data_7US9 # _entry.id 7US9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.360 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7US9 pdb_00007us9 10.2210/pdb7us9/pdb WWPDB D_1000264801 ? ? EMDB EMD-26729 ? ? # _pdbx_database_related.db_name EMDB _pdbx_database_related.details 'CCoV-HuPn-2018 D0 in proximal conformation' _pdbx_database_related.db_id EMD-26729 _pdbx_database_related.content_type 'associated EM volume' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7US9 _pdbx_database_status.recvd_initial_deposition_date 2022-04-23 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Tortorici, M.A.' 1 0000-0002-2260-2577 'Veesler, D.' 2 0000-0002-6019-8675 'Seattle Structural Genomics Center for Infectious Disease (SSGCID)' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Cell _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1097-4172 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 185 _citation.language ? _citation.page_first 2279 _citation.page_last 2291.e17 _citation.title 'Structure, receptor recognition, and antigenicity of the human coronavirus CCoV-HuPn-2018 spike glycoprotein.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.cell.2022.05.019 _citation.pdbx_database_id_PubMed 35700730 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tortorici, M.A.' 1 ? primary 'Walls, A.C.' 2 ? primary 'Joshi, A.' 3 ? primary 'Park, Y.J.' 4 ? primary 'Eguia, R.T.' 5 ? primary 'Miranda, M.C.' 6 ? primary 'Kepl, E.' 7 ? primary 'Dosey, A.' 8 ? primary 'Stevens-Ayers, T.' 9 ? primary 'Boeckh, M.J.' 10 ? primary 'Telenti, A.' 11 ? primary 'Lanzavecchia, A.' 12 ? primary 'King, N.P.' 13 ? primary 'Corti, D.' 14 ? primary 'Bloom, J.D.' 15 ? primary 'Veesler, D.' 16 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 7US9 _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.00 _cell.length_a_esd ? _cell.length_b 1.00 _cell.length_b_esd ? _cell.length_c 1.00 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 7US9 _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Spike glycoprotein' 29960.043 1 ? ? 'CCoV-HuPn-2018 Spike domain 0 in proximal conformation' ? 2 branched man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401 1 ? ? ? ? 3 non-polymer syn 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'S glycoprotein,E2,Peplomer protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGILPSPGMPALLSLVSLLSVLLMGCVAETGTDNFPCSKFLNRTIGNHWNLIENFLLNYSIRLPPNSDVVLGDYFPTVQP WFNCIRNNNNSLYVTMENLKALYWDYATENITSDHRQRLHVVVKGKPYSITVTTTRNFDAAEGAIICICKGSPPTTTTGN LDCNWGSDCRLNHKFPICPSNSQANCGNMLYGLQWFTDEVVAYLHGAIYRISFENKWFGTVTLGDMRATTLQTAGALVDL WWFNPVYDVTYYRVNNKNGTTIVSNCT ; _entity_poly.pdbx_seq_one_letter_code_can ;MGILPSPGMPALLSLVSLLSVLLMGCVAETGTDNFPCSKFLNRTIGNHWNLIENFLLNYSIRLPPNSDVVLGDYFPTVQP WFNCIRNNNNSLYVTMENLKALYWDYATENITSDHRQRLHVVVKGKPYSITVTTTRNFDAAEGAIICICKGSPPTTTTGN LDCNWGSDCRLNHKFPICPSNSQANCGNMLYGLQWFTDEVVAYLHGAIYRISFENKWFGTVTLGDMRATTLQTAGALVDL WWFNPVYDVTYYRVNNKNGTTIVSNCT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 ILE n 1 4 LEU n 1 5 PRO n 1 6 SER n 1 7 PRO n 1 8 GLY n 1 9 MET n 1 10 PRO n 1 11 ALA n 1 12 LEU n 1 13 LEU n 1 14 SER n 1 15 LEU n 1 16 VAL n 1 17 SER n 1 18 LEU n 1 19 LEU n 1 20 SER n 1 21 VAL n 1 22 LEU n 1 23 LEU n 1 24 MET n 1 25 GLY n 1 26 CYS n 1 27 VAL n 1 28 ALA n 1 29 GLU n 1 30 THR n 1 31 GLY n 1 32 THR n 1 33 ASP n 1 34 ASN n 1 35 PHE n 1 36 PRO n 1 37 CYS n 1 38 SER n 1 39 LYS n 1 40 PHE n 1 41 LEU n 1 42 ASN n 1 43 ARG n 1 44 THR n 1 45 ILE n 1 46 GLY n 1 47 ASN n 1 48 HIS n 1 49 TRP n 1 50 ASN n 1 51 LEU n 1 52 ILE n 1 53 GLU n 1 54 ASN n 1 55 PHE n 1 56 LEU n 1 57 LEU n 1 58 ASN n 1 59 TYR n 1 60 SER n 1 61 ILE n 1 62 ARG n 1 63 LEU n 1 64 PRO n 1 65 PRO n 1 66 ASN n 1 67 SER n 1 68 ASP n 1 69 VAL n 1 70 VAL n 1 71 LEU n 1 72 GLY n 1 73 ASP n 1 74 TYR n 1 75 PHE n 1 76 PRO n 1 77 THR n 1 78 VAL n 1 79 GLN n 1 80 PRO n 1 81 TRP n 1 82 PHE n 1 83 ASN n 1 84 CYS n 1 85 ILE n 1 86 ARG n 1 87 ASN n 1 88 ASN n 1 89 ASN n 1 90 ASN n 1 91 SER n 1 92 LEU n 1 93 TYR n 1 94 VAL n 1 95 THR n 1 96 MET n 1 97 GLU n 1 98 ASN n 1 99 LEU n 1 100 LYS n 1 101 ALA n 1 102 LEU n 1 103 TYR n 1 104 TRP n 1 105 ASP n 1 106 TYR n 1 107 ALA n 1 108 THR n 1 109 GLU n 1 110 ASN n 1 111 ILE n 1 112 THR n 1 113 SER n 1 114 ASP n 1 115 HIS n 1 116 ARG n 1 117 GLN n 1 118 ARG n 1 119 LEU n 1 120 HIS n 1 121 VAL n 1 122 VAL n 1 123 VAL n 1 124 LYS n 1 125 GLY n 1 126 LYS n 1 127 PRO n 1 128 TYR n 1 129 SER n 1 130 ILE n 1 131 THR n 1 132 VAL n 1 133 THR n 1 134 THR n 1 135 THR n 1 136 ARG n 1 137 ASN n 1 138 PHE n 1 139 ASP n 1 140 ALA n 1 141 ALA n 1 142 GLU n 1 143 GLY n 1 144 ALA n 1 145 ILE n 1 146 ILE n 1 147 CYS n 1 148 ILE n 1 149 CYS n 1 150 LYS n 1 151 GLY n 1 152 SER n 1 153 PRO n 1 154 PRO n 1 155 THR n 1 156 THR n 1 157 THR n 1 158 THR n 1 159 GLY n 1 160 ASN n 1 161 LEU n 1 162 ASP n 1 