data_7UKV # _entry.id 7UKV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7UKV pdb_00007ukv 10.2210/pdb7ukv/pdb WWPDB D_1000261994 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7UKV _pdbx_database_status.recvd_initial_deposition_date 2022-04-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Beyett, T.S.' 1 0000-0001-5509-7004 'Pham, C.' 2 0000-0001-6902-0745 'Eck, M.J.' 3 0000-0003-4247-9403 'Heppner, D.E.' 4 0000-0002-0722-5160 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Med.Chem.Lett.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1948-5875 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 13 _citation.language ? _citation.page_first 1856 _citation.page_last 1863 _citation.title 'Structural Basis for Inhibition of Mutant EGFR with Lazertinib (YH25448).' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acsmedchemlett.2c00213 _citation.pdbx_database_id_PubMed 36518696 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Heppner, D.E.' 1 ? primary 'Wittlinger, F.' 2 ? primary 'Beyett, T.S.' 3 ? primary 'Shaurova, T.' 4 ? primary 'Urul, D.A.' 5 ? primary 'Buckley, B.' 6 ? primary 'Pham, C.D.' 7 ? primary 'Schaeffner, I.K.' 8 ? primary 'Yang, B.' 9 ? primary 'Ogboo, B.C.' 10 ? primary 'May, E.W.' 11 ? primary 'Schaefer, E.M.' 12 ? primary 'Eck, M.J.' 13 ? primary 'Laufer, S.A.' 14 ? primary 'Hershberger, P.A.' 15 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7UKV _cell.details ? _cell.formula_units_Z ? _cell.length_a 145.700 _cell.length_a_esd ? _cell.length_b 145.700 _cell.length_b_esd ? _cell.length_c 145.700 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 24 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7UKV _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Epidermal growth factor receptor' 37391.211 1 2.7.10.1 ? 'kinase domain' ? 2 non-polymer syn ;N-[5-{[(4P)-4-{4-[(dimethylamino)methyl]-3-phenyl-1H-pyrazol-1-yl}pyrimidin-2-yl]amino}-4-methoxy-2-(morpholin-4-yl)phenyl]propanamide ; 556.659 1 ? ? ? ? 3 water nat water 18.015 42 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Proto-oncogene c-ErbB-1,Receptor tyrosine-protein kinase erbB-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHV CRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKIT DFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLP QPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDAD EYLIPQQG ; _entity_poly.pdbx_seq_one_letter_code_can ;SGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHV CRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKIT DFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLP QPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDAD EYLIPQQG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLY n 1 3 GLU n 1 4 ALA n 1 5 PRO n 1 6 ASN n 1 7 GLN n 1 8 ALA n 1 9 LEU n 1 10 LEU n 1 11 ARG n 1 12 ILE n 1 13 LEU n 1 14 LYS n 1 15 GLU n 1 16 THR n 1 17 GLU n 1 18 PHE n 1 19 LYS n 1 20 LYS n 1 21 ILE n 1 22 LYS n 1 23 VAL n 1 24 LEU n 1 25 GLY n 1 26 SER n 1 27 GLY n 1 28 ALA n 1 29 PHE n 1 30 GLY n 1 31 THR n 1 32 VAL n 1 33 TYR n 1 34 LYS n 1 35 GLY n 1 36 LEU n 1 37 TRP n 1 38 ILE n 1 39 PRO n 1 40 GLU n 1 41 GLY n 1 42 GLU n 1 43 LYS n 1 44 VAL n 1 45 LYS n 1 46 ILE n 1 47 PRO n 1 48 VAL n 1 49 ALA n 1 50 ILE n 1 51 LYS n 1 52 GLU n 1 53 LEU n 1 54 ARG n 1 55 GLU n 1 56 ALA n 1 57 THR n 1 58 SER n 1 59 PRO n 1 60 LYS n 1 61 ALA n 1 62 ASN n 1 63 LYS n 1 64 GLU n 1 65 ILE n 1 66 LEU n 1 67 ASP n 1 68 GLU n 1 69 ALA n 1 70 TYR n 1 71 VAL n 1 72 MET n 1 73 ALA n 1 74 SER n 1 75 VAL n 1 76 ASP n 1 77 ASN n 1 78 PRO n 1 79 HIS n 1 80 VAL n 1 81 CYS n 1 82 ARG n 1 83 LEU n 1 84 LEU n 1 85 GLY n 1 86 ILE n 1 87 CYS n 1 88 LEU n 1 89 THR n 1 90 SER n 1 91 THR n 1 92 VAL n 1 93 GLN n 1 94 LEU n 1 95 ILE n 1 96 THR n 1 97 GLN n 1 98 LEU n 1 99 MET n 1 100 PRO n 1 101 PHE n 1 102 GLY n 1 103 CYS n 1 104 LEU n 1 105 LEU n 1 106 ASP n 1 107 TYR n 1 108 VAL n 1 109 ARG n 1 110 GLU n 1 111 HIS n 1 112 LYS n 1 113 ASP n 1 114 ASN n 1 115 ILE n 1 116 GLY n 1 117 SER n 1 118 GLN n 1 119 TYR n 1 120 LEU n 1 121 LEU n 1 122 ASN n 1 123 TRP n 1 124 CYS n 1 125 VAL n 1 126 GLN n 1 127 ILE n 1 128 ALA n 1 129 LYS n 1 130 GLY n 1 131 MET n 1 132 ASN n 1 133 TYR n 1 134 LEU n 1 135 GLU n 1 136 ASP n 1 137 ARG n 1 138 ARG n 1 139 LEU n 1 140 VAL n 1 141 HIS n 1 142 ARG n 1 143 ASP n 1 144 LEU n 1 145 ALA n 1 