H2 sing N N 240 SER CA C sing N N 241 SER CA CB sing N N 242 SER CA HA sing N N 243 SER C O doub N N 244 SER C OXT sing N N 245 SER CB OG sing N N 246 SER CB HB2 sing N N 247 SER CB HB3 sing N N 248 SER OG HG sing N N 249 SER OXT HXT sing N N 250 THR N CA sing N N 251 THR N H sing N N 252 THR N H2 sing N N 253 THR CA C sing N N 254 THR CA CB sing N N 255 THR CA HA sing N N 256 THR C O doub N N 257 THR C OXT sing N N 258 THR CB OG1 sing N N 259 THR CB CG2 sing N N 260 THR CB HB sing N N 261 THR OG1 HG1 sing N N 262 THR CG2 HG21 sing N N 263 THR CG2 HG22 sing N N 264 THR CG2 HG23 sing N N 265 THR OXT HXT sing N N 266 TRP N CA sing N N 267 TRP N H sing N N 268 TRP N H2 sing N N 269 TRP CA C sing N N 270 TRP CA CB sing N N 271 TRP CA HA sing N N 272 TRP C O doub N N 273 TRP C OXT sing N N 274 TRP CB CG sing N N 275 TRP CB HB2 sing N N 276 TRP CB HB3 sing N N 277 TRP CG CD1 doub Y N 278 TRP CG CD2 sing Y N 279 TRP CD1 NE1 sing Y N 280 TRP CD1 HD1 sing N N 281 TRP CD2 CE2 doub Y N 282 TRP CD2 CE3 sing Y N 283 TRP NE1 CE2 sing Y N 284 TRP NE1 HE1 sing N N 285 TRP CE2 CZ2 sing Y N 286 TRP CE3 CZ3 doub Y N 287 TRP CE3 HE3 sing N N 288 TRP CZ2 CH2 doub Y N 289 TRP CZ2 HZ2 sing N N 290 TRP CZ3 CH2 sing Y N 291 TRP CZ3 HZ3 sing N N 292 TRP CH2 HH2 sing N N 293 TRP OXT HXT sing N N 294 TYR N CA sing N N 295 TYR N H sing N N 296 TYR N H2 sing N N 297 TYR CA C sing N N 298 TYR CA CB sing N N 299 TYR CA HA sing N N 300 TYR C O doub N N 301 TYR C OXT sing N N 302 TYR CB CG sing N N 303 TYR CB HB2 sing N N 304 TYR CB HB3 sing N N 305 TYR CG CD1 doub Y N 306 TYR CG CD2 sing Y N 307 TYR CD1 CE1 sing Y N 308 TYR CD1 HD1 sing N N 309 TYR CD2 CE2 doub Y N 310 TYR CD2 HD2 sing N N 311 TYR CE1 CZ doub Y N 312 TYR CE1 HE1 sing N N 313 TYR CE2 CZ sing Y N 314 TYR CE2 HE2 sing N N 315 TYR CZ OH sing N N 316 TYR OH HH sing N N 317 TYR OXT HXT sing N N 318 VAL N CA sing N N 319 VAL N H sing N N 320 VAL N H2 sing N N 321 VAL CA C sing N N 322 VAL CA CB sing N N 323 VAL CA HA sing N N 324 VAL C O doub N N 325 VAL C OXT sing N N 326 VAL CB CG1 sing N N 327 VAL CB CG2 sing N N 328 VAL CB HB sing N N 329 VAL CG1 HG11 sing N N 330 VAL CG1 HG12 sing N N 331 VAL CG1 HG13 sing N N 332 VAL CG2 HG21 sing N N 333 VAL CG2 HG22 sing N N 334 VAL CG2 HG23 sing N N 335 VAL OXT HXT sing N N 336 # _em_admin.entry_id 7UII _em_admin.current_status REL _em_admin.deposition_date 2022-03-29 _em_admin.deposition_site RCSB _em_admin.last_update 2026-05-13 _em_admin.map_release_date 2023-04-12 _em_admin.title 'Cryo-EM of self-assembled cannula CanA' # _em_ctf_correction.id 1 _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.type 'PHASE FLIPPING AND AMPLITUDE CORRECTION' _em_ctf_correction.details ? # _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.ncbi_tax_id 54256 _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organism 'Pyrodictium abyssi' _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? # _em_entity_assembly_recombinant.id 2 _em_entity_assembly_recombinant.entity_assembly_id 1 _em_entity_assembly_recombinant.cell ? _em_entity_assembly_recombinant.ncbi_tax_id 562 _em_entity_assembly_recombinant.organism 'Escherichia coli' _em_entity_assembly_recombinant.plasmid ? _em_entity_assembly_recombinant.strain BL21 # _em_helical_entity.id 1 _em_helical_entity.image_processing_id 1 _em_helical_entity.angular_rotation_per_subunit -173.747 _em_helical_entity.axial_rise_per_subunit 1.59 _em_helical_entity.axial_symmetry C1 _em_helical_entity.details ? # _em_image_processing.id 1 _em_image_processing.image_recording_id 1 _em_image_processing.details ? # _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.avg_electron_dose_per_image 50 _em_image_recording.average_exposure_time ? _em_image_recording.details ? _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model 'GATAN K3 (6k x 4k)' _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? _em_image_recording.avg_electron_dose_per_subtomogram ? # loop_ _em_software.id _em_software.category _em_software.details _em_software.name _em_software.version _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id 1 'PARTICLE SELECTION' ? ? ? 1 ? ? 2 'IMAGE ACQUISITION' ? ? ? ? ? 1 3 MASKING ? ? ? ? ? ? 4 'CTF CORRECTION' ? ? ? 1 ? ? 5 'LAYERLINE INDEXING' ? ? ? ? ? ? 6 'DIFFRACTION INDEXING' ? ? ? ? ? ? 7 'MODEL FITTING' ? ? ? ? ? ? 8 'MODEL REFINEMENT' ? PHENIX ? ? ? ? 9 OTHER ? ? ? ? ? ? 10 'INITIAL EULER ASSIGNMENT' ? ? ? 1 ? ? 11 'FINAL EULER ASSIGNMENT' ? ? ? 1 ? ? 12 CLASSIFICATION ? ? ? 1 ? ? 13 RECONSTRUCTION ? ? ? 1 ? ? # _em_specimen.id 1 _em_specimen.experiment_id 1 _em_specimen.concentration ? _em_specimen.details ? _em_specimen.embedding_applied NO _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Science Foundation (NSF, United States)' 'United States' NSF-DMR-1533958 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' R35GM122510 2 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' K99GM138756 3 # _atom_sites.entry_id 7UII _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CA N O S # loop_ #