163 CYS n 1 164 ASN n 1 165 TRP n 1 166 GLY n 1 167 SER n 1 168 ASP n 1 169 CYS n 1 170 ARG n 1 171 LEU n 1 172 ASN n 1 173 HIS n 1 174 LYS n 1 175 PHE n 1 176 PRO n 1 177 ILE n 1 178 CYS n 1 179 PRO n 1 180 SER n 1 181 ASN n 1 182 SER n 1 183 GLN n 1 184 ALA n 1 185 ASN n 1 186 CYS n 1 187 GLY n 1 188 ASN n 1 189 MET n 1 190 LEU n 1 191 TYR n 1 192 GLY n 1 193 LEU n 1 194 GLN n 1 195 TRP n 1 196 PHE n 1 197 THR n 1 198 ASP n 1 199 GLU n 1 200 VAL n 1 201 VAL n 1 202 ALA n 1 203 TYR n 1 204 LEU n 1 205 HIS n 1 206 GLY n 1 207 ALA n 1 208 ILE n 1 209 TYR n 1 210 ARG n 1 211 ILE n 1 212 SER n 1 213 PHE n 1 214 GLU n 1 215 ASN n 1 216 LYS n 1 217 TRP n 1 218 PHE n 1 219 GLY n 1 220 THR n 1 221 VAL n 1 222 THR n 1 223 LEU n 1 224 GLY n 1 225 ASP n 1 226 MET n 1 227 ARG n 1 228 ALA n 1 229 THR n 1 230 THR n 1 231 LEU n 1 232 GLN n 1 233 THR n 1 234 ALA n 1 235 GLY n 1 236 ALA n 1 237 LEU n 1 238 VAL n 1 239 ASP n 1 240 LEU n 1 241 TRP n 1 242 TRP n 1 243 PHE n 1 244 ASN n 1 245 PRO n 1 246 VAL n 1 247 TYR n 1 248 ASP n 1 249 VAL n 1 250 THR n 1 251 TYR n 1 252 TYR n 1 253 ARG n 1 254 VAL n 1 255 ASN n 1 256 ASN n 1 257 LYS n 1 258 ASN n 1 259 GLY n 1 260 THR n 1 261 THR n 1 262 ILE n 1 263 VAL n 1 264 SER n 1 265 ASN n 1 266 CYS n 1 267 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 267 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'unidentified human coronavirus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 694448 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'mammal environmental sample' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 1092587 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A8E6CMP0_9ALPC _struct_ref.pdbx_db_accession A0A8E6CMP0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DNFPCSKFLNRTIGNHWNLIENFLLNYSIRLPPNSDVVLGDYFPTVQPWFNCIRNNNNSLYVTMENLKALYWDYATENIT SDHRQRLHVVVKGKPYSITVTTTRNFDAAEGAIICICKGSPPTTTTGNLDCNWGSDCRLNHKFPICPSNSQANCGNMLYG LQWFTDEVVAYLHGAIYRISFENKWFGTVTLGDMRATTLQTAGALVDLWWFNPVYDVTYYRVNNKNGTTIVSNCT ; _struct_ref.pdbx_align_begin 17 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7US9 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 33 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 267 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A8E6CMP0 _struct_ref_seq.db_align_beg 17 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 251 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 17 _struct_ref_seq.pdbx_auth_seq_align_end 251 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7US9 MET A 1 ? UNP A0A8E6CMP0 ? ? 'initiating methionine' -15 1 1 7US9 GLY A 2 ? UNP A0A8E6CMP0 ? ? 'expression tag' -14 2 1 7US9 ILE A 3 ? UNP A0A8E6CMP0 ? ? 'expression tag' -13 3 1 7US9 LEU A 4 ? UNP A0A8E6CMP0 ? ? 'expression tag' -12 4 1 7US9 PRO A 5 ? UNP A0A8E6CMP0 ? ? 'expression tag' -11 5 1 7US9 SER A 6 ? UNP A0A8E6CMP0 ? ? 'expression tag' -10 6 1 7US9 PRO A 7 ? UNP A0A8E6CMP0 ? ? 'expression tag' -9 7 1 7US9 GLY A 8 ? UNP A0A8E6CMP0 ? ? 'expression tag' -8 8 1 7US9 MET A 9 ? UNP A0A8E6CMP0 ? ? 'expression tag' -7 9 1 7US9 PRO A 10 ? UNP A0A8E6CMP0 ? ? 'expression tag' -6 10 1 7US9 ALA A 11 ? UNP A0A8E6CMP0 ? ? 'expression tag' -5 11 1 7US9 LEU A 12 ? UNP A0A8E6CMP0 ? ? 'expression tag' -4 12 1 7US9 LEU A 13 ? UNP A0A8E6CMP0 ? ? 'expression tag' -3 13 1 7US9 SER A 14 ? UNP A0A8E6CMP0 ? ? 'expression tag' -2 14 1 7US9 LEU A 15 ? UNP A0A8E6CMP0 ? ? 'expression tag' -1 15 1 7US9 VAL A 16 ? UNP A0A8E6CMP0 ? ? 'expression tag' 0 16 1 7US9 SER A 17 ? UNP A0A8E6CMP0 ? ? 'expression tag' 1 17 1 7US9 LEU A 18 ? UNP A0A8E6CMP0 ? ? 'expression tag' 2 18 1 7US9 LEU A 19 ? UNP A0A8E6CMP0 ? ? 'expression tag' 3 19 1 7US9 SER A 20 ? UNP A0A8E6CMP0 ? ? 'expression tag' 4 20 1 7US9 VAL A 21 ? UNP A0A8E6CMP0 ? ? 'expression tag' 5 21 1 7US9 LEU A 22 ? UNP A0A8E6CMP0 ? ? 'expression tag' 6 22 1 7US9 LEU A 23 ? UNP A0A8E6CMP0 ? ? 'expression tag' 7 23 1 7US9 MET A 24 ? UNP A0A8E6CMP0 ? ? 'expression tag' 8 24 1 7US9 GLY A 25 ? UNP A0A8E6CMP0 ? ? 'expression tag' 9 25 1 7US9 CYS A 26 ? UNP A0A8E6CMP0 ? ? 'expression tag' 10 26 1 7US9 VAL A 27 ? UNP A0A8E6CMP0 ? ? 'expression tag' 11 27 1 7US9 ALA A 28 ? UNP A0A8E6CMP0 ? ? 'expression tag' 12 28 1 7US9 GLU A 29 ? UNP A0A8E6CMP0 ? ? 'expression tag' 13 29 1 7US9 THR A 30 ? UNP A0A8E6CMP0 ? ? 'expression tag' 14 30 1 7US9 GLY A 31 ? UNP A0A8E6CMP0 ? ? 'expression tag' 15 31 1 7US9 THR A 32 ? UNP A0A8E6CMP0 ? ? 