146 ALA n 1 147 ARG n 1 148 ASN n 1 149 VAL n 1 150 LEU n 1 151 VAL n 1 152 LYS n 1 153 THR n 1 154 PRO n 1 155 GLN n 1 156 HIS n 1 157 VAL n 1 158 LYS n 1 159 ILE n 1 160 THR n 1 161 ASP n 1 162 PHE n 1 163 GLY n 1 164 LEU n 1 165 ALA n 1 166 LYS n 1 167 LEU n 1 168 LEU n 1 169 GLY n 1 170 ALA n 1 171 GLU n 1 172 GLU n 1 173 LYS n 1 174 GLU n 1 175 TYR n 1 176 HIS n 1 177 ALA n 1 178 GLU n 1 179 GLY n 1 180 GLY n 1 181 LYS n 1 182 VAL n 1 183 PRO n 1 184 ILE n 1 185 LYS n 1 186 TRP n 1 187 MET n 1 188 ALA n 1 189 LEU n 1 190 GLU n 1 191 SER n 1 192 ILE n 1 193 LEU n 1 194 HIS n 1 195 ARG n 1 196 ILE n 1 197 TYR n 1 198 THR n 1 199 HIS n 1 200 GLN n 1 201 SER n 1 202 ASP n 1 203 VAL n 1 204 TRP n 1 205 SER n 1 206 TYR n 1 207 GLY n 1 208 VAL n 1 209 THR n 1 210 VAL n 1 211 TRP n 1 212 GLU n 1 213 LEU n 1 214 MET n 1 215 THR n 1 216 PHE n 1 217 GLY n 1 218 SER n 1 219 LYS n 1 220 PRO n 1 221 TYR n 1 222 ASP n 1 223 GLY n 1 224 ILE n 1 225 PRO n 1 226 ALA n 1 227 SER n 1 228 GLU n 1 229 ILE n 1 230 SER n 1 231 SER n 1 232 ILE n 1 233 LEU n 1 234 GLU n 1 235 LYS n 1 236 GLY n 1 237 GLU n 1 238 ARG n 1 239 LEU n 1 240 PRO n 1 241 GLN n 1 242 PRO n 1 243 PRO n 1 244 ILE n 1 245 CYS n 1 246 THR n 1 247 ILE n 1 248 ASP n 1 249 VAL n 1 250 TYR n 1 251 MET n 1 252 ILE n 1 253 MET n 1 254 VAL n 1 255 LYS n 1 256 CYS n 1 257 TRP n 1 258 MET n 1 259 ILE n 1 260 ASP n 1 261 ALA n 1 262 ASP n 1 263 SER n 1 264 ARG n 1 265 PRO n 1 266 LYS n 1 267 PHE n 1 268 ARG n 1 269 GLU n 1 270 LEU n 1 271 ILE n 1 272 ILE n 1 273 GLU n 1 274 PHE n 1 275 SER n 1 276 LYS n 1 277 MET n 1 278 ALA n 1 279 ARG n 1 280 ASP n 1 281 PRO n 1 282 GLN n 1 283 ARG n 1 284 TYR n 1 285 LEU n 1 286 VAL n 1 287 ILE n 1 288 GLN n 1 289 GLY n 1 290 ASP n 1 291 GLU n 1 292 ARG n 1 293 MET n 1 294 HIS n 1 295 LEU n 1 296 PRO n 1 297 SER n 1 298 PRO n 1 299 THR n 1 300 ASP n 1 301 SER n 1 302 ASN n 1 303 PHE n 1 304 TYR n 1 305 ARG n 1 306 ALA n 1 307 LEU n 1 308 MET n 1 309 ASP n 1 310 GLU n 1 311 GLU n 1 312 ASP n 1 313 MET n 1 314 ASP n 1 315 ASP n 1 316 VAL n 1 317 VAL n 1 318 ASP n 1 319 ALA n 1 320 ASP n 1 321 GLU n 1 322 TYR n 1 323 LEU n 1 324 ILE n 1 325 PRO n 1 326 GLN n 1 327 GLN n 1 328 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 328 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'EGFR, ERBB, ERBB1, HER1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EGFR_HUMAN _struct_ref.pdbx_db_accession P00533 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SGEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHV CRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKIT DFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLP QPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDAD EYLIPQQG ; _struct_ref.pdbx_align_begin 695 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7UKV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 328 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00533 _struct_ref_seq.db_align_beg 695 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1022 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 695 _struct_ref_seq.pdbx_auth_seq_align_end 1022 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZRT non-polymer . ;N-[5-{[(4P)-4-{4-[(dimethylamino)methyl]-3-phenyl-1H-pyrazol-1-yl}pyrimidin-2-yl]amino}-4-methoxy-2-(morpholin-4-yl)phenyl]propanamide ; 'lazertinib, bound form' 'C30 H36 N8 O3' 556.659 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7UKV _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.45 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 64.40 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.0 M Sodium Citrate, 0.1 M MES pH 6.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-12-15 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97911 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97911 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 58.970 _reflns.entry_id 7UKV _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.400 _reflns.d_resolution_low 59.480 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 19853 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.200 _reflns.pdbx_Rmerge_I_obs 0.090 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.800 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 5 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.100 _reflns.pdbx_Rpim_I_all 0.043 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 103918 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.400 2.460 ? ? 7258 ? ? ? 1468 97.700 ? ? ? ? 1.572 ? ? ? ? ? ? ? ? 4.900 ? ? ? 1.000 1.757 0.758 ? 1 1 0.344 ? ? ? ? ? ? ? ? ? ? 10.740 59.480 ? ? 1220 ? ? ? 242 93.700 ? ? ? ? 0.032 ? ? ? ? ? ? ? ? 5.000 ? ? ? 34.000 0.036 0.015 ? 2 1 0.998 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 129.730 _refine.B_iso_mean 66.2994 _refine.B_iso_min 36.790 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7UKV _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.4000 _refine.ls_d_res_low 59.4800 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 19849 _refine.ls_number_reflns_R_free 998 _refine.ls_number_reflns_R_work 18851 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.0300 _refine.ls_percent_reflns_R_free 5.0300 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2128 _refine.ls_R_factor_R_free 0.2433 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2111 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6VH4 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 34.7200 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.4000 _refine_hist.d_res_low 59.4800 _refine_hist.number_atoms_solvent 42 _refine_hist.number_atoms_total 2380 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 290 _refine_hist.pdbx_B_iso_mean_ligand 70.35 _refine_hist.pdbx_B_iso_mean_solvent 62.17 _refine_hist.pdbx_number_atoms_protein 2297 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 41 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.4000 2.5300 2700 . 146 2554 94.0000 . . . 0.3637 0.0000 0.3170 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.5300 2.6900 2855 . 120 2735 100.0000 . . . 0.3123 0.0000 0.2767 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.6900 2.8900 2857 . 144 2713 100.0000 . . . 0.4047 0.0000 0.2757 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.8900 3.1800 2872 . 155 2717 100.0000 . . . 0.2623 0.0000 0.2547 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 3.1900 3.6400 2803 . 146 2657 97.0000 . . . 0.2856 0.0000 0.2268 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 3.6500 4.5800 2849 . 136 2713 99.0000 . . . 0.2116 0.0000 0.1772 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 4.5900 59.4800 2913 . 151 2762 97.0000 . . . 0.1969 0.0000 0.1844 . . . . . . . 7 . . . # _struct.entry_id 7UKV _struct.title 'Wild type EGFR in complex with Lazertinib (YH25448)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7UKV _struct_keywords.text 'Cancer, Drug Discovery, Kinase, TRANSFERASE, TRANSFERASE-INHIBITOR complex' _struct_keywords.pdbx_keywords TRANSFERASE/INHIBITOR # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 14 ? PHE A 18 ? LYS A 708 PHE A 712 5 ? 5 HELX_P HELX_P2 AA2 LYS A 60 ? SER A 74 ? LYS A 754 SER A 768 1 ? 15 HELX_P HELX_P3 AA3 CYS A 103 ? HIS A 111 ? CYS A 797 HIS A 805 1 ? 9 HELX_P HELX_P4 AA4 LYS A 112 ? ILE A 115 ? LYS A 806 ILE A 809 5 ? 4 HELX_P HELX_P5 AA5 GLY A 116 ? ARG A 137 ? GLY A 810 ARG A 831 1 ? 22 HELX_P HELX_P6 AA6 ALA A 145 ? ARG A 147 ? ALA A 839 ARG A 841 5 ? 3 HELX_P HELX_P7 AA7 PRO A 183 ? MET A 187 ? PRO A 877 MET A 881 5 ? 5 HELX_P HELX_P8 AA8 ALA A 188 ? ARG A 195 ? ALA A 882 ARG A 889 1 ? 8 HELX_P HELX_P9 AA9 THR A 198 ? THR A 215 ? THR A 892 THR A 909 1 ? 18 HELX_P HELX_P10 AB1 PRO A 225 ? SER A 227 ? PRO A 919 SER A 921 5 ? 3 HELX_P HELX_P11 AB2 GLU A 228 ? GLY A 236 ? GLU A 922 GLY A 930 1 ? 9 HELX_P HELX_P12 AB3 THR A 246 ? CYS A 256 ? THR A 940 CYS A 950 1 ? 11 HELX_P HELX_P13 AB4 ASP A 260 ? ARG A 264 ? ASP A 954 ARG A 958 5 ? 5 HELX_P HELX_P14 AB5 LYS A 266 ? ARG A 279 ? LYS A 960 ARG A 973 1 ? 14 HELX_P HELX_P15 AB6 ASP A 280 ? TYR A 284 ? ASP A 974 TYR A 978 5 ? 5 HELX_P HELX_P16 AB7 ASP A 318 ? TYR A 322 ? ASP A 1012 TYR A 1016 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 103 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id ZRT _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C33 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 797 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id ZRT _struct_conn.ptnr2_auth_seq_id 1101 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.767 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 23 ? GLY A 25 ? VAL A 717 GLY A 719 AA1 2 VAL A 32 ? TRP A 37 ? VAL A 726 TRP A 731 AA1 3 ILE A 46 ? LYS A 51 ? ILE A 740 LYS A 745 AA1 4 VAL A 92 ? GLN A 97 ? VAL A 786 GLN A 791 AA1 5 LEU A 83 ? LEU A 88 ? LEU A 777 LEU A 782 AA2 1 LEU A 139 ? VAL A 140 ? LEU A 833 VAL A 834 AA2 2 LYS A 166 ? LEU A 167 ? LYS A 860 LEU A 861 AA3 1 VAL A 149 ? THR A 153 ? VAL A 843 THR A 847 AA3 2 HIS A 156 ? ILE A 159 ? HIS A 850 ILE A 853 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 25 ? N GLY A 719 O VAL A 32 ? O VAL A 726 AA1 2 3 N TYR A 33 ? N TYR A 727 O ILE A 50 ? O ILE A 744 AA1 3 4 N ALA A 49 ? N ALA A 743 O THR A 96 ? O THR A 790 AA1 4 5 O ILE A 95 ? O ILE A 789 N GLY A 85 ? N GLY A 779 AA2 1 2 N VAL A 140 ? N VAL A 834 O LYS A 166 ? O LYS A 860 AA3 1 2 N LEU A 150 ? N LEU A 844 O LYS A 158 ? O LYS A 852 # _atom_sites.entry_id 7UKV _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.006863 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006863 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006863 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 695 ? ? ? A . n A 1 2 GLY 2 696 696 GLY GLY A . n A 1 3 GLU 3 697 697 GLU GLU A . n A 1 4 ALA 4 698 698 ALA ALA A . n A 1 5 PRO 5 699 699 PRO PRO A . n A 1 6 ASN 6 700 700 ASN ASN A . n A 1 7 GLN 7 701 701 GLN GLN A . n A 1 8 ALA 8 702 702 ALA ALA A . n A 1 9 LEU 9 703 703 LEU LEU A . n A 1 10 LEU 10 704 704 LEU LEU A . n A 1 11 ARG 11 705 705 ARG ARG A . n A 1 12 ILE 12 706 706 ILE ILE A . n A 1 13 LEU 13 707 707 LEU LEU A . n A 1 14 LYS 14 708 708 LYS LYS A . n A 1 15 GLU 15 709 709 GLU GLU A . n A 1 16 THR 16 710 710 THR THR A . n A 1 17 GLU 17 711 711 GLU GLU A . n A 1 18 PHE 18 712 712 PHE PHE A . n A 1 19 LYS 19 713 713 LYS LYS A . n A 1 20 LYS 20 714 714 LYS LYS A . n A 1 21 ILE 21 715 715 ILE ILE A . n A 1 22 LYS 22 716 716 LYS ALA A . n A 1 23 VAL 23 717 717 VAL VAL A . n A 1 24 LEU 24 718 718 LEU LEU A . n A 1 25 GLY 25 719 719 GLY GLY A . n A 1 26 SER 26 720 720 SER SER A . n A 1 27 GLY 27 721 721 GLY GLY A . n A 1 28 ALA 28 722 ? ? ? A . n A 1 29 PHE 29 723 ? ? ? A . n A 1 30 GLY 30 724 724 GLY GLY A . n A 1 31 THR 31 725 725 THR THR A . n A 1 32 VAL 32 726 726 VAL VAL A . n A 1 33 TYR 33 727 727 TYR TYR A . n A 1 34 LYS 34 728 728 LYS ALA A . n A 1 35 GLY 35 729 729 GLY GLY A . n A 1 36 LEU 36 730 730 LEU LEU A . n A 1 37 TRP 37 731 731 TRP TRP A . n A 1 38 ILE 38 732 732 ILE ILE A . n A 1 39 PRO 39 733 733 PRO PRO A . n A 1 40 GLU 40 734 734 GLU GLU A . n A 1 41 GLY 41 735 735 GLY GLY A . n A 1 42 GLU 42 736 736 GLU GLU A . n A 1 43 LYS 43 737 737 LYS LYS A . n A 1 44 VAL 44 738 738 VAL VAL A . n A 1 45 LYS 45 739 739 LYS LYS A . n A 1 46 ILE 46 740 740 ILE ILE A . n A 1 47 PRO 47 741 741 PRO PRO A . n A 1 48 VAL 48 742 742 VAL VAL A . n A 1 49 ALA 49 743 743 ALA ALA A . n A 1 50 ILE 50 744 744 ILE ILE A . n A 1 51 LYS 51 745 745 LYS LYS A . n A 1 52 GLU 52 746 746 GLU GLU A . n A 1 53 LEU 53 747 ? ? ? A . n A 1 54 ARG 54 748 ? ? ? A . n A 1 55 GLU 55 749 ? ? ? A . n A 1 56 ALA 56 750 ? ? ? A . n A 1 57 THR 57 751 ? ? ? A . n A 1 58 SER 58 752 752 SER SER A . n A 1 59 PRO 59 753 753 PRO PRO A . n A 1 60 LYS 60 754 754 LYS LYS A . n A 1 61 ALA 61 755 755 ALA ALA A . n A 1 62 ASN 62 756 756 ASN ASN A . n A 1 63 LYS 63 757 757 LYS LYS A . n A 1 64 GLU 64 758 758 GLU GLU A . n A 1 65 ILE 65 759 759 ILE ILE A . n A 1 66 LEU 66 760 760 LEU LEU A . n A 1 67 ASP 67 761 761 ASP ASP A . n A 1 68 GLU 68 762 762 GLU GLU A . n A 1 69 ALA 69 763 763 ALA ALA A . n A 1 70 TYR 70 764 764 TYR TYR A . n A 1 71 VAL 71 765 765 VAL VAL A . n A 1 72 MET 72 766 766 MET MET A . n A 1 73 ALA 73 767 767 ALA ALA A . n A 1 74 SER 74 768 768 SER SER A . n A 1 75 VAL 75 769 769 VAL VAL A . n A 1 76 ASP 76 770 770 ASP ASP A . n A 1 77 ASN 77 771 771 ASN ASN A . n A 1 78 PRO 78 772 772 PRO PRO A . n A 1 79 HIS 79 773 773 HIS HIS A . n A 1 80 VAL 80 774 774 VAL VAL A . n A 1 81 CYS 81 775 775 CYS CYS A . n A 1 82 ARG 82 776 776 ARG ARG A . n A 1 83 LEU 83 777 777 LEU LEU A . n A 1 84 LEU 84 778 778 LEU LEU A . n A 1 85 GLY 85 779 779 GLY GLY A . n A 1 86 ILE 86 780 780 ILE ILE A . n A 1 87 CYS 87 781 781 CYS CYS A . n A 1 88 LEU 88 782 782 LEU LEU A . n A 1 89 THR 89 783 783 THR THR A . n A 1 90 SER 90 784 784 SER SER A . n A 1 91 THR 91 785 785 THR THR A . n A 1 92 VAL 92 786 786 VAL VAL A . n A 1 93 GLN 93 787 787 GLN GLN A . n A 1 94 LEU 94 788 788 LEU LEU A . n A 1 95 ILE 95 789 789 ILE ILE A . n A 1 96 THR 96 790 790 THR THR A . n A 1 97 GLN 97 791 791 GLN GLN A . n A 1 98 LEU 98 792 792 LEU LEU A . n A 1 99 MET 99 793 793 MET MET A . n A 1 100 PRO 100 794 794 PRO PRO A . n A 1 101 PHE 101 795 795 PHE PHE A . n A 1 102 GLY 102 796 796 GLY GLY A . n A 1 103 CYS 103 797 797 CYS CYS A . n A 1 104 LEU 104 798 798 LEU LEU A . n A 1 105 LEU 105 799 799 LEU LEU A . n A 1 106 ASP 106 800 800 ASP ASP A . n A 1 107 TYR 107 801 801 TYR TYR A . n A 1 108 VAL 108 802 802 VAL VAL A . n A 1 109 ARG 109 803 803 ARG ARG A . n A 1 110 GLU 110 804 804 GLU GLU A . n A 1 111 HIS 111 805 805 HIS HIS A . n A 1 112 LYS 112 806 806 LYS LYS A . n A 1 113 ASP 113 807 807 ASP ASP A . n A 1 114 ASN 114 808 808 ASN ASN A . n A 1 115 ILE 115 809 809 ILE ILE A . n A 1 116 GLY 116 810 810 GLY GLY A . n A 1 117 SER 117 811 811 SER SER A . n A 1 118 GLN 118 812 812 GLN GLN A . n A 1 119 TYR 119 813 813 TYR TYR A . n A 1 120 LEU 120 814 814 LEU LEU A . n A 1 121 LEU 121 815 815 LEU LEU A . n A 1 122 ASN 122 816 816 ASN ASN A . n A 1 123 TRP 123 817 817 TRP TRP A . n A 1 124 CYS 124 818 818 CYS CYS A . n A 1 125 VAL 125 819 819 VAL VAL A . n A 1 126 GLN 126 820 820 GLN GLN A . n A 1 127 ILE 127 821 821 ILE ILE A . n A 1 128 ALA 128 822 822 ALA ALA A . n A 1 129 LYS 129 823 823 LYS LYS A . n A 1 130 GLY 130 824 824 GLY GLY A . n A 1 131 MET 131 825 825 MET MET A . n A 1 132 ASN 132 826 826 ASN ASN A . n A 1 133 TYR 133 827 827 TYR TYR A . n A 1 134 LEU 134 828 828 LEU LEU A . n A 1 135 GLU 135 829 829 GLU GLU A . n A 1 136 ASP 136 830 830 ASP ASP A . n A 1 137 ARG 137 831 831 ARG ARG A . n A 1 138 ARG 138 832 832 ARG ARG A . n A 1 139 LEU 139 833 833 LEU LEU A . n A 1 140 VAL 140 834 834 VAL VAL A . n A 1 141 HIS 141 835 835 HIS HIS A . n A 1 142 ARG 142 836 836 ARG ARG A . n A 1 143 ASP 143 837 837 ASP ASP A . n A 1 144 LEU 144 838 838 LEU LEU A . n A 1 145 ALA 145 839 839 ALA ALA A . n A 1 146 ALA 146 840 840 ALA ALA A . n A 1 147 ARG 147 841 841 ARG ARG A . n A 1 148 ASN 148 842 842 ASN ASN A . n A 1 149 VAL 149 843 843 VAL VAL A . n A 1 150 LEU 150 844 844 LEU LEU A . n A 1 151 VAL 151 845 845 VAL VAL A . n A 1 152 LYS 152 846 846 LYS LYS A . n A 1 153 THR 153 847 847 THR THR A . n A 1 154 PRO 154 848 848 PRO PRO A . n A 1 155 GLN 155 849 849 GLN GLN A . n A 1 156 HIS 156 850 850 HIS HIS A . n A 1 157 VAL 157 851 851 VAL VAL A . n A 1 158 LYS 158 852 852 LYS LYS A . n A 1 159 ILE 159 853 853 ILE ILE A . n A 1 160 THR 160 854 854 THR THR A . n A 1 161 ASP 161 855 855 ASP ASP A . n A 1 162 PHE 162 856 856 PHE PHE A . n A 1 163 GLY 163 857 857 GLY GLY A . n A 1 164 LEU 164 858 858 LEU LEU A . n A 1 165 ALA 165 859 859 ALA ALA A . n A 1 166 LYS 166 860 860 LYS LYS A . n A 1 167 LEU 167 861 861 LEU LEU A . n A 1 168 LEU 168 862 862 LEU LEU A . n A 1 169 GLY 169 863 863 GLY GLY A . n A 1 170 ALA 170 864 864 ALA ALA A . n A 1 171 GLU 171 865 ? ? ? A . n A 1 172 GLU 172 866 ? ? ? A . n A 1 173 LYS 173 867 ? ? ? A . n A 1 174 GLU 174 868 868 GLU GLU A . n A 1 175 TYR 175 869 869 TYR TYR A . n A 1 176 HIS 176 870 870 HIS HIS A . n A 1 177 ALA 177 871 871 ALA ALA A . n A 1 178 GLU 178 872 ? ? ? A . n A 1 179 GLY 179 873 ? ? ? A . n A 1 180 GLY 180 874 ? ? ? A . n A 1 181 LYS 181 875 875 LYS LYS A . n A 1 182 VAL 182 876 876 VAL VAL A . n A 1 183 PRO 183 877 877 PRO PRO A . n A 1 184 ILE 184 878 878 ILE ILE A . n A 1 185 LYS 185 879 879 LYS LYS A . n A 1 186 TRP 186 880 880 TRP TRP A . n A 1 187 MET 187 881 881 MET MET A . n A 1 188 ALA 188 882 882 ALA ALA A . n A 1 189 LEU 189 883 883 LEU LEU A . n A 1 190 GLU 190 884 884 GLU GLU A . n A 1 191 SER 191 885 885 SER SER A . n A 1 192 ILE 192 886 886 ILE ILE A . n A 1 193 LEU 193 887 887 LEU LEU A . n A 1 194 HIS 194 888 888 HIS HIS A . n A 1 195 ARG 195 889 889 ARG ARG A . n A 1 196 ILE 196 890 890 ILE ILE A . n A 1 197 TYR 197 891 891 TYR TYR A . n A 1 198 THR 198 892 892 THR THR A . n A 1 199 HIS 199 893 893 HIS HIS A . n A 1 200 GLN 200 894 894 GLN GLN A . n A 1 201 SER 201 895 895 SER SER A . n A 1 202 ASP 202 896 896 ASP ASP A . n A 1 203 VAL 203 897 897 VAL VAL A . n A 1 204 TRP 204 898 898 TRP TRP A . n A 1 205 SER 205 899 899 SER SER A . n A 1 206 TYR 206 900 900 TYR TYR A . n A 1 207 GLY 207 901 901 GLY GLY A . n A 1 208 VAL 208 902 902 VAL VAL A . n A 1 209 THR 209 903 903 THR THR A . n A 1 210 VAL 210 904 904 VAL VAL A . n A 1 211 TRP 211 905 905 TRP TRP A . n A 1 212 GLU 212 906 906 GLU GLU A . n A 1 213 LEU 213 907 907 LEU LEU A . n A 1 214 MET 214 908 908 MET MET A . n A 1 215 THR 215 909 909 THR THR A . n A 1 216 PHE 216 910 910 PHE PHE A . n A 1 217 GLY 217 911 911 GLY GLY A . n A 1 218 SER 218 912 912 SER SER A . n A 1 219 LYS 219 913 913 LYS LYS A . n A 1 220 PRO 220 914 914 PRO PRO A . n A 1 221 TYR 221 915 915 TYR TYR A . n A 1 222 ASP 222 916 916 ASP ASP A . n A 1 223 GLY 223 917 917 GLY GLY A . n A 1 224 ILE 224 918 918 ILE ILE A . n A 1 225 PRO 225 919 919 PRO PRO A . n A 1 226 ALA 226 920 920 ALA ALA A . n A 1 227 SER 227 921 921 SER SER A . n A 1 228 GLU 228 922 922 GLU GLU A . n A 1 229 ILE 229 923 923 ILE ILE A . n A 1 230 SER 230 924 924 SER SER A . n A 1 231 SER 231 925 925 SER SER A . n A 1 232 ILE 232 926 926 ILE ILE A . n A 1 233 LEU 233 927 927 LEU LEU A . n A 1 234 GLU 234 928 928 GLU GLU A . n A 1 235 LYS 235 929 929 LYS LYS A . n A 1 236 GLY 236 930 930 GLY GLY A . n A 1 237 GLU 237 931 931 GLU GLU A . n A 1 238 ARG 238 932 932 ARG ARG A . n A 1 239 LEU 239 933 933 LEU LEU A . n A 1 240 PRO 240 934 934 PRO PRO A . n A 1 241 GLN 241 935 935 GLN GLN A . n A 1 242 PRO 242 936 936 PRO PRO A . n A 1 243 PRO 243 937 937 PRO PRO A . n A 1 244 ILE 244 938 938 ILE ILE A . n A 1 245 CYS 245 939 939 CYS CYS A . n A 1 246 THR 246 940 940 THR THR A . n A 1 247 ILE 247 941 941 ILE ILE A . n A 1 248 ASP 248 942 942 ASP ASP A . n A 1 249 VAL 249 943 943 VAL VAL A . n A 1 250 TYR 250 944 944 TYR TYR A . n A 1 251 MET 251 945 945 MET MET A . n A 1 252 ILE 252 946 946 ILE ILE A . n A 1 253 MET 253 947 947 MET MET A . n A 1 254 VAL 254 948 948 VAL VAL A . n A 1 255 LYS 255 949 949 LYS LYS A . n A 1 256 CYS 256 950 950 CYS CYS A . n A 1 257 TRP 257 951 951 TRP TRP A . n A 1 258 MET 258 952 952 MET MET A . n A 1 259 ILE 259 953 953 ILE ILE A . n A 1 260 ASP 260 954 954 ASP ASP A . n A 1 261 ALA 261 955 955 ALA ALA A . n A 1 262 ASP 262 956 956 ASP ASP A . n A 1 263 SER 263 957 957 SER SER A . n A 1 264 ARG 264 958 958 ARG ARG A . n A 1 265 PRO 265 959 959 PRO PRO A . n A 1 266 LYS 266 960 960 LYS LYS A . n A 1 267 PHE 267 961 961 PHE PHE A . n A 1 268 ARG 268 962 962 ARG ARG A . n A 1 269 GLU 269 963 963 GLU GLU A . n A 1 270 LEU 270 964 964 LEU LEU A . n A 1 271 ILE 271 965 965 ILE ILE A . n A 1 272 ILE 272 966 966 ILE ILE A . n A 1 273 GLU 273 967 967 GLU GLU A . n A 1 274 PHE 274 968 968 PHE PHE A . n A 1 275 SER 275 969 969 SER SER A . n A 1 276 LYS 276 970 970 LYS LYS A . n A 1 277 MET 277 971 971 MET MET A . n A 1 278 ALA 278 972 972 ALA ALA A . n A 1 279 ARG 279 973 973 ARG ARG A . n A 1 280 ASP 280 974 974 ASP ASP A . n A 1 281 PRO 281 975 975 PRO PRO A . n A 1 282 GLN 282 976 976 GLN GLN A . n A 1 283 ARG 283 977 977 ARG ARG A . n A 1 284 TYR 284 978 978 TYR TYR A . n A 1 285 LEU 285 979 979 LEU LEU A . n A 1 286 VAL 286 980 980 VAL VAL A . n A 1 287 ILE 287 981 981 ILE ILE A . n A 1 288 GLN 288 982 982 GLN ALA A . n A 1 289 GLY 289 983 983 GLY GLY A . n A 1 290 ASP 290 984 984 ASP ASP A . n A 1 291 GLU 291 985 985 GLU GLU A . n A 1 292 ARG 292 986 ? ? ? A . n A 1 293 MET 293 987 ? ? ? A . n A 1 294 HIS 294 988 ? ? ? A . n A 1 295 LEU 295 989 ? ? ? A . n A 1 296 PRO 296 990 ? ? ? A . n A 1 297 SER 297 991 ? ? ? A . n A 1 298 PRO 298 992 ? ? ? A . n A 1 299 THR 299 993 ? ? ? A . n A 1 300 ASP 300 994 ? ? ? A . n A 1 301 SER 301 995 ? ? ? A . n A 1 302 ASN 302 996 ? ? ? A . n A 1 303 PHE 303 997 ? ? ? A . n A 1 304 TYR 304 998 ? ? ? A . n A 1 305 ARG 305 999 ? ? ? A . n A 1 306 ALA 306 1000 ? ? ? A . n A 1 307 LEU 307 1001 ? ? ? A . n A 1 308 MET 308 1002 ? ? ? A . n A 1 309 ASP 309 1003 ? ? ? A . n A 1 310 GLU 310 1004 ? ? ? A . n A 1 311 GLU 311 1005 ? ? ? A . n A 1 312 ASP 312 1006 1006 ASP ASP A . n A 1 313 MET 313 1007 1007 MET MET A . n A 1 314 ASP 314 1008 1008 ASP ASP A . n A 1 315 ASP 315 1009 1009 ASP ASP A . n A 1 316 VAL 316 1010 1010 VAL VAL A . n A 1 317 VAL 317 1011 1011 VAL VAL A . n A 1 318 ASP 318 1012 1012 ASP ASP A . n A 1 319 ALA 319 1013 1013 ALA ALA A . n A 1 320 ASP 320 1014 1014 ASP ASP A . n A 1 321 GLU 321 1015 1015 GLU GLU A . n A 1 322 TYR 322 1016 1016 TYR TYR A . n A 1 323 LEU 323 1017 1017 LEU LEU A . n A 1 324 ILE 324 1018 1018 ILE ILE A . n A 1 325 PRO 325 1019 ? ? ? A . n A 1 326 GLN 326 1020 ? ? ? A . n A 1 327 GLN 327 1021 ? ? ? A . n A 1 328 GLY 328 1022 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email davidhep@buffalo.edu _pdbx_contact_author.name_first David _pdbx_contact_author.name_last Heppner _pdbx_contact_author.name_mi E _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-0722-5160 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZRT 1 1101 1101 ZRT LAZ A . C 3 HOH 1 1201 8 HOH HOH A . C 3 HOH 2 1202 10 HOH HOH A . C 3 HOH 3 1203 12 HOH HOH A . C 3 HOH 4 1204 2 HOH HOH A . C 3 HOH 5 1205 62 HOH HOH A . C 3 HOH 6 1206 3 HOH HOH A . C 3 HOH 7 1207 38 HOH HOH A . C 3 HOH 8 1208 34 HOH HOH A . C 3 HOH 9 1209 60 HOH HOH A . C 3 HOH 10 1210 4 HOH HOH A . C 3 HOH 11 1211 7 HOH HOH A . C 3 HOH 12 1212 11 HOH HOH A . C 3 HOH 13 1213 44 HOH HOH A . C 3 HOH 14 1214 6 HOH HOH A . C 3 HOH 15 1215 5 HOH HOH A . C 3 HOH 16 1216 29 HOH HOH A . C 3 HOH 17 1217 14 HOH HOH A . C 3 HOH 18 1218 24 HOH HOH A . C 3 HOH 19 1219 1 HOH HOH A . C 3 HOH 20 1220 30 HOH HOH A . C 3 HOH 21 1221 43 HOH HOH A . C 3 HOH 22 1222 17 HOH HOH A . C 3 HOH 23 1223 48 HOH HOH A . C 3 HOH 24 1224 13 HOH HOH A . C 3 HOH 25 1225 31 HOH HOH A . C 3 HOH 26 1226 63 HOH HOH A . C 3 HOH 27 1227 27 HOH HOH A . C 3 HOH 28 1228 26 HOH HOH A . C 3 HOH 29 1229 35 HOH HOH A . C 3 HOH 30 1230 42 HOH HOH A . C 3 HOH 31 1231 18 HOH HOH A . C 3 HOH 32 1232 39 HOH HOH A . C 3 HOH 33 1233 19 HOH HOH A . C 3 HOH 34 1234 20 HOH HOH A . C 3 HOH 35 1235 55 HOH HOH A . C 3 HOH 36 1236 40 HOH HOH A . C 3 HOH 37 1237 61 HOH HOH A . C 3 HOH 38 1238 36 HOH HOH A . C 3 HOH 39 1239 52 HOH HOH A . C 3 HOH 40 1240 15 HOH HOH A . C 3 HOH 41 1241 45 HOH HOH A . C 3 HOH 42 1242 51 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-11-23 2 'Structure model' 1 1 2022-12-28 3 'Structure model' 1 2 2023-10-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.pdbx_database_id_PubMed' 5 2 'Structure model' '_citation.title' 6 2 'Structure model' '_citation_author.identifier_ORCID' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? xia2 ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 7UKV _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 713 ? ? -117.83 60.80 2 1 ILE A 715 ? ? -101.97 -134.79 3 1 GLU A 734 ? ? -8.46 -101.33 4 1 PRO A 753 ? ? -106.17 -147.24 5 1 ASP A 837 ? ? -148.42 39.76 6 1 ASP A 855 ? ? 62.37 83.02 7 1 MET A 1007 ? ? 39.98 -142.93 8 1 ASP A 1008 ? ? 61.65 -71.35 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 716 ? CG ? A LYS 22 CG 2 1 Y 1 A LYS 716 ? CD ? A LYS 22 CD 3 1 Y 1 A LYS 716 ? CE ? A LYS 22 CE 4 1 Y 1 A LYS 716 ? NZ ? A LYS 22 NZ 5 1 Y 1 A LYS 728 ? CG ? A LYS 34 CG 6 1 Y 1 A LYS 728 ? CD ? A LYS 34 CD 7 1 Y 1 A LYS 728 ? CE ? A LYS 34 CE 8 1 Y 1 A LYS 728 ? NZ ? A LYS 34 NZ 9 1 Y 1 A GLN 982 ? CG ? A GLN 288 CG 10 1 Y 1 A GLN 982 ? CD ? A GLN 288 CD 11 1 Y 1 A GLN 982 ? OE1 ? A GLN 288 OE1 12 1 Y 1 A GLN 982 ? NE2 ? A GLN 288 NE2 13 1 Y 1 A GLU 985 ? CG ? A GLU 291 CG 14 1 Y 1 A GLU 985 ? CD ? A GLU 291 CD 15 1 Y 1 A GLU 985 ? OE1 ? A GLU 291 OE1 16 1 Y 1 A GLU 985 ? OE2 ? A GLU 291 OE2 17 1 Y 1 A ASP 1008 ? CG ? A ASP 314 CG 18 1 Y 1 A ASP 1008 ? OD1 ? A ASP 314 OD1 19 1 Y 1 A ASP 1008 ? OD2 ? A ASP 314 OD2 20 1 Y 1 A ASP 1009 ? CG ? A ASP 315 CG 21 1 Y 1 A ASP 1009 ? OD1 ? A ASP 315 OD1 22 1 Y 1 A ASP 1009 ? OD2 ? A ASP 315 OD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 695 ? A SER 1 2 1 Y 1 A ALA 722 ? A ALA 28 3 1 Y 1 A PHE 723 ? A PHE 29 4 1 Y 1 A LEU 747 ? A LEU 53 5 1 Y 1 A ARG 748 ? A ARG 54 6 1 Y 1 A GLU 749 ? A GLU 55 7 1 Y 1 A ALA 750 ? A ALA 56 8 1 Y 1 A THR 751 ? A THR 57 9 1 Y 1 A GLU 865 ? A GLU 171 10 1 Y 1 A GLU 866 ? A GLU 172 11 1 Y 1 A LYS 867 ? A LYS 173 12 1 Y 1 A GLU 872 ? A GLU 178 13 1 Y 1 A GLY 873 ? A GLY 179 14 1 Y 1 A GLY 874 ? A GLY 180 15 1 Y 1 A ARG 986 ? A ARG 292 16 1 Y 1 A MET 987 ? A MET 293 17 1 Y 1 A HIS 988 ? A HIS 294 18 1 Y 1 A LEU 989 ? A LEU 295 19 1 Y 1 A PRO 990 ? A PRO 296 20 1 Y 1 A SER 991 ? A SER 297 21 1 Y 1 A PRO 992 ? A PRO 298 22 1 Y 1 A THR 993 ? A THR 299 23 1 Y 1 A ASP 994 ? A ASP 300 24 1 Y 1 A SER 995 ? A SER 301 25 1 Y 1 A ASN 996 ? A ASN 302 26 1 Y 1 A PHE 997 ? A PHE 303 27 1 Y 1 A TYR 998 ? A TYR 304 28 1 Y 1 A ARG 999 ? A ARG 305 29 1 Y 1 A ALA 1000 ? A ALA 306 30 1 Y 1 A LEU 1001 ? A LEU 307 31 1 Y 1 A MET 1002 ? A MET 308 32 1 Y 1 A ASP 1003 ? A ASP 309 33 1 Y 1 A GLU 1004 ? A GLU 310 34 1 Y 1 A GLU 1005 ? A GLU 311 35 1 Y 1 A PRO 1019 ? A PRO 325 36 1 Y 1 A GLN 1020 ? A GLN 326 37 1 Y 1 A GLN 1021 ? A GLN 327 38 1 Y 1 A GLY 1022 ? A GLY 328 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 ZRT C10 C Y N 391 ZRT C01 C N N 392 ZRT C03 C N N 393 ZRT C04 C N N 394 ZRT C05 C Y N 395 ZRT C06 C Y N 396 ZRT C09 C Y N 397 ZRT C11 C Y N 398 ZRT C12 C Y N 399 ZRT C13 C Y N 400 ZRT C14 C Y N 401 ZRT C15 C Y N 402 ZRT C16 C Y N 403 ZRT C18 C Y N 404 ZRT C20 C Y N 405 ZRT C21 C Y N 406 ZRT C23 C Y N 407 ZRT C24 C Y N 408 ZRT C25 C Y N 409 ZRT C26 C Y N 410 ZRT C27 C Y N 411 ZRT C28 C Y N 412 ZRT C30 C N N 413 ZRT C32 C N N 414 ZRT C33 C N N 415 ZRT C35 C N N 416 ZRT C36 C N N 417 ZRT C38 C N N 418 ZRT C39 C N N 419 ZRT C41 C N N 420 ZRT N02 N N N 421 ZRT N07 N Y N 422 ZRT N08 N Y N 423 ZRT N17 N Y N 424 ZRT N19 N Y N 425 ZRT N22 N N N 426 ZRT N29 N N N 427 ZRT N34 N N N 428 ZRT O31 O N N 429 ZRT O37 O N N 430 ZRT O40 O N N 431 ZRT H1 H N N 432 ZRT H2 H N N 433 ZRT H3 H N N 434 ZRT H4 H N N 435 ZRT H5 H N N 436 ZRT H6 H N N 437 ZRT H7 H N N 438 ZRT H8 H N N 439 ZRT H9 H N N 440 ZRT H10 H N N 441 ZRT H11 H N N 442 ZRT H12 H N N 443 ZRT H13 H N N 444 ZRT H14 H N N 445 ZRT H15 H N N 446 ZRT H16 H N N 447 ZRT H17 H N N 448 ZRT H18 H N N 449 ZRT H19 H N N 450 ZRT H20 H N N 451 ZRT H21 H N N 452 ZRT H22 H N N 453 ZRT H23 H N N 454 ZRT H24 H N N 455 ZRT H25 H N N 456 ZRT H26 H N N 457 ZRT H27 H N N 458 ZRT H28 H N N 459 ZRT H29 H N N 460 ZRT H30 H N N 461 ZRT H31 H N N 462 ZRT H32 H N N 463 ZRT H34 H N N 464 ZRT H35 H N N 465 ZRT H33 H N N 466 ZRT H36 H N N 467 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 ZRT C36 O37 sing N N 376 ZRT C36 C35 sing N N 377 ZRT O37 C38 sing N N 378 ZRT C35 N34 sing N N 379 ZRT C41 O40 sing N N 380 ZRT C38 C39 sing N N 381 ZRT N34 C39 sing N N 382 ZRT N34 C26 sing N N 383 ZRT C25 C26 doub Y N 384 ZRT C25 C24 sing Y N 385 ZRT C26 C27 sing Y N 386 ZRT O40 C24 sing N N 387 ZRT C24 C23 doub Y N 388 ZRT C27 N29 sing N N 389 ZRT C27 C28 doub Y N 390 ZRT N29 C30 sing N N 391 ZRT C23 C28 sing Y N 392 ZRT C23 N22 sing N N 393 ZRT C33 C32 sing N N 394 ZRT N22 C18 sing N N 395 ZRT C30 C32 sing N N 396 ZRT C30 O31 doub N N 397 ZRT C18 N19 doub Y N 398 ZRT C18 N17 sing Y N 399 ZRT N19 C20 sing Y N 400 ZRT N17 C16 doub Y N 401 ZRT C20 C21 doub Y N 402 ZRT C16 C21 sing Y N 403 ZRT C16 N07 sing N N 404 ZRT C06 N07 sing Y N 405 ZRT C06 C05 doub Y N 406 ZRT C01 N02 sing N N 407 ZRT N07 N08 sing Y N 408 ZRT C03 N02 sing N N 409 ZRT C04 C05 sing N N 410 ZRT C04 N02 sing N N 411 ZRT C05 C09 sing Y N 412 ZRT N08 C09 doub Y N 413 ZRT C09 C10 sing N N 414 ZRT C10 C11 doub Y N 415 ZRT C10 C15 sing Y N 416 ZRT C11 C12 sing Y N 417 ZRT C15 C14 doub Y N 418 ZRT C12 C13 doub Y N 419 ZRT C14 C13 sing Y N 420 ZRT C01 H1 sing N N 421 ZRT C01 H2 sing N N 422 ZRT C01 H3 sing N N 423 ZRT C03 H4 sing N N 424 ZRT C03 H5 sing N N 425 ZRT C03 H6 sing N N 426 ZRT C04 H7 sing N N 427 ZRT C04 H8 sing N N 428 ZRT C06 H9 sing N N 429 ZRT C11 H10 sing N N 430 ZRT C12 H11 sing N N 431 ZRT C13 H12 sing N N 432 ZRT C14 H13 sing N N 433 ZRT C15 H14 sing N N 434 ZRT C20 H15 sing N N 435 ZRT C21 H16 sing N N 436 ZRT C25 H17 sing N N 437 ZRT C28 H18 sing N N 438 ZRT C32 H19 sing N N 439 ZRT C33 H20 sing N N 440 ZRT C33 H21 sing N N 441 ZRT C35 H22 sing N N 442 ZRT C35 H23 sing N N 443 ZRT C36 H24 sing N N 444 ZRT C36 H25 sing N N 445 ZRT C38 H26 sing N N 446 ZRT C38 H27 sing N N 447 ZRT C39 H28 sing N N 448 ZRT C39 H29 sing N N 449 ZRT C41 H30 sing N N 450 ZRT C41 H31 sing N N 451 ZRT C41 H32 sing N N 452 ZRT N22 H34 sing N N 453 ZRT N29 H35 sing N N 454 ZRT C32 H33 sing N N 455 ZRT C33 H36 sing N N 456 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' R01CA116020 1 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' R01CA201049 2 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' R35CA242461 3 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' F32CA247198 4 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ZRT _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ZRT _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ;N-[5-{[(4P)-4-{4-[(dimethylamino)methyl]-3-phenyl-1H-pyrazol-1-yl}pyrimidin-2-yl]amino}-4-methoxy-2-(morpholin-4-yl)phenyl]propanamide ; ZRT 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6VH4 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #