data_7UO6 # _entry.id 7UO6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.366 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7UO6 pdb_00007uo6 10.2210/pdb7uo6/pdb WWPDB D_1000264536 ? ? BMRB 50074 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 50074 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7UO6 _pdbx_database_status.recvd_initial_deposition_date 2022-04-12 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Ayyappan, S.' 1 0000-0001-5739-8257 'Mohanty, S.' 2 0000-0002-1680-6338 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Protein Sci.' _citation.journal_id_ASTM PRCIEI _citation.journal_id_CSD 0795 _citation.journal_id_ISSN 1469-896X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 31 _citation.language ? _citation.page_first e4438 _citation.page_last e4438 _citation.title 'Ostrinia furnacalis PBP2 solution NMR structure: Insight into ligand binding and release mechanisms.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/pro.4438 _citation.pdbx_database_id_PubMed 36173163 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dahal, S.R.' 1 ? primary 'Lewellen, J.L.' 2 ? primary 'Ayyappan, S.' 3 ? primary 'Chaudhary, B.P.' 4 ? primary 'Nukala, V.' 5 ? primary 'Mohanty, S.' 6 0000-0002-1680-6338 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Pheromone binding protein 2' _entity.formula_weight 16122.551 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SQAVMKDMTKNFIKAYEVCAKEYNLPEAAGAEVMNFWKEGYVLTSREAGCAILCLSSKLNLLDPEGTLHRGNTVEFAKQH GSDDAMAHQLVDIVHACEKSVPPNEDNCLMALGISMCFKTEIHKLNWAPDHELLLEEMMAEMKQ ; _entity_poly.pdbx_seq_one_letter_code_can ;SQAVMKDMTKNFIKAYEVCAKEYNLPEAAGAEVMNFWKEGYVLTSREAGCAILCLSSKLNLLDPEGTLHRGNTVEFAKQH GSDDAMAHQLVDIVHACEKSVPPNEDNCLMALGISMCFKTEIHKLNWAPDHELLLEEMMAEMKQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLN n 1 3 ALA n 1 4 VAL n 1 5 MET n 1 6 LYS n 1 7 ASP n 1 8 MET n 1 9 THR n 1 10 LYS n 1 11 ASN n 1 12 PHE n 1 13 ILE n 1 14 LYS n 1 15 ALA n 1 16 TYR n 1 17 GLU n 1 18 VAL n 1 19 CYS n 1 20 ALA n 1 21 LYS n 1 22 GLU n 1 23 TYR n 1 24 ASN n 1 25 LEU n 1 26 PRO n 1 27 GLU n 1 28 ALA n 1 29 ALA n 1 30 GLY n 1 31 ALA n 1 32 GLU n 1 33 VAL n 1 34 MET n 1 35 ASN n 1 36 PHE n 1 37 TRP n 1 38 LYS n 1 39 GLU n 1 40 GLY n 1 41 TYR n 1 42 VAL n 1 43 LEU n 1 44 THR n 1 45 SER n 1 46 ARG n 1 47 GLU n 1 48 ALA n 1 49 GLY n 1 50 CYS n 1 51 ALA n 1 52 ILE n 1 53 LEU n 1 54 CYS n 1 55 LEU n 1 56 SER n 1 57 SER n 1 58 LYS n 1 59 LEU n 1 60 ASN n 1 61 LEU n 1 62 LEU n 1 63 ASP n 1 64 PRO n 1 65 GLU n 1 66 GLY n 1 67 THR n 1 68 LEU n 1 69 HIS n 1 70 ARG n 1 71 GLY n 1 72 ASN n 1 73 THR n 1 74 VAL n 1 75 GLU n 1 76 PHE n 1 77 ALA n 1 78 LYS n 1 79 GLN n 1 80 HIS n 1 81 GLY n 1 82 SER n 1 83 ASP n 1 84 ASP n 1 85 ALA n 1 86 MET n 1 87 ALA n 1 88 HIS n 1 89 GLN n 1 90 LEU n 1 91 VAL n 1 92 ASP n 1 93 ILE n 1 94 VAL n 1 95 HIS n 1 96 ALA n 1 97 CYS n 1 98 GLU n 1 99 LYS n 1 100 SER n 1 101 VAL n 1 102 PRO n 1 103 PRO n 1 104 ASN n 1 105 GLU n 1 106 ASP n 1 107 ASN n 1 108 CYS n 1 109 LEU n 1 110 MET n 1 111 ALA n 1 112 LEU n 1 113 GLY n 1 114 ILE n 1 115 SER n 1 116 MET n 1 117 CYS n 1 118 PHE n 1 119 LYS n 1 120 THR n 1 121 GLU n 1 122 ILE n 1 123 HIS n 1 124 LYS n 1 125 LEU n 1 126 ASN n 1 127 TRP n 1 128 ALA n 1 129 PRO n 1 130 ASP n 1 131 HIS n 1 132 GLU n 1 133 LEU n 1 134 LEU n 1 135 LEU n 1 136 GLU n 1 137 GLU n 1 138 MET n 1 139 MET n 1 140 ALA n 1 141 GLU n 1 142 MET n 1 143 LYS n 1 144 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 144 _entity_src_gen.gene_src_common_name 'Asian corn borer' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'PBP2, OfurPBP2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Ostrinia furnacalis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 93504 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code E7CCA0_OSTFU _struct_ref.pdbx_db_accession E7CCA0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SQAVMKDMTKNFIKAYEVCAKEYNLPEAAGAEVMNFWKEGYVLTSREAGCAILCLSSKLNLLDPEGTLHRGNTVEFAKQH GSDDAMAHQLVDIVHACEKSVPPNEDNCLMALGISMCFKTEIHKLNWAPDHELLLEEMMAEMKQ ; _struct_ref.pdbx_align_begin 23 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7UO6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 144 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession E7CCA0 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 166 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 144 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D 1H-15N NOESY' 1 isotropic 3 1 1 '3D 1H-13C NOESY aliphatic' 1 isotropic 4 1 1 '3D 1H-13C NOESY aromatic' 1 isotropic 5 1 1 '3D HNCACB' 1 isotropic 6 1 1 '3D HNCA' 1 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label sample_conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '400 uM [U-13C; U-15N] Pheromone-binding protein 2, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 'U-13C; U-15N' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 7UO6 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 7UO6 _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7UO6 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CYANA ? 'Guntert, Mumenthaler and Wuthrich' 2 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' NMRFAM-SPARKY ? 'Markley JL.' 4 'peak picking' NMRFAM-SPARKY ? 'Markley JL.' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7UO6 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7UO6 _struct.title 'NMR structure of Pheromone-binding protein 2 in Ostrinia furnacalis' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7UO6 _struct_keywords.text 'pheromone binding, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 3 ? ILE A 13 ? ALA A 3 ILE A 13 1 ? 11 HELX_P HELX_P2 AA2 ALA A 15 ? ASN A 24 ? ALA A 15 ASN A 24 1 ? 10 HELX_P HELX_P3 AA3 PRO A 26 ? PHE A 36 ? PRO A 26 PHE A 36 1 ? 11 HELX_P HELX_P4 AA4 SER A 45 ? ASN A 60 ? SER A 45 ASN A 60 1 ? 16 HELX_P HELX_P5 AA5 HIS A 69 ? GLN A 79 ? HIS A 69 GLN A 79 1 ? 11 HELX_P HELX_P6 AA6 ASP A 83 ? VAL A 101 ? ASP A 83 VAL A 101 1 ? 19 HELX_P HELX_P7 AA7 ASP A 106 ? LEU A 125 ? ASP A 106 LEU A 125 1 ? 20 HELX_P HELX_P8 AA8 ASP A 130 ? GLN A 144 ? ASP A 130 GLN A 144 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 19 SG ? ? ? 1_555 A CYS 54 SG ? ? A CYS 19 A CYS 54 1_555 ? ? ? ? ? ? ? 2.030 ? ? disulf2 disulf ? ? A CYS 50 SG ? ? ? 1_555 A CYS 108 SG ? ? A CYS 50 A CYS 108 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf3 disulf ? ? A CYS 97 SG ? ? ? 1_555 A CYS 117 SG ? ? A CYS 97 A CYS 117 1_555 ? ? ? ? ? ? ? 2.026 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 7UO6 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 MET 8 8 8 MET MET A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 MET 34 34 34 MET MET A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 CYS 50 50 50 CYS CYS A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 SER 57 57 57 SER SER A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 LEU 61 61 61 LEU LEU A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 THR 67 67 67 THR THR A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 GLN 79 79 79 GLN GLN A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 MET 86 86 86 MET MET A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 GLN 89 89 89 GLN GLN A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 HIS 95 95 95 HIS HIS A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 CYS 97 97 97 CYS CYS A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 ASN 104 104 104 ASN ASN A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 CYS 108 108 108 CYS CYS A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 MET 110 110 110 MET MET A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 SER 115 115 115 SER SER A . n A 1 116 MET 116 116 116 MET MET A . n A 1 117 CYS 117 117 117 CYS CYS A . n A 1 118 PHE 118 118 118 PHE PHE A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 GLU 121 121 121 GLU GLU A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 HIS 123 123 123 HIS HIS A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ASN 126 126 126 ASN ASN A . n A 1 127 TRP 127 127 127 TRP TRP A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 ASP 130 130 130 ASP ASP A . n A 1 131 HIS 131 131 131 HIS HIS A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 MET 138 138 138 MET MET A . n A 1 139 MET 139 139 139 MET MET A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 GLU 141 141 141 GLU GLU A . n A 1 142 MET 142 142 142 MET MET A . n A 1 143 LYS 143 143 143 LYS LYS A . n A 1 144 GLN 144 144 144 GLN GLN A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email smita.mohanty@okstate.edu _pdbx_contact_author.name_first Smita _pdbx_contact_author.name_last Mohanty _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-1680-6338 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-02-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component 'Pheromone-binding protein 2' _pdbx_nmr_exptl_sample.concentration 400 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units uM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-13C; U-15N]' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 2 HB1 A ALA 77 ? ? HG A SER 82 ? ? 1.25 2 9 HB1 A ALA 77 ? ? HG A SER 82 ? ? 1.33 3 10 HB1 A ALA 77 ? ? HG A SER 82 ? ? 1.20 4 13 HB1 A ALA 77 ? ? HG A SER 82 ? ? 1.28 5 15 HB1 A ALA 77 ? ? HG A SER 82 ? ? 1.25 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 124.74 120.30 4.44 0.50 N 2 1 NE A ARG 70 ? ? CZ A ARG 70 ? ? NH1 A ARG 70 ? ? 125.03 120.30 4.73 0.50 N 3 2 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 125.60 120.30 5.30 0.50 N 4 2 NE A ARG 70 ? ? CZ A ARG 70 ? ? NH1 A ARG 70 ? ? 123.42 120.30 3.12 0.50 N 5 3 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 124.22 120.30 3.92 0.50 N 6 3 NE A ARG 70 ? ? CZ A ARG 70 ? ? NH1 A ARG 70 ? ? 124.27 120.30 3.97 0.50 N 7 4 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 124.78 120.30 4.48 0.50 N 8 4 NE A ARG 70 ? ? CZ A ARG 70 ? ? NH1 A ARG 70 ? ? 123.48 120.30 3.18 0.50 N 9 5 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 124.23 120.30 3.93 0.50 N 10 5 NE A ARG 70 ? ? CZ A ARG 70 ? ? NH1 A ARG 70 ? ? 124.41 120.30 4.11 0.50 N 11 6 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 124.40 120.30 4.10 0.50 N 12 6 NE A ARG 70 ? ? CZ A ARG 70 ? ? NH1 A ARG 70 ? ? 124.34 120.30 4.04 0.50 N 13 7 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 124.76 120.30 4.46 0.50 N 14 7 NE A ARG 70 ? ? CZ A ARG 70 ? ? NH1 A ARG 70 ? ? 124.50 120.30 4.20 0.50 N 15 8 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 123.62 120.30 3.32 0.50 N 16 8 NE A ARG 70 ? ? CZ A ARG 70 ? ? NH1 A ARG 70 ? ? 124.51 120.30 4.21 0.50 N 17 9 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 124.40 120.30 4.10 0.50 N 18 9 NE A ARG 70 ? ? CZ A ARG 70 ? ? NH1 A ARG 70 ? ? 124.47 120.30 4.17 0.50 N 19 10 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 124.75 120.30 4.45 0.50 N 20 10 NE A ARG 70 ? ? CZ A ARG 70 ? ? NH1 A ARG 70 ? ? 124.31 120.30 4.01 0.50 N 21 11 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 125.16 120.30 4.86 0.50 N 22 11 NE A ARG 70 ? ? CZ A ARG 70 ? ? NH1 A ARG 70 ? ? 124.68 120.30 4.38 0.50 N 23 12 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 125.20 120.30 4.90 0.50 N 24 12 NE A ARG 70 ? ? CZ A ARG 70 ? ? NH1 A ARG 70 ? ? 124.90 120.30 4.60 0.50 N 25 12 NE A ARG 70 ? ? CZ A ARG 70 ? ? NH2 A ARG 70 ? ? 116.97 120.30 -3.33 0.50 N 26 13 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 124.28 120.30 3.98 0.50 N 27 13 NE A ARG 70 ? ? CZ A ARG 70 ? ? NH1 A ARG 70 ? ? 124.04 120.30 3.74 0.50 N 28 14 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 124.28 120.30 3.98 0.50 N 29 14 NE A ARG 70 ? ? CZ A ARG 70 ? ? NH1 A ARG 70 ? ? 124.52 120.30 4.22 0.50 N 30 15 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 124.01 120.30 3.71 0.50 N 31 15 NE A ARG 70 ? ? CZ A ARG 70 ? ? NH1 A ARG 70 ? ? 124.64 120.30 4.34 0.50 N 32 16 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 124.85 120.30 4.55 0.50 N 33 16 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH2 A ARG 46 ? ? 117.12 120.30 -3.18 0.50 N 34 16 NE A ARG 70 ? ? CZ A ARG 70 ? ? NH1 A ARG 70 ? ? 124.41 120.30 4.11 0.50 N 35 17 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 125.05 120.30 4.75 0.50 N 36 17 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH2 A ARG 46 ? ? 117.09 120.30 -3.21 0.50 N 37 17 NE A ARG 70 ? ? CZ A ARG 70 ? ? NH1 A ARG 70 ? ? 124.54 120.30 4.24 0.50 N 38 18 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 124.21 120.30 3.91 0.50 N 39 18 NE A ARG 70 ? ? CZ A ARG 70 ? ? NH1 A ARG 70 ? ? 124.26 120.30 3.96 0.50 N 40 19 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 124.53 120.30 4.23 0.50 N 41 19 NE A ARG 70 ? ? CZ A ARG 70 ? ? NH1 A ARG 70 ? ? 123.98 120.30 3.68 0.50 N 42 20 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH1 A ARG 46 ? ? 123.73 120.30 3.43 0.50 N 43 20 NE A ARG 70 ? ? CZ A ARG 70 ? ? NH1 A ARG 70 ? ? 123.97 120.30 3.67 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 61 ? ? -88.91 43.55 2 3 LEU A 61 ? ? -87.39 44.73 3 3 ASP A 130 ? ? -107.14 71.88 4 4 ASP A 130 ? ? -103.47 71.26 5 8 LEU A 61 ? ? -80.52 44.34 6 11 GLN A 2 ? ? -94.09 46.82 7 13 THR A 44 ? ? -143.27 19.04 8 15 HIS A 69 ? ? -69.86 92.40 9 16 THR A 44 ? ? -143.60 12.29 10 16 LEU A 61 ? ? -94.05 47.00 11 19 SER A 82 ? ? -68.91 -175.97 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 3 TYR A 16 ? ? 0.083 'SIDE CHAIN' 2 7 TYR A 16 ? ? 0.075 'SIDE CHAIN' 3 10 TYR A 16 ? ? 0.107 'SIDE CHAIN' # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Science Foundation (NSF, United States)' 'United States' CHE-1807722 1 'National Science Foundation (NSF, United States)' 'United States' DBI-1726397 2 'National Science Foundation (NSF, United States)' 'United States' DMR-1644779 3 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details ? #