'expression tag' 16 32 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7US9 _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _struct.entry_id 7US9 _struct.title 'CCoV-HuPn-2018 S in the proximal conformation (local refinement of domain 0)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7US9 _struct_keywords.text ;Human coronavirus, Coronavirus, CCoV-HuPn-2018, spike glycoprotein, Alpha-coronaviruses, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, VIRAL PROTEIN ; _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id HIS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 48 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ILE _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 61 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id HIS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 32 _struct_conf.end_auth_comp_id ILE _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 45 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 149 SG ? ? ? 1_555 A CYS 169 SG ? ? A CYS 133 A CYS 153 1_555 ? ? ? ? ? ? ? 2.088 ? ? covale1 covale one ? A ASN 58 ND2 ? ? ? 1_555 C NAG . C1 ? ? A ASN 42 A NAG 301 1_555 ? ? ? ? ? ? ? 1.503 ? N-Glycosylation covale2 covale one ? A ASN 258 ND2 ? ? ? 1_555 D NAG . C1 ? ? A ASN 242 A NAG 302 1_555 ? ? ? ? ? ? ? 1.510 ? N-Glycosylation covale3 covale one ? A ASN 265 ND2 ? ? ? 1_555 B NAG . C1 ? ? A ASN 249 B NAG 1 1_555 ? ? ? ? ? ? ? 1.509 ? N-Glycosylation covale4 covale both ? B NAG . O4 ? ? ? 1_555 B NAG . C1 ? ? B NAG 1 B NAG 2 1_555 ? ? ? ? ? ? ? 1.511 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 126 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 110 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 127 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 111 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -2.64 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 6 ? AA3 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASP A 68 ? ASP A 73 ? ASP A 52 ASP A 57 AA1 2 THR A 250 ? ASN A 255 ? THR A 234 ASN A 239 AA1 3 ILE A 262 ? ASN A 265 ? ILE A 246 ASN A 249 AA2 1 VAL A 94 ? GLU A 97 ? VAL A 78 GLU A 81 AA2 2 LYS A 216 ? LEU A 223 ? LYS A 200 LEU A 207 AA2 3 VAL A 121 ? LYS A 126 ? VAL A 105 LYS A 110 AA2 4 TYR A 128 ? VAL A 132 ? TYR A 112 VAL A 116 AA2 5 ILE A 145 ? LYS A 150 ? ILE A 129 LYS A 134 AA2 6 CYS A 169 ? LYS A 174 ? CYS A 153 LYS A 158 AA3 1 ALA A 207 ? SER A 212 ? ALA A 191 SER A 196 AA3 2 GLU A 199 ? LEU A 204 ? GLU A 183 LEU A 188 AA3 3 TYR A 191 ? PHE A 196 ? TYR A 175 PHE A 180 AA3 4 ALA A 101 ? TRP A 104 ? ALA A 85 TRP A 88 AA3 5 PHE A 243 ? VAL A 246 ? PHE A 227 VAL A 230 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 71 ? N LEU A 55 O TYR A 252 ? O TYR A 236 AA1 2 3 N ARG A 253 ? N ARG A 237 O SER A 264 ? O SER A 248 AA2 1 2 N VAL A 94 ? N VAL A 78 O LEU A 223 ? O LEU A 207 AA2 2 3 O THR A 222 ? O THR A 206 N VAL A 122 ? N VAL A 106 AA2 3 4 N VAL A 123 ? N VAL A 107 O ILE A 130 ? O ILE A 114 AA2 4 5 N THR A 131 ? N THR A 115 O CYS A 147 ? O CYS A 131 AA2 5 6 N ILE A 148 ? N ILE A 132 O ARG A 170 ? O ARG A 154 AA3 1 2 O ILE A 211 ? O ILE A 195 N VAL A 200 ? N VAL A 184 AA3 2 3 O VAL A 201 ? O VAL A 185 N GLN A 194 ? N GLN A 178 AA3 3 4 O TYR A 191 ? O TYR A 175 N TRP A 104 ? N TRP A 88 AA3 4 5 N TYR A 103 ? N TYR A 87 O ASN A 244 ? O ASN A 228 # _atom_sites.entry_id 7US9 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -15 ? ? ? A . n A 1 2 GLY 2 -14 ? ? ? A . n A 1 3 ILE 3 -13 ? ? ? A . n A 1 4 LEU 4 -12 ? ? ? A . n A 1 5 PRO 5 -11 ? ? ? A . n A 1 6 SER 6 -10 ? ? ? A . n A 1 7 PRO 7 -9 ? ? ? A . n A 1 8 GLY 8 -8 ? ? ? A . n A 1 9 MET 9 -7 ? ? ? A . n A 1 10 PRO 10 -6 ? ? ? A . n A 1 11 ALA 11 -5 ? ? ? A . n A 1 12 LEU 12 -4 ? ? ? A . n A 1 13 LEU 13 -3 ? ? ? A . n A 1 14 SER 14 -2 ? ? ? A . n A 1 15 LEU 15 -1 ? ? ? A . n A 1 16 VAL 16 0 ? ? ? A . n A 1 17 SER 17 1 ? ? ? A . n A 1 18 LEU 18 2 ? ? ? A . n A 1 19 LEU 19 3 ? ? ? A . n A 1 20 SER 20 4 ? ? ? A . n A 1 21 VAL 21 5 ? ? ? A . n A 1 22 LEU 22 6 ? ? ? A . n A 1 23 LEU 23 7 ? ? ? A . n A 1 24 MET 24 8 ? ? ? A . n A 1 25 GLY 25 9 ? ? ? A . n A 1 26 CYS 26 10 ? ? ? A . n A 1 27 VAL 27 11 ? ? ? A . n A 1 28 ALA 28 12 ? ? ? A . n A 1 29 GLU 29 13 ? ? ? A . n A 1 30 THR 30 14 ? ? ? A . n A 1 31 GLY 31 15 ? ? ? A . n A 1 32 THR 32 16 ? ? ? A . n A 1 33 ASP 33 17 ? ? ? A . n A 1 34 ASN 34 18 ? ? ? A . n A 1 35 PHE 35 19 ? ? ? A . n A 1 36 PRO 36 20 ? ? ? A . n A 1 37 CYS 37 21 ? ? ? A . n A 1 38 SER 38 22 ? ? ? A . n A 1 39 LYS 39 23 ? ? ? A . n A 1 40 PHE 40 24 ? ? ? A . n A 1 41 LEU 41 25 ? ? ? A . n A 1 42 ASN 42 26 ? ? ? A . n A 1 43 ARG 43 27 ? ? ? A . n A 1 44 THR 44 28 ? ? ? A . n A 1 45 ILE 45 29 ? ? ? A . n A 1 46 GLY 46 30 ? ? ? A . n A 1 47 ASN 47 31 ? ? ? A . n A 1 48 HIS 48 32 32 HIS HIS A . n A 1 49 TRP 49 33 33 TRP TRP A . n A 1 50 ASN 50 34 34 ASN ASN A . n A 1 51 LEU 51 35 35 LEU LEU A . n A 1 52 ILE 52 36 36 ILE ILE A . n A 1 53 GLU 53 37 37 GLU GLU A . n A 1 54 ASN 54 38 38 ASN ASN A . n A 1 55 PHE 55 39 39 PHE PHE A . n A 1 56 LEU 56 40 40 LEU LEU A . n A 1 57 LEU 57 41 41 LEU LEU A . n A 1 58 ASN 58 42 42 ASN ASN A . n A 1 59 TYR 59 43 43 TYR TYR A . n A 1 60 SER 60 44 44 SER SER A . n A 1 61 ILE 61 45 45 ILE ILE A . n A 1 62 ARG 62 46 ? ? ? A . n A 1 63 LEU 63 47 47 LEU LEU A . n A 1 64 PRO 64 48 48 PRO PRO A . n A 1 65 PRO 65 49 49 PRO PRO A . n A 1 66 ASN 66 50 50 ASN ASN A . n A 1 67 SER 67 51 51 SER SER A . n A 1 68 ASP 68 52 52 ASP ASP A . n A 1 69 VAL 69 53 53 VAL VAL A . n A 1 70 VAL 70 54 54 VAL VAL A . n A 1 71 LEU 71 55 55 LEU LEU A . n A 1 72 GLY 72 56 56 GLY GLY A . n A 1 73 ASP 73 57 57 ASP ASP A . n A 1 74 TYR 74 58 58 TYR TYR A . n A 1 75 PHE 75 59 59 PHE PHE A . n A 1 76 PRO 76 60 60 PRO PRO A . n A 1 77 THR 77 61 61 THR THR A . n A 1 78 VAL 78 62 62 VAL VAL A . n A 1 79 GLN 79 63 63 GLN GLN A . n A 1 80 PRO 80 64 64 PRO PRO A . n A 1 81 TRP 81 65 65 TRP TRP A . n A 1 82 PHE 82 66 66 PHE PHE A . n A 1 83 ASN 83 67 67 ASN ASN A . n A 1 84 CYS 84 68 68 CYS CYS A . n A 1 85 ILE 85 69 ? ? ? A . n A 1 86 ARG 86 70 ? ? ? A . n A 1 87 ASN 87 71 ? ? ? A . n A 1 88 ASN 88 72 ? ? ? A . n A 1 89 ASN 89 73 ? ? ? A . n A 1 90 ASN 90 74 ? ? ? A . n A 1 91 SER 91 75 ? ? ? A . n A 1 92 LEU 92 76 76 LEU LEU A . n A 1 93 TYR 93 77 77 TYR TYR A . n A 1 94 VAL 94 78 78 VAL VAL A . n A 1 95 THR 95 79 79 THR THR A . n A 1 96 MET 96 80 80 MET MET A . n A 1 97 GLU 97 81 81 GLU GLU A . n A 1 98 ASN 98 82 82 ASN ASN A . n A 1 99 LEU 99 83 83 LEU LEU A . n A 1 100 LYS 100 84 84 LYS LYS A . n A 1 101 ALA 101 85 85 ALA ALA A . n A 1 102 LEU 102 86 86 LEU LEU A . n A 1 103 TYR 103 87 87 TYR TYR A . n A 1 104 TRP 104 88 88 TRP TRP A . n A 1 105 ASP 105 89 89 ASP ASP A . n A 1 106 TYR 106 90 ? ? ? A . n A 1 107 ALA 107 91 ? ? ? A . n A 1 108 THR 108 92 ? ? ? A . n A 1 109 GLU 109 93 ? ? ? A . n A 1 110 ASN 110 94 ? ? ? A . n A 1 111 ILE 111 95 ? ? ? A . n A 1 112 THR 112 96 ? ? ? A . n A 1 113 SER 113 97 ? ? ? A . n A 1 114 ASP 114 98 ? ? ? A . n A 1 115 HIS 115 99 ? ? ? A . n A 1 116 ARG 116 100 ? ? ? A . n A 1 117 GLN 117 101 ? ? ? A . n A 1 118 ARG 118 102 ? ? ? A . n A 1 119 LEU 119 103 ? ? ? A . n A 1 120 HIS 120 104 104 HIS HIS A . n A 1 121 VAL 121 105 105 VAL VAL A . n A 1 122 VAL 122 106 106 VAL VAL A . n A 1 123 VAL 123 107 107 VAL VAL A . n A 1 124 LYS 124 108 108 LYS LYS A . n A 1 125 GLY 125 109 109 GLY GLY A . n A 1 126 LYS 126 110 110 LYS LYS A . n A 1 127 PRO 127 111 111 PRO PRO A . n A 1 128 TYR 128 112 112 TYR TYR A . n A 1 129 SER 129 113 113 SER SER A . n A 1 130 ILE 130 114 114 ILE ILE A . n A 1 131 THR 131 115 115 THR THR A . n A 1 132 VAL 132 116 116 VAL VAL A . n A 1 133 THR 133 117 117 THR THR A . n A 1 134 THR 134 118 ? ? ? A . n A 1 135 THR 135 119 ? ? ? A . n A 1 136 ARG 136 120 ? ? ? A . n A 1 137 ASN 137 121 ? ? ? A . n A 1 138 PHE 138 122 ? ? ? A . n A 1 139 ASP 139 123 ? ? ? A . n A 1 140 ALA 140 124 ? ? ? A . n A 1 141 ALA 141 125 ? ? ? A . n A 1 142 GLU 142 126 ? ? ? A . n A 1 143 GLY 143 127 ? ? ? A . n A 1 144 ALA 144 128 128 ALA ALA A . n A 1 145 ILE 145 129 129 ILE ILE A . n A 1 146 ILE 146 130 130 ILE ILE A . n A 1 147 CYS 147 131 131 CYS CYS A . n A 1 148 ILE 148 132 132 ILE ILE A . n A 1 149 CYS 149 133 133 CYS CYS A . n A 1 150 LYS 150 134 134 LYS LYS A . n A 1 151 GLY 151 135 135 GLY GLY A . n A 1 152 SER 152 136 ? ? ? A . n A 1 153 PRO 153 137 ? ? ? A . n A 1 154 PRO 154 138 ? ? ? A . n A 1 155 THR 155 139 ? ? ? A . n A 1 156 THR 156 140 ? ? ? A . n A 1 157 THR 157 141 ? ? ? A . n A 1 158 THR 158 142 ? ? ? A . n A 1 159 GLY 159 143 ? ? ? A . n A 1 160 ASN 160 144 ? ? ? A . n A 1 161 LEU 161 145 ? ? ? A . n A 1 162 ASP 162 146 ? ? ? A . n A 1 163 CYS 163 147 ? ? ? A . n A 1 164 ASN 164 148 ? ? ? A . n A 1 165 TRP 165 149 ? ? ? A . n A 1 166 GLY 166 150 ? ? ? A . n A 1 167 SER 167 151 ? ? ? A . n A 1 168 ASP 168 152 152 ASP ASP A . n A 1 169 CYS 169 153 153 CYS CYS A . n A 1 170 ARG 170 154 154 ARG ARG A . n A 1 171 LEU 171 155 155 LEU LEU A . n A 1 172 ASN 172 156 156 ASN ASN A . n A 1 173 HIS 173 157 157 HIS HIS A . n A 1 174 LYS 174 158 158 LYS LYS A . n A 1 175 PHE 175 159 159 PHE PHE A . n A 1 176 PRO 176 160 160 PRO PRO A . n A 1 177 ILE 177 161 161 ILE ILE A . n A 1 178 CYS 178 162 ? ? ? A . n A 1 179 PRO 179 163 ? ? ? A . n A 1 180 SER 180 164 ? ? ? A . n A 1 181 ASN 181 165 ? ? ? A . n A 1 182 SER 182 166 ? ? ? A . n A 1 183 GLN 183 167 ? ? ? A . n A 1 184 ALA 184 168 ? ? ? A . n A 1 185 ASN 185 169 ? ? ? A . n A 1 186 CYS 186 170 ? ? ? A . n A 1 187 GLY 187 171 ? ? ? A . n A 1 188 ASN 188 172 172 ASN ASN A . n A 1 189 MET 189 173 173 MET MET A . n A 1 190 LEU 190 174 174 LEU LEU A . n A 1 191 TYR 191 175 175 TYR TYR A . n A 1 192 GLY 192 176 176 GLY GLY A . n A 1 193 LEU 193 177 177 LEU LEU A . n A 1 194 GLN 194 178 178 GLN GLN A . n A 1 195 TRP 195 179 179 TRP TRP A . n A 1 196 PHE 196 180 180 PHE PHE A . n A 1 197 THR 197 181 181 THR THR A . n A 1 198 ASP 198 182 182 ASP ASP A . n A 1 199 GLU 199 183 183 GLU GLU A . n A 1 200 VAL 200 184 184 VAL VAL A . n A 1 201 VAL 201 185 185 VAL VAL A . n A 1 202 ALA 202 186 186 ALA ALA A . n A 1 203 TYR 203 187 187 TYR TYR A . n A 1 204 LEU 204 188 188 LEU LEU A . n A 1 205 HIS 205 189 189 HIS HIS A . n A 1 206 GLY 206 190 190 GLY GLY A . n A 1 207 ALA 207 191 191 ALA ALA A . n A 1 208 ILE 208 192 192 ILE ILE A . n A 1 209 TYR 209 193 193 TYR TYR A . n A 1 210 ARG 210 194 194 ARG ARG A . n A 1 211 ILE 211 195 195 ILE ILE A . n A 1 212 SER 212 196 196 SER SER A . n A 1 213 PHE 213 197 197 PHE PHE A . n A 1 214 GLU 214 198 198 GLU GLU A . n A 1 215 ASN 215 199 199 ASN ASN A . n A 1 216 LYS 216 200 200 LYS LYS A . n A 1 217 TRP 217 201 201 TRP TRP A . n A 1 218 PHE 218 202 202 PHE PHE A . n A 1 219 GLY 219 203 203 GLY GLY A . n A 1 220 THR 220 204 204 THR THR A . n A 1 221 VAL 221 205 205 VAL VAL A . n A 1 222 THR 222 206 206 THR THR A . n A 1 223 LEU 223 207 207 LEU LEU A . n A 1 224 GLY 224 208 208 GLY GLY A . n A 1 225 ASP 225 209 ? ? ? A . n A 1 226 MET 226 210 ? ? ? A . n A 1 227 ARG 227 211 ? ? ? A . n A 1 228 ALA 228 212 ? ? ? A . n A 1 229 THR 229 213 ? ? ? A . n A 1 230 THR 230 214 ? ? ? A . n A 1 231 LEU 231 215 ? ? ? A . n A 1 232 GLN 232 216 ? ? ? A . n A 1 233 THR 233 217 ? ? ? A . n A 1 234 ALA 234 218 ? ? ? A . n A 1 235 GLY 235 219 ? ? ? A . n A 1 236 ALA 236 220 ? ? ? A . n A 1 237 LEU 237 221 ? ? ? A . n A 1 238 VAL 238 222 ? ? ? A . n A 1 239 ASP 239 223 ? ? ? A . n A 1 240 LEU 240 224 ? ? ? A . n A 1 241 TRP 241 225 225 TRP TRP A . n A 1 242 TRP 242 226 226 TRP TRP A . n A 1 243 PHE 243 227 227 PHE PHE A . n A 1 244 ASN 244 228 228 ASN ASN A . n A 1 245 PRO 245 229 229 PRO PRO A . n A 1 246 VAL 246 230 230 VAL VAL A . n A 1 247 TYR 247 231 231 TYR TYR A . n A 1 248 ASP 248 232 232 ASP ASP A . n A 1 249 VAL 249 233 233 VAL VAL A . n A 1 250 THR 250 234 234 THR THR A . n A 1 251 TYR 251 235 235 TYR TYR A . n A 1 252 TYR 252 236 236 TYR TYR A . n A 1 253 ARG 253 237 237 ARG ARG A . n A 1 254 VAL 254 238 238 VAL VAL A . n A 1 255 ASN 255 239 239 ASN ASN A . n A 1 256 ASN 256 240 240 ASN ASN A . n A 1 257 LYS 257 241 241 LYS LYS A . n A 1 258 ASN 258 242 242 ASN ASN A . n A 1 259 GLY 259 243 243 GLY GLY A . n A 1 260 THR 260 244 244 THR THR A . n A 1 261 THR 261 245 245 THR THR A . n A 1 262 ILE 262 246 246 ILE ILE A . n A 1 263 VAL 263 247 247 VAL VAL A . n A 1 264 SER 264 248 248 SER SER A . n A 1 265 ASN 265 249 249 ASN ASN A . n A 1 266 CYS 266 250 250 CYS CYS A . n A 1 267 THR 267 251 ? ? ? A . n # _pdbx_contact_author.id 3 _pdbx_contact_author.email dveesler@uw.edu _pdbx_contact_author.name_first David _pdbx_contact_author.name_last Veesler _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-6019-8675 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NIAID, National Institute of Allergy and Infectious Diseases' _pdbx_SG_project.full_name_of_center 'Seattle Structural Genomics Center for Infectious Disease' _pdbx_SG_project.initial_of_center SSGCID # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 NAG 1 301 2549 NAG NAG A . D 3 NAG 1 302 2602 NAG NAG A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2022-08-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_entry_details.entry_id 7US9 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N # _em_3d_fitting.entry_id 7US9 _em_3d_fitting.id 1 _em_3d_fitting.details ? _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_protocol ? _em_3d_fitting.ref_space ? _em_3d_fitting.target_criteria ? _em_3d_fitting.method ? # _em_3d_reconstruction.entry_id 7US9 _em_3d_reconstruction.id 1 _em_3d_reconstruction.algorithm ? _em_3d_reconstruction.details ? _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.num_particles 36141 _em_3d_reconstruction.resolution 3.8 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.symmetry_type POINT _em_3d_reconstruction.method ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.magnification_calibration ? # _em_buffer.id 1 _em_buffer.details ? _em_buffer.pH 8 _em_buffer.specimen_id 1 _em_buffer.name ? # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.details ? _em_entity_assembly.name CCoV-HuPn-2018 _em_entity_assembly.source RECOMBINANT _em_entity_assembly.type VIRUS _em_entity_assembly.entity_id_list 1 _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? # _em_imaging.id 1 _em_imaging.entry_id 7US9 _em_imaging.accelerating_voltage 300 _em_imaging.alignment_procedure ? _em_imaging.c2_aperture_diameter ? _em_imaging.calibrated_defocus_max ? _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_magnification ? _em_imaging.cryogen ? _em_imaging.details ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.illumination_mode 'FLOOD BEAM' _em_imaging.microscope_model 'FEI TITAN KRIOS' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs ? _em_imaging.nominal_defocus_max 1500 _em_imaging.nominal_defocus_min 800 _em_imaging.nominal_magnification ? _em_imaging.recording_temperature_maximum ? _em_imaging.recording_temperature_minimum ? _em_imaging.residual_tilt ? _em_imaging.specimen_holder_model ? _em_imaging.specimen_id 1 _em_imaging.citation_id ? _em_imaging.date ? _em_imaging.temperature ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.astigmatism ? _em_imaging.detector_distance ? _em_imaging.electron_beam_tilt_params ? _em_imaging.specimen_holder_type ? # _em_virus_entity.entity_assembly_id 1 _em_virus_entity.empty YES _em_virus_entity.enveloped YES _em_virus_entity.virus_isolate OTHER _em_virus_entity.virus_type VIRION _em_virus_entity.id 1 _em_virus_entity.virus_host_category ? _em_virus_entity.details ? # _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.chamber_temperature ? _em_vitrification.cryogen_name ETHANE _em_vitrification.details ? _em_vitrification.humidity ? _em_vitrification.instrument ? _em_vitrification.entry_id 7US9 _em_vitrification.citation_id ? _em_vitrification.method ? _em_vitrification.temp ? _em_vitrification.time_resolved_state ? # _em_experiment.entry_id 7US9 _em_experiment.id 1 _em_experiment.aggregation_state PARTICLE _em_experiment.reconstruction_method 'SINGLE PARTICLE' _em_experiment.entity_assembly_id 1 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CD _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 PRO _pdbx_validate_rmsd_bond.auth_seq_id_1 111 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 N _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 PRO _pdbx_validate_rmsd_bond.auth_seq_id_2 111 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.381 _pdbx_validate_rmsd_bond.bond_target_value 1.474 _pdbx_validate_rmsd_bond.bond_deviation -0.093 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.014 _pdbx_validate_rmsd_bond.linker_flag N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id PHE _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 197 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -179.55 _pdbx_validate_torsion.psi 134.88 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASN 34 ? CG ? A ASN 50 CG 2 1 Y 1 A ASN 34 ? OD1 ? A ASN 50 OD1 3 1 Y 1 A ASN 34 ? ND2 ? A ASN 50 ND2 4 1 Y 1 A LEU 35 ? CG ? A LEU 51 CG 5 1 Y 1 A LEU 35 ? CD1 ? A LEU 51 CD1 6 1 Y 1 A LEU 35 ? CD2 ? A LEU 51 CD2 7 1 Y 1 A LEU 41 ? CG ? A LEU 57 CG 8 1 Y 1 A LEU 41 ? CD1 ? A LEU 57 CD1 9 1 Y 1 A LEU 41 ? CD2 ? A LEU 57 CD2 10 1 Y 1 A SER 44 ? OG ? A SER 60 OG 11 1 Y 1 A ILE 45 ? CG1 ? A ILE 61 CG1 12 1 Y 1 A ILE 45 ? CG2 ? A ILE 61 CG2 13 1 Y 1 A ILE 45 ? CD1 ? A ILE 61 CD1 14 1 Y 1 A LEU 47 ? CG ? A LEU 63 CG 15 1 Y 1 A LEU 47 ? CD1 ? A LEU 63 CD1 16 1 Y 1 A LEU 47 ? CD2 ? A LEU 63 CD2 17 1 Y 1 A SER 51 ? OG ? A SER 67 OG 18 1 Y 1 A ASP 52 ? CG ? A ASP 68 CG 19 1 Y 1 A ASP 52 ? OD1 ? A ASP 68 OD1 20 1 Y 1 A ASP 52 ? OD2 ? A ASP 68 OD2 21 1 Y 1 A VAL 53 ? CG1 ? A VAL 69 CG1 22 1 Y 1 A VAL 53 ? CG2 ? A VAL 69 CG2 23 1 Y 1 A THR 61 ? OG1 ? A THR 77 OG1 24 1 Y 1 A THR 61 ? CG2 ? A THR 77 CG2 25 1 Y 1 A GLN 63 ? CG ? A GLN 79 CG 26 1 Y 1 A GLN 63 ? CD ? A GLN 79 CD 27 1 Y 1 A GLN 63 ? OE1 ? A GLN 79 OE1 28 1 Y 1 A GLN 63 ? NE2 ? A GLN 79 NE2 29 1 Y 1 A ASN 67 ? CG ? A ASN 83 CG 30 1 Y 1 A ASN 67 ? OD1 ? A ASN 83 OD1 31 1 Y 1 A ASN 67 ? ND2 ? A ASN 83 ND2 32 1 Y 1 A CYS 68 ? SG ? A CYS 84 SG 33 1 Y 1 A VAL 78 ? CG1 ? A VAL 94 CG1 34 1 Y 1 A VAL 78 ? CG2 ? A VAL 94 CG2 35 1 Y 1 A GLU 81 ? CG ? A GLU 97 CG 36 1 Y 1 A GLU 81 ? CD ? A GLU 97 CD 37 1 Y 1 A GLU 81 ? OE1 ? A GLU 97 OE1 38 1 Y 1 A GLU 81 ? OE2 ? A GLU 97 OE2 39 1 Y 1 A ASN 82 ? CG ? A ASN 98 CG 40 1 Y 1 A ASN 82 ? OD1 ? A ASN 98 OD1 41 1 Y 1 A ASN 82 ? ND2 ? A ASN 98 ND2 42 1 Y 1 A LYS 84 ? CG ? A LYS 100 CG 43 1 Y 1 A LYS 84 ? CD ? A LYS 100 CD 44 1 Y 1 A LYS 84 ? CE ? A LYS 100 CE 45 1 Y 1 A LYS 84 ? NZ ? A LYS 100 NZ 46 1 Y 1 A HIS 104 ? CG ? A HIS 120 CG 47 1 Y 1 A HIS 104 ? ND1 ? A HIS 120 ND1 48 1 Y 1 A HIS 104 ? CD2 ? A HIS 120 CD2 49 1 Y 1 A HIS 104 ? CE1 ? A HIS 120 CE1 50 1 Y 1 A HIS 104 ? NE2 ? A HIS 120 NE2 51 1 Y 1 A SER 113 ? OG ? A SER 129 OG 52 1 Y 1 A THR 115 ? OG1 ? A THR 131 OG1 53 1 Y 1 A THR 115 ? CG2 ? A THR 131 CG2 54 1 Y 1 A THR 117 ? OG1 ? A THR 133 OG1 55 1 Y 1 A THR 117 ? CG2 ? A THR 133 CG2 56 1 Y 1 A ILE 129 ? CG1 ? A ILE 145 CG1 57 1 Y 1 A ILE 129 ? CG2 ? A ILE 145 CG2 58 1 Y 1 A ILE 129 ? CD1 ? A ILE 145 CD1 59 1 Y 1 A ILE 130 ? CG1 ? A ILE 146 CG1 60 1 Y 1 A ILE 130 ? CG2 ? A ILE 146 CG2 61 1 Y 1 A ILE 130 ? CD1 ? A ILE 146 CD1 62 1 Y 1 A CYS 131 ? SG ? A CYS 147 SG 63 1 Y 1 A ILE 132 ? CG1 ? A ILE 148 CG1 64 1 Y 1 A ILE 132 ? CG2 ? A ILE 148 CG2 65 1 Y 1 A ILE 132 ? CD1 ? A ILE 148 CD1 66 1 Y 1 A LYS 134 ? CG ? A LYS 150 CG 67 1 Y 1 A LYS 134 ? CD ? A LYS 150 CD 68 1 Y 1 A LYS 134 ? CE ? A LYS 150 CE 69 1 Y 1 A LYS 134 ? NZ ? A LYS 150 NZ 70 1 Y 1 A ASP 152 ? CG ? A ASP 168 CG 71 1 Y 1 A ASP 152 ? OD1 ? A ASP 168 OD1 72 1 Y 1 A ASP 152 ? OD2 ? A ASP 168 OD2 73 1 Y 1 A LEU 155 ? CG ? A LEU 171 CG 74 1 Y 1 A LEU 155 ? CD1 ? A LEU 171 CD1 75 1 Y 1 A LEU 155 ? CD2 ? A LEU 171 CD2 76 1 Y 1 A LYS 158 ? CG ? A LYS 174 CG 77 1 Y 1 A LYS 158 ? CD ? A LYS 174 CD 78 1 Y 1 A LYS 158 ? CE ? A LYS 174 CE 79 1 Y 1 A LYS 158 ? NZ ? A LYS 174 NZ 80 1 Y 1 A ILE 161 ? CG1 ? A ILE 177 CG1 81 1 Y 1 A ILE 161 ? CG2 ? A ILE 177 CG2 82 1 Y 1 A ILE 161 ? CD1 ? A ILE 177 CD1 83 1 Y 1 A ASN 172 ? CG ? A ASN 188 CG 84 1 Y 1 A ASN 172 ? OD1 ? A ASN 188 OD1 85 1 Y 1 A ASN 172 ? ND2 ? A ASN 188 ND2 86 1 Y 1 A THR 181 ? OG1 ? A THR 197 OG1 87 1 Y 1 A THR 181 ? CG2 ? A THR 197 CG2 88 1 Y 1 A ASP 182 ? CG ? A ASP 198 CG 89 1 Y 1 A ASP 182 ? OD1 ? A ASP 198 OD1 90 1 Y 1 A ASP 182 ? OD2 ? A ASP 198 OD2 91 1 Y 1 A GLU 183 ? CG ? A GLU 199 CG 92 1 Y 1 A GLU 183 ? CD ? A GLU 199 CD 93 1 Y 1 A GLU 183 ? OE1 ? A GLU 199 OE1 94 1 Y 1 A GLU 183 ? OE2 ? A GLU 199 OE2 95 1 Y 1 A VAL 184 ? CG1 ? A VAL 200 CG1 96 1 Y 1 A VAL 184 ? CG2 ? A VAL 200 CG2 97 1 Y 1 A VAL 185 ? CG1 ? A VAL 201 CG1 98 1 Y 1 A VAL 185 ? CG2 ? A VAL 201 CG2 99 1 Y 1 A ILE 192 ? CG1 ? A ILE 208 CG1 100 1 Y 1 A ILE 192 ? CG2 ? A ILE 208 CG2 101 1 Y 1 A ILE 192 ? CD1 ? A ILE 208 CD1 102 1 Y 1 A SER 196 ? OG ? A SER 212 OG 103 1 Y 1 A GLU 198 ? CG ? A GLU 214 CG 104 1 Y 1 A GLU 198 ? CD ? A GLU 214 CD 105 1 Y 1 A GLU 198 ? OE1 ? A GLU 214 OE1 106 1 Y 1 A GLU 198 ? OE2 ? A GLU 214 OE2 107 1 Y 1 A THR 204 ? OG1 ? A THR 220 OG1 108 1 Y 1 A THR 204 ? CG2 ? A THR 220 CG2 109 1 Y 1 A VAL 205 ? CG1 ? A VAL 221 CG1 110 1 Y 1 A VAL 205 ? CG2 ? A VAL 221 CG2 111 1 Y 1 A THR 206 ? OG1 ? A THR 222 OG1 112 1 Y 1 A THR 206 ? CG2 ? A THR 222 CG2 113 1 Y 1 A LEU 207 ? CG ? A LEU 223 CG 114 1 Y 1 A LEU 207 ? CD1 ? A LEU 223 CD1 115 1 Y 1 A LEU 207 ? CD2 ? A LEU 223 CD2 116 1 Y 1 A ASN 228 ? CG ? A ASN 244 CG 117 1 Y 1 A ASN 228 ? OD1 ? A ASN 244 OD1 118 1 Y 1 A ASN 228 ? ND2 ? A ASN 244 ND2 119 1 Y 1 A VAL 230 ? CG1 ? A VAL 246 CG1 120 1 Y 1 A VAL 230 ? CG2 ? A VAL 246 CG2 121 1 Y 1 A ASP 232 ? CG ? A ASP 248 CG 122 1 Y 1 A ASP 232 ? OD1 ? A ASP 248 OD1 123 1 Y 1 A ASP 232 ? OD2 ? A ASP 248 OD2 124 1 Y 1 A VAL 233 ? CG1 ? A VAL 249 CG1 125 1 Y 1 A VAL 233 ? CG2 ? A VAL 249 CG2 126 1 Y 1 A THR 234 ? OG1 ? A THR 250 OG1 127 1 Y 1 A THR 234 ? CG2 ? A THR 250 CG2 128 1 Y 1 A VAL 238 ? CG1 ? A VAL 254 CG1 129 1 Y 1 A VAL 238 ? CG2 ? A VAL 254 CG2 130 1 Y 1 A THR 244 ? OG1 ? A THR 260 OG1 131 1 Y 1 A THR 244 ? CG2 ? A THR 260 CG2 132 1 Y 1 A SER 248 ? OG ? A SER 264 OG 133 1 Y 1 A CYS 250 ? SG ? A CYS 266 SG # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -15 ? A MET 1 2 1 Y 1 A GLY -14 ? A GLY 2 3 1 Y 1 A ILE -13 ? A ILE 3 4 1 Y 1 A LEU -12 ? A LEU 4 5 1 Y 1 A PRO -11 ? A PRO 5 6 1 Y 1 A SER -10 ? A SER 6 7 1 Y 1 A PRO -9 ? A PRO 7 8 1 Y 1 A GLY -8 ? A GLY 8 9 1 Y 1 A MET -7 ? A MET 9 10 1 Y 1 A PRO -6 ? A PRO 10 11 1 Y 1 A ALA -5 ? A ALA 11 12 1 Y 1 A LEU -4 ? A LEU 12 13 1 Y 1 A LEU -3 ? A LEU 13 14 1 Y 1 A SER -2 ? A SER 14 15 1 Y 1 A LEU -1 ? A LEU 15 16 1 Y 1 A VAL 0 ? A VAL 16 17 1 Y 1 A SER 1 ? A SER 17 18 1 Y 1 A LEU 2 ? A LEU 18 19 1 Y 1 A LEU 3 ? A LEU 19 20 1 Y 1 A SER 4 ? A SER 20 21 1 Y 1 A VAL 5 ? A VAL 21 22 1 Y 1 A LEU 6 ? A LEU 22 23 1 Y 1 A LEU 7 ? A LEU 23 24 1 Y 1 A MET 8 ? A MET 24 25 1 Y 1 A GLY 9 ? A GLY 25 26 1 Y 1 A CYS 10 ? A CYS 26 27 1 Y 1 A VAL 11 ? A VAL 27 28 1 Y 1 A ALA 12 ? A ALA 28 29 1 Y 1 A GLU 13 ? A GLU 29 30 1 Y 1 A THR 14 ? A THR 30 31 1 Y 1 A GLY 15 ? A GLY 31 32 1 Y 1 A THR 16 ? A THR 32 33 1 Y 1 A ASP 17 ? A ASP 33 34 1 Y 1 A ASN 18 ? A ASN 34 35 1 Y 1 A PHE 19 ? A PHE 35 36 1 Y 1 A PRO 20 ? A PRO 36 37 1 Y 1 A CYS 21 ? A CYS 37 38 1 Y 1 A SER 22 ? A SER 38 39 1 Y 1 A LYS 23 ? A LYS 39 40 1 Y 1 A PHE 24 ? A PHE 40 41 1 Y 1 A LEU 25 ? A LEU 41 42 1 Y 1 A ASN 26 ? A ASN 42 43 1 Y 1 A ARG 27 ? A ARG 43 44 1 Y 1 A THR 28 ? A THR 44 45 1 Y 1 A ILE 29 ? A ILE 45 46 1 Y 1 A GLY 30 ? A GLY 46 47 1 Y 1 A ASN 31 ? A ASN 47 48 1 Y 1 A ARG 46 ? A ARG 62 49 1 Y 1 A ILE 69 ? A ILE 85 50 1 Y 1 A ARG 70 ? A ARG 86 51 1 Y 1 A ASN 71 ? A ASN 87 52 1 Y 1 A ASN 72 ? A ASN 88 53 1 Y 1 A ASN 73 ? A ASN 89 54 1 Y 1 A ASN 74 ? A ASN 90 55 1 Y 1 A SER 75 ? A SER 91 56 1 Y 1 A TYR 90 ? A TYR 106 57 1 Y 1 A ALA 91 ? A ALA 107 58 1 Y 1 A THR 92 ? A THR 108 59 1 Y 1 A GLU 93 ? A GLU 109 60 1 Y 1 A ASN 94 ? A ASN 110 61 1 Y 1 A ILE 95 ? A ILE 111 62 1 Y 1 A THR 96 ? A THR 112 63 1 Y 1 A SER 97 ? A SER 113 64 1 Y 1 A ASP 98 ? A ASP 114 65 1 Y 1 A HIS 99 ? A HIS 115 66 1 Y 1 A ARG 100 ? A ARG 116 67 1 Y 1 A GLN 101 ? A GLN 117 68 1 Y 1 A ARG 102 ? A ARG 118 69 1 Y 1 A LEU 103 ? A LEU 119 70 1 Y 1 A THR 118 ? A THR 134 71 1 Y 1 A THR 119 ? A THR 135 72 1 Y 1 A ARG 120 ? A ARG 136 73 1 Y 1 A ASN 121 ? A ASN 137 74 1 Y 1 A PHE 122 ? A PHE 138 75 1 Y 1 A ASP 123 ? A ASP 139 76 1 Y 1 A ALA 124 ? A ALA 140 77 1 Y 1 A ALA 125 ? A ALA 141 78 1 Y 1 A GLU 126 ? A GLU 142 79 1 Y 1 A GLY 127 ? A GLY 143 80 1 Y 1 A SER 136 ? A SER 152 81 1 Y 1 A PRO 137 ? A PRO 153 82 1 Y 1 A PRO 138 ? A PRO 154 83 1 Y 1 A THR 139 ? A THR 155 84 1 Y 1 A THR 140 ? A THR 156 85 1 Y 1 A THR 141 ? A THR 157 86 1 Y 1 A THR 142 ? A THR 158 87 1 Y 1 A GLY 143 ? A GLY 159 88 1 Y 1 A ASN 144 ? A ASN 160 89 1 Y 1 A LEU 145 ? A LEU 161 90 1 Y 1 A ASP 146 ? A ASP 162 91 1 Y 1 A CYS 147 ? A CYS 163 92 1 Y 1 A ASN 148 ? A ASN 164 93 1 Y 1 A TRP 149 ? A TRP 165 94 1 Y 1 A GLY 150 ? A GLY 166 95 1 Y 1 A SER 151 ? A SER 167 96 1 Y 1 A CYS 162 ? A CYS 178 97 1 Y 1 A PRO 163 ? A PRO 179 98 1 Y 1 A SER 164 ? A SER 180 99 1 Y 1 A ASN 165 ? A ASN 181 100 1 Y 1 A SER 166 ? A SER 182 101 1 Y 1 A GLN 167 ? A GLN 183 102 1 Y 1 A ALA 168 ? A ALA 184 103 1 Y 1 A ASN 169 ? A ASN 185 104 1 Y 1 A CYS 170 ? A CYS 186 105 1 Y 1 A GLY 171 ? A GLY 187 106 1 Y 1 A ASP 209 ? A ASP 225 107 1 Y 1 A MET 210 ? A MET 226 108 1 Y 1 A ARG 211 ? A ARG 227 109 1 Y 1 A ALA 212 ? A ALA 228 110 1 Y 1 A THR 213 ? A THR 229 111 1 Y 1 A THR 214 ? A THR 230 112 1 Y 1 A LEU 215 ? A LEU 231 113 1 Y 1 A GLN 216 ? A GLN 232 114 1 Y 1 A THR 217 ? A THR 233 115 1 Y 1 A ALA 218 ? A ALA 234 116 1 Y 1 A GLY 219 ? A GLY 235 117 1 Y 1 A ALA 220 ? A ALA 236 118 1 Y 1 A LEU 221 ? A LEU 237 119 1 Y 1 A VAL 222 ? A VAL 238 120 1 Y 1 A ASP 223 ? A ASP 239 121 1 Y 1 A LEU 224 ? A LEU 240 122 1 Y 1 A THR 251 ? A THR 267 # _em_ctf_correction.id 1 _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.type 'PHASE FLIPPING AND AMPLITUDE CORRECTION' _em_ctf_correction.details ? # _em_embedding.id 1 _em_embedding.details ? _em_embedding.specimen_id 1 _em_embedding.material 'Tris buffer saline' # _em_entity_assembly_naturalsource.id 2 _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.ncbi_tax_id 2697049 _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organism CCoV-HuPn-2018 _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? # _em_entity_assembly_recombinant.id 2 _em_entity_assembly_recombinant.entity_assembly_id 1 _em_entity_assembly_recombinant.cell ? _em_entity_assembly_recombinant.ncbi_tax_id 1092587 _em_entity_assembly_recombinant.organism 'mammal environmental sample' _em_entity_assembly_recombinant.plasmid ? _em_entity_assembly_recombinant.strain ? # _em_image_processing.id 1 _em_image_processing.image_recording_id 1 _em_image_processing.details ? # _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.avg_electron_dose_per_image 80 _em_image_recording.average_exposure_time ? _em_image_recording.details ? _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model 'GATAN K3 (6k x 4k)' _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? _em_image_recording.avg_electron_dose_per_subtomogram ? # loop_ _em_software.id _em_software.category _em_software.details _em_software.name _em_software.version _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id 1 'CRYSTALLOGRAPHY MERGING' ? ? ? 1 1 1 2 'IMAGE ACQUISITION' ? ? ? ? ? 1 3 MASKING ? ? ? ? ? ? 4 'CTF CORRECTION' ? ? ? 1 ? ? 5 'LAYERLINE INDEXING' ? ? ? ? ? ? 6 'DIFFRACTION INDEXING' ? ? ? ? ? ? 7 'MODEL FITTING' ? ? ? ? ? ? 8 'MODEL REFINEMENT' ? ? ? ? ? ? 9 OTHER ? ? ? ? ? ? 10 'INITIAL EULER ASSIGNMENT' ? ? ? 1 ? ? 11 'FINAL EULER ASSIGNMENT' ? ? ? 1 ? ? 12 CLASSIFICATION ? ? ? 1 ? ? 13 RECONSTRUCTION ? ? ? 1 ? ? # _em_specimen.id 1 _em_specimen.experiment_id 1 _em_specimen.concentration ? _em_specimen.details ? _em_specimen.embedding_applied YES _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # _em_virus_natural_host.id 1 _em_virus_natural_host.entity_assembly_id 1 _em_virus_natural_host.ncbi_tax_id 9606 _em_virus_natural_host.organism 'Homo sapiens' _em_virus_natural_host.strain ? # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 NAG 1 B NAG 1 A NAG 2550 n B 2 NAG 2 B NAG 2 A NAG 2551 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 DGlcpNAcb1-4DGlcpNAcb1-ROH 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1' WURCS PDB2Glycan 1.1.0 3 2 '[][D-1-deoxy-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}' LINUCS PDB-CARE ? # _pdbx_entity_branch_link.link_id 1 _pdbx_entity_branch_link.entity_id 2 _pdbx_entity_branch_link.entity_branch_list_num_1 2 _pdbx_entity_branch_link.comp_id_1 NAG _pdbx_entity_branch_link.atom_id_1 C1 _pdbx_entity_branch_link.leaving_atom_id_1 O1 _pdbx_entity_branch_link.entity_branch_list_num_2 1 _pdbx_entity_branch_link.comp_id_2 NAG _pdbx_entity_branch_link.atom_id_2 O4 _pdbx_entity_branch_link.leaving_atom_id_2 HO4 _pdbx_entity_branch_link.value_order sing _pdbx_entity_branch_link.details ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 NAG 1 n 2 NAG 2 n # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name 2-acetamido-2-deoxy-beta-D-glucopyranose _pdbx_entity_nonpoly.comp_id NAG # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #