data_7USG # _entry.id 7USG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7USG pdb_00007usg 10.2210/pdb7usg/pdb WWPDB D_1000264804 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7USG _pdbx_database_status.recvd_initial_deposition_date 2022-04-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jayasinghe, T.D.' 1 0000-0003-3436-0795 'Ronning, D.R.' 2 0000-0003-2583-8849 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J Control Release' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1873-4995 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 354 _citation.language ? _citation.page_first 80 _citation.page_last 90 _citation.title 'Targeting BRD4 and PI3K signaling pathways for the treatment of medulloblastoma.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jconrel.2022.12.055 _citation.pdbx_database_id_PubMed 36599397 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sethi, B.' 1 ? primary 'Kumar, V.' 2 ? primary 'Jayasinghe, T.D.' 3 ? primary 'Dong, Y.' 4 ? primary 'Ronning, D.R.' 5 ? primary 'Zhong, H.A.' 6 ? primary 'Coulter, D.W.' 7 ? primary 'Mahato, R.I.' 8 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7USG _cell.details ? _cell.formula_units_Z ? _cell.length_a 52.560 _cell.length_a_esd ? _cell.length_b 72.277 _cell.length_b_esd ? _cell.length_c 32.213 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 7USG _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bromodomain-containing protein 2' 13056.032 1 ? ? BD2 ? 2 non-polymer syn '(8M)-8-(2,3-dihydro-1,4-benzodioxin-6-yl)-2-(morpholin-4-yl)-4H-1-benzopyran-4-one' 365.379 1 ? ? ? ? 3 non-polymer syn 1,2-ETHANEDIOL 62.068 2 ? ? ? ? 4 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 5 water nat water 18.015 247 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'O27.1.1,Really interesting new gene 3 protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPMEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSN CYKYNPPDHDVVAMARKLQDVFEFRYAKMPD ; _entity_poly.pdbx_seq_one_letter_code_can ;GPMEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSN CYKYNPPDHDVVAMARKLQDVFEFRYAKMPD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 MET n 1 4 GLU n 1 5 GLN n 1 6 LEU n 1 7 LYS n 1 8 HIS n 1 9 CYS n 1 10 ASN n 1 11 GLY n 1 12 ILE n 1 13 LEU n 1 14 LYS n 1 15 GLU n 1 16 LEU n 1 17 LEU n 1 18 SER n 1 19 LYS n 1 20 LYS n 1 21 HIS n 1 22 ALA n 1 23 ALA n 1 24 TYR n 1 25 ALA n 1 26 TRP n 1 27 PRO n 1 28 PHE n 1 29 TYR n 1 30 LYS n 1 31 PRO n 1 32 VAL n 1 33 ASP n 1 34 ALA n 1 35 SER n 1 36 ALA n 1 37 LEU n 1 38 GLY n 1 39 LEU n 1 40 HIS n 1 41 ASP n 1 42 TYR n 1 43 HIS n 1 44 ASP n 1 45 ILE n 1 46 ILE n 1 47 LYS n 1 48 HIS n 1 49 PRO n 1 50 MET n 1 51 ASP n 1 52 LEU n 1 53 SER n 1 54 THR n 1 55 VAL n 1 56 LYS n 1 57 ARG n 1 58 LYS n 1 59 MET n 1 60 GLU n 1 61 ASN n 1 62 ARG n 1 63 ASP n 1 64 TYR n 1 65 ARG n 1 66 ASP n 1 67 ALA n 1 68 GLN n 1 69 GLU n 1 70 PHE n 1 71 ALA n 1 72 ALA n 1 73 ASP n 1 74 VAL n 1 75 ARG n 1 76 LEU n 1 77 MET n 1 78 PHE n 1 79 SER n 1 80 ASN n 1 81 CYS n 1 82 TYR n 1 83 LYS n 1 84 TYR n 1 85 ASN n 1 86 PRO n 1 87 PRO n 1 88 ASP n 1 89 HIS n 1 90 ASP n 1 91 VAL n 1 92 VAL n 1 93 ALA n 1 94 MET n 1 95 ALA n 1 96 ARG n 1 97 LYS n 1 98 LEU n 1 99 GLN n 1 100 ASP n 1 101 VAL n 1 102 PHE n 1 103 GLU n 1 104 PHE n 1 105 ARG n 1 106 TYR n 1 107 ALA n 1 108 LYS n 1 109 MET n 1 110 PRO n 1 111 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 111 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BRD2, KIAA9001, RING3' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BRD2_HUMAN _struct_ref.pdbx_db_accession P25440 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYK YNPPDHDVVAMARKLQDVFEFRYAKMPD ; _struct_ref.pdbx_align_begin 348 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7USG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 111 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P25440 _struct_ref_seq.db_align_beg 348 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 455 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 348 _struct_ref_seq.pdbx_auth_seq_align_end 455 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7USG GLY A 1 ? UNP P25440 ? ? 'expression tag' 345 1 1 7USG PRO A 2 ? UNP P25440 ? ? 'expression tag' 346 2 1 7USG MET A 3 ? UNP P25440 ? ? 'expression tag' 347 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 O6O non-polymer . '(8M)-8-(2,3-dihydro-1,4-benzodioxin-6-yl)-2-(morpholin-4-yl)-4H-1-benzopyran-4-one' ? 'C21 H19 N O5' 365.379 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7USG _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.34 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.51 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Bis-Tris pH 6.5, 16 % W/V PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-07-17 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9787 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-F' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9787 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-F _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 11.180 _reflns.entry_id 7USG _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.2 _reflns.d_resolution_low 19.6 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 35996 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 91.85 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.7 _reflns.pdbx_Rmerge_I_obs 0.106 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 28.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.039 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.991 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 1.2 _reflns_shell.d_res_low 1.243 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 3501 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.762 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 53.930 _refine.B_iso_mean 15.0309 _refine.B_iso_min 6.680 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7USG _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.2000 _refine.ls_d_res_low 19.6000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 35996 _refine.ls_number_reflns_R_free 2000 _refine.ls_number_reflns_R_work 33996 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 91.8700 _refine.ls_percent_reflns_R_free 5.5600 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1783 _refine.ls_R_factor_R_free 0.1973 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1772 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6E6J _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 19.7500 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1100 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.2000 _refine_hist.d_res_low 19.6000 _refine_hist.number_atoms_solvent 247 _refine_hist.number_atoms_total 1198 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 111 _refine_hist.pdbx_B_iso_mean_ligand 16.79 _refine_hist.pdbx_B_iso_mean_solvent 23.43 _refine_hist.pdbx_number_atoms_protein 915 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 36 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.2000 1.2300 2471 . 137 2334 90.0000 . . . 0.2681 0.0000 0.2508 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.2300 1.2600 2494 . 139 2355 91.0000 . . . 0.2596 0.0000 0.2412 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.2600 1.3000 2509 . 139 2370 90.0000 . . . 0.2597 0.0000 0.2282 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.3000 1.3400 2527 . 141 2386 91.0000 . . . 0.2367 0.0000 0.2182 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.3400 1.3900 2492 . 139 2353 91.0000 . . . 0.2407 0.0000 0.2100 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.3900 1.4500 2511 . 139 2372 91.0000 . . . 0.2186 0.0000 0.1992 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.4500 1.5100 2544 . 141 2403 91.0000 . . . 0.2123 0.0000 0.1872 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.5100 1.5900 2559 . 142 2417 93.0000 . . . 0.1861 0.0000 0.1754 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.5900 1.6900 2628 . 146 2482 94.0000 . . . 0.1902 0.0000 0.1671 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.6900 1.8200 2646 . 147 2499 95.0000 . . . 0.1998 0.0000 0.1793 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 1.8200 2.0000 2656 . 147 2509 94.0000 . . . 0.2025 0.0000 0.1789 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.0000 2.2900 2644 . 148 2496 93.0000 . . . 0.1801 0.0000 0.1664 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.2900 2.8900 2659 . 147 2512 93.0000 . . . 0.1984 0.0000 0.1739 . . . . . . . 14 . . . 'X-RAY DIFFRACTION' 2.8900 19.6000 2656 . 148 2508 89.0000 . . . 0.1749 0.0000 0.1565 . . . . . . . 14 . . . # _struct.entry_id 7USG _struct.title 'BRD2-BD2 in complex with MDP5' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7USG _struct_keywords.text 'Inhibitor, acetyllysine binding pocket, TRANSCRIPTION, TRANSCRIPTION-INHIBITOR complex' _struct_keywords.pdbx_keywords TRANSCRIPTION/INHIBITOR # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 1 ? LEU A 17 ? GLY A 345 LEU A 361 1 ? 17 HELX_P HELX_P2 AA2 SER A 18 ? LYS A 20 ? SER A 362 LYS A 364 5 ? 3 HELX_P HELX_P3 AA3 HIS A 21 ? TRP A 26 ? HIS A 365 TRP A 370 1 ? 6 HELX_P HELX_P4 AA4 PRO A 27 ? TYR A 29 ? PRO A 371 TYR A 373 5 ? 3 HELX_P HELX_P5 AA5 ASP A 41 ? ILE A 46 ? ASP A 385 ILE A 390 1 ? 6 HELX_P HELX_P6 AA6 ASP A 51 ? ASN A 61 ? ASP A 395 ASN A 405 1 ? 11 HELX_P HELX_P7 AA7 ASP A 66 ? ASN A 85 ? ASP A 410 ASN A 429 1 ? 20 HELX_P HELX_P8 AA8 HIS A 89 ? ALA A 107 ? HIS A 433 ALA A 451 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? E NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 504 A HOH 681 1_555 ? ? ? ? ? ? ? 3.032 ? ? metalc2 metalc ? ? E NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 504 A HOH 681 2_555 ? ? ? ? ? ? ? 3.032 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 7USG _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.019026 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013836 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.031043 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N NA O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 345 345 GLY GLY A . n A 1 2 PRO 2 346 346 PRO PRO A . n A 1 3 MET 3 347 347 MET MET A . n A 1 4 GLU 4 348 348 GLU GLU A . n A 1 5 GLN 5 349 349 GLN GLN A . n A 1 6 LEU 6 350 350 LEU LEU A . n A 1 7 LYS 7 351 351 LYS LYS A . n A 1 8 HIS 8 352 352 HIS HIS A . n A 1 9 CYS 9 353 353 CYS CYS A . n A 1 10 ASN 10 354 354 ASN ASN A . n A 1 11 GLY 11 355 355 GLY GLY A . n A 1 12 ILE 12 356 356 ILE ILE A . n A 1 13 LEU 13 357 357 LEU LEU A . n A 1 14 LYS 14 358 358 LYS LYS A . n A 1 15 GLU 15 359 359 GLU GLU A . n A 1 16 LEU 16 360 360 LEU LEU A . n A 1 17 LEU 17 361 361 LEU LEU A . n A 1 18 SER 18 362 362 SER SER A . n A 1 19 LYS 19 363 363 LYS LYS A . n A 1 20 LYS 20 364 364 LYS LYS A . n A 1 21 HIS 21 365 365 HIS HIS A . n A 1 22 ALA 22 366 366 ALA ALA A . n A 1 23 ALA 23 367 367 ALA ALA A . n A 1 24 TYR 24 368 368 TYR TYR A . n A 1 25 ALA 25 369 369 ALA ALA A . n A 1 26 TRP 26 370 370 TRP TRP A . n A 1 27 PRO 27 371 371 PRO PRO A . n A 1 28 PHE 28 372 372 PHE PHE A . n A 1 29 TYR 29 373 373 TYR TYR A . n A 1 30 LYS 30 374 374 LYS LYS A . n A 1 31 PRO 31 375 375 PRO PRO A . n A 1 32 VAL 32 376 376 VAL VAL A . n A 1 33 ASP 33 377 377 ASP ASP A . n A 1 34 ALA 34 378 378 ALA ALA A . n A 1 35 SER 35 379 379 SER SER A . n A 1 36 ALA 36 380 380 ALA ALA A . n A 1 37 LEU 37 381 381 LEU LEU A . n A 1 38 GLY 38 382 382 GLY GLY A . n A 1 39 LEU 39 383 383 LEU LEU A . n A 1 40 HIS 40 384 384 HIS HIS A . n A 1 41 ASP 41 385 385 ASP ASP A . n A 1 42 TYR 42 386 386 TYR TYR A . n A 1 43 HIS 43 387 387 HIS HIS A . n A 1 44 ASP 44 388 388 ASP ASP A . n A 1 45 ILE 45 389 389 ILE ILE A . n A 1 46 ILE 46 390 390 ILE ILE A . n A 1 47 LYS 47 391 391 LYS LYS A . n A 1 48 HIS 48 392 392 HIS HIS A . n A 1 49 PRO 49 393 393 PRO PRO A . n A 1 50 MET 50 394 394 MET MET A . n A 1 51 ASP 51 395 395 ASP ASP A . n A 1 52 LEU 52 396 396 LEU LEU A . n A 1 53 SER 53 397 397 SER SER A . n A 1 54 THR 54 398 398 THR THR A . n A 1 55 VAL 55 399 399 VAL VAL A . n A 1 56 LYS 56 400 400 LYS LYS A . n A 1 57 ARG 57 401 401 ARG ARG A . n A 1 58 LYS 58 402 402 LYS LYS A . n A 1 59 MET 59 403 403 MET MET A . n A 1 60 GLU 60 404 404 GLU GLU A . n A 1 61 ASN 61 405 405 ASN ASN A . n A 1 62 ARG 62 406 406 ARG ARG A . n A 1 63 ASP 63 407 407 ASP ASP A . n A 1 64 TYR 64 408 408 TYR TYR A . n A 1 65 ARG 65 409 409 ARG ARG A . n A 1 66 ASP 66 410 410 ASP ASP A . n A 1 67 ALA 67 411 411 ALA ALA A . n A 1 68 GLN 68 412 412 GLN GLN A . n A 1 69 GLU 69 413 413 GLU GLU A . n A 1 70 PHE 70 414 414 PHE PHE A . n A 1 71 ALA 71 415 415 ALA ALA A . n A 1 72 ALA 72 416 416 ALA ALA A . n A 1 73 ASP 73 417 417 ASP ASP A . n A 1 74 VAL 74 418 418 VAL VAL A . n A 1 75 ARG 75 419 419 ARG ARG A . n A 1 76 LEU 76 420 420 LEU LEU A . n A 1 77 MET 77 421 421 MET MET A . n A 1 78 PHE 78 422 422 PHE PHE A . n A 1 79 SER 79 423 423 SER SER A . n A 1 80 ASN 80 424 424 ASN ASN A . n A 1 81 CYS 81 425 425 CYS CYS A . n A 1 82 TYR 82 426 426 TYR TYR A . n A 1 83 LYS 83 427 427 LYS LYS A . n A 1 84 TYR 84 428 428 TYR TYR A . n A 1 85 ASN 85 429 429 ASN ASN A . n A 1 86 PRO 86 430 430 PRO PRO A . n A 1 87 PRO 87 431 431 PRO PRO A . n A 1 88 ASP 88 432 432 ASP ASP A . n A 1 89 HIS 89 433 433 HIS HIS A . n A 1 90 ASP 90 434 434 ASP ASP A . n A 1 91 VAL 91 435 435 VAL VAL A . n A 1 92 VAL 92 436 436 VAL VAL A . n A 1 93 ALA 93 437 437 ALA ALA A . n A 1 94 MET 94 438 438 MET MET A . n A 1 95 ALA 95 439 439 ALA ALA A . n A 1 96 ARG 96 440 440 ARG ARG A . n A 1 97 LYS 97 441 441 LYS LYS A . n A 1 98 LEU 98 442 442 LEU LEU A . n A 1 99 GLN 99 443 443 GLN GLN A . n A 1 100 ASP 100 444 444 ASP ASP A . n A 1 101 VAL 101 445 445 VAL VAL A . n A 1 102 PHE 102 446 446 PHE PHE A . n A 1 103 GLU 103 447 447 GLU GLU A . n A 1 104 PHE 104 448 448 PHE PHE A . n A 1 105 ARG 105 449 449 ARG ARG A . n A 1 106 TYR 106 450 450 TYR TYR A . n A 1 107 ALA 107 451 451 ALA ALA A . n A 1 108 LYS 108 452 452 LYS LYS A . n A 1 109 MET 109 453 453 MET MET A . n A 1 110 PRO 110 454 454 PRO PRO A . n A 1 111 ASP 111 455 455 ASP ASP A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email don.ronning@unmc.edu _pdbx_contact_author.name_first Donald _pdbx_contact_author.name_last Ronning _pdbx_contact_author.name_mi R _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2583-8849 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 O6O 1 501 501 O6O LIG A . C 3 EDO 1 502 502 EDO EDO A . D 3 EDO 1 503 504 EDO EDO A . E 4 NA 1 504 1 NA NA A . F 5 HOH 1 601 229 HOH HOH A . F 5 HOH 2 602 67 HOH HOH A . F 5 HOH 3 603 253 HOH HOH A . F 5 HOH 4 604 68 HOH HOH A . F 5 HOH 5 605 154 HOH HOH A . F 5 HOH 6 606 155 HOH HOH A . F 5 HOH 7 607 210 HOH HOH A . F 5 HOH 8 608 128 HOH HOH A . F 5 HOH 9 609 86 HOH HOH A . F 5 HOH 10 610 255 HOH HOH A . F 5 HOH 11 611 7 HOH HOH A . F 5 HOH 12 612 131 HOH HOH A . F 5 HOH 13 613 4 HOH HOH A . F 5 HOH 14 614 2 HOH HOH A . F 5 HOH 15 615 127 HOH HOH A . F 5 HOH 16 616 47 HOH HOH A . F 5 HOH 17 617 152 HOH HOH A . F 5 HOH 18 618 116 HOH HOH A . F 5 HOH 19 619 62 HOH HOH A . F 5 HOH 20 620 222 HOH HOH A . F 5 HOH 21 621 33 HOH HOH A . F 5 HOH 22 622 208 HOH HOH A . F 5 HOH 23 623 212 HOH HOH A . F 5 HOH 24 624 61 HOH HOH A . F 5 HOH 25 625 22 HOH HOH A . F 5 HOH 26 626 75 HOH HOH A . F 5 HOH 27 627 160 HOH HOH A . F 5 HOH 28 628 60 HOH HOH A . F 5 HOH 29 629 8 HOH HOH A . F 5 HOH 30 630 107 HOH HOH A . F 5 HOH 31 631 5 HOH HOH A . F 5 HOH 32 632 49 HOH HOH A . F 5 HOH 33 633 118 HOH HOH A . F 5 HOH 34 634 13 HOH HOH A . F 5 HOH 35 635 237 HOH HOH A . F 5 HOH 36 636 69 HOH HOH A . F 5 HOH 37 637 9 HOH HOH A . F 5 HOH 38 638 35 HOH HOH A . F 5 HOH 39 639 198 HOH HOH A . F 5 HOH 40 640 15 HOH HOH A . F 5 HOH 41 641 126 HOH HOH A . F 5 HOH 42 642 45 HOH HOH A . F 5 HOH 43 643 58 HOH HOH A . F 5 HOH 44 644 50 HOH HOH A . F 5 HOH 45 645 41 HOH HOH A . F 5 HOH 46 646 91 HOH HOH A . F 5 HOH 47 647 23 HOH HOH A . F 5 HOH 48 648 112 HOH HOH A . F 5 HOH 49 649 71 HOH HOH A . F 5 HOH 50 650 53 HOH HOH A . F 5 HOH 51 651 175 HOH HOH A . F 5 HOH 52 652 3 HOH HOH A . F 5 HOH 53 653 20 HOH HOH A . F 5 HOH 54 654 92 HOH HOH A . F 5 HOH 55 655 73 HOH HOH A . F 5 HOH 56 656 246 HOH HOH A . F 5 HOH 57 657 12 HOH HOH A . F 5 HOH 58 658 17 HOH HOH A . F 5 HOH 59 659 52 HOH HOH A . F 5 HOH 60 660 186 HOH HOH A . F 5 HOH 61 661 109 HOH HOH A . F 5 HOH 62 662 185 HOH HOH A . F 5 HOH 63 663 48 HOH HOH A . F 5 HOH 64 664 89 HOH HOH A . F 5 HOH 65 665 36 HOH HOH A . F 5 HOH 66 666 32 HOH HOH A . F 5 HOH 67 667 55 HOH HOH A . F 5 HOH 68 668 11 HOH HOH A . F 5 HOH 69 669 156 HOH HOH A . F 5 HOH 70 670 28 HOH HOH A . F 5 HOH 71 671 74 HOH HOH A . F 5 HOH 72 672 133 HOH HOH A . F 5 HOH 73 673 84 HOH HOH A . F 5 HOH 74 674 82 HOH HOH A . F 5 HOH 75 675 19 HOH HOH A . F 5 HOH 76 676 26 HOH HOH A . F 5 HOH 77 677 18 HOH HOH A . F 5 HOH 78 678 34 HOH HOH A . F 5 HOH 79 679 46 HOH HOH A . F 5 HOH 80 680 142 HOH HOH A . F 5 HOH 81 681 30 HOH HOH A . F 5 HOH 82 682 27 HOH HOH A . F 5 HOH 83 683 177 HOH HOH A . F 5 HOH 84 684 98 HOH HOH A . F 5 HOH 85 685 100 HOH HOH A . F 5 HOH 86 686 254 HOH HOH A . F 5 HOH 87 687 16 HOH HOH A . F 5 HOH 88 688 70 HOH HOH A . F 5 HOH 89 689 122 HOH HOH A . F 5 HOH 90 690 147 HOH HOH A . F 5 HOH 91 691 57 HOH HOH A . F 5 HOH 92 692 54 HOH HOH A . F 5 HOH 93 693 192 HOH HOH A . F 5 HOH 94 694 181 HOH HOH A . F 5 HOH 95 695 85 HOH HOH A . F 5 HOH 96 696 21 HOH HOH A . F 5 HOH 97 697 184 HOH HOH A . F 5 HOH 98 698 238 HOH HOH A . F 5 HOH 99 699 97 HOH HOH A . F 5 HOH 100 700 204 HOH HOH A . F 5 HOH 101 701 56 HOH HOH A . F 5 HOH 102 702 115 HOH HOH A . F 5 HOH 103 703 140 HOH HOH A . F 5 HOH 104 704 90 HOH HOH A . F 5 HOH 105 705 78 HOH HOH A . F 5 HOH 106 706 10 HOH HOH A . F 5 HOH 107 707 171 HOH HOH A . F 5 HOH 108 708 249 HOH HOH A . F 5 HOH 109 709 256 HOH HOH A . F 5 HOH 110 710 63 HOH HOH A . F 5 HOH 111 711 14 HOH HOH A . F 5 HOH 112 712 37 HOH HOH A . F 5 HOH 113 713 44 HOH HOH A . F 5 HOH 114 714 215 HOH HOH A . F 5 HOH 115 715 31 HOH HOH A . F 5 HOH 116 716 6 HOH HOH A . F 5 HOH 117 717 83 HOH HOH A . F 5 HOH 118 718 103 HOH HOH A . F 5 HOH 119 719 123 HOH HOH A . F 5 HOH 120 720 169 HOH HOH A . F 5 HOH 121 721 135 HOH HOH A . F 5 HOH 122 722 138 HOH HOH A . F 5 HOH 123 723 241 HOH HOH A . F 5 HOH 124 724 219 HOH HOH A . F 5 HOH 125 725 43 HOH HOH A . F 5 HOH 126 726 144 HOH HOH A . F 5 HOH 127 727 25 HOH HOH A . F 5 HOH 128 728 221 HOH HOH A . F 5 HOH 129 729 151 HOH HOH A . F 5 HOH 130 730 217 HOH HOH A . F 5 HOH 131 731 96 HOH HOH A . F 5 HOH 132 732 242 HOH HOH A . F 5 HOH 133 733 95 HOH HOH A . F 5 HOH 134 734 42 HOH HOH A . F 5 HOH 135 735 234 HOH HOH A . F 5 HOH 136 736 226 HOH HOH A . F 5 HOH 137 737 195 HOH HOH A . F 5 HOH 138 738 130 HOH HOH A . F 5 HOH 139 739 38 HOH HOH A . F 5 HOH 140 740 104 HOH HOH A . F 5 HOH 141 741 65 HOH HOH A . F 5 HOH 142 742 148 HOH HOH A . F 5 HOH 143 743 172 HOH HOH A . F 5 HOH 144 744 114 HOH HOH A . F 5 HOH 145 745 164 HOH HOH A . F 5 HOH 146 746 132 HOH HOH A . F 5 HOH 147 747 170 HOH HOH A . F 5 HOH 148 748 146 HOH HOH A . F 5 HOH 149 749 247 HOH HOH A . F 5 HOH 150 750 119 HOH HOH A . F 5 HOH 151 751 134 HOH HOH A . F 5 HOH 152 752 179 HOH HOH A . F 5 HOH 153 753 150 HOH HOH A . F 5 HOH 154 754 161 HOH HOH A . F 5 HOH 155 755 139 HOH HOH A . F 5 HOH 156 756 182 HOH HOH A . F 5 HOH 157 757 117 HOH HOH A . F 5 HOH 158 758 227 HOH HOH A . F 5 HOH 159 759 200 HOH HOH A . F 5 HOH 160 760 220 HOH HOH A . F 5 HOH 161 761 235 HOH HOH A . F 5 HOH 162 762 141 HOH HOH A . F 5 HOH 163 763 216 HOH HOH A . F 5 HOH 164 764 243 HOH HOH A . F 5 HOH 165 765 205 HOH HOH A . F 5 HOH 166 766 233 HOH HOH A . F 5 HOH 167 767 76 HOH HOH A . F 5 HOH 168 768 244 HOH HOH A . F 5 HOH 169 769 110 HOH HOH A . F 5 HOH 170 770 231 HOH HOH A . F 5 HOH 171 771 166 HOH HOH A . F 5 HOH 172 772 64 HOH HOH A . F 5 HOH 173 773 214 HOH HOH A . F 5 HOH 174 774 153 HOH HOH A . F 5 HOH 175 775 194 HOH HOH A . F 5 HOH 176 776 24 HOH HOH A . F 5 HOH 177 777 230 HOH HOH A . F 5 HOH 178 778 239 HOH HOH A . F 5 HOH 179 779 197 HOH HOH A . F 5 HOH 180 780 124 HOH HOH A . F 5 HOH 181 781 248 HOH HOH A . F 5 HOH 182 782 176 HOH HOH A . F 5 HOH 183 783 193 HOH HOH A . F 5 HOH 184 784 102 HOH HOH A . F 5 HOH 185 785 203 HOH HOH A . F 5 HOH 186 786 40 HOH HOH A . F 5 HOH 187 787 174 HOH HOH A . F 5 HOH 188 788 99 HOH HOH A . F 5 HOH 189 789 211 HOH HOH A . F 5 HOH 190 790 228 HOH HOH A . F 5 HOH 191 791 143 HOH HOH A . F 5 HOH 192 792 120 HOH HOH A . F 5 HOH 193 793 106 HOH HOH A . F 5 HOH 194 794 168 HOH HOH A . F 5 HOH 195 795 66 HOH HOH A . F 5 HOH 196 796 72 HOH HOH A . F 5 HOH 197 797 201 HOH HOH A . F 5 HOH 198 798 157 HOH HOH A . F 5 HOH 199 799 190 HOH HOH A . F 5 HOH 200 800 125 HOH HOH A . F 5 HOH 201 801 165 HOH HOH A . F 5 HOH 202 802 105 HOH HOH A . F 5 HOH 203 803 93 HOH HOH A . F 5 HOH 204 804 80 HOH HOH A . F 5 HOH 205 805 213 HOH HOH A . F 5 HOH 206 806 236 HOH HOH A . F 5 HOH 207 807 137 HOH HOH A . F 5 HOH 208 808 191 HOH HOH A . F 5 HOH 209 809 39 HOH HOH A . F 5 HOH 210 810 108 HOH HOH A . F 5 HOH 211 811 240 HOH HOH A . F 5 HOH 212 812 59 HOH HOH A . F 5 HOH 213 813 113 HOH HOH A . F 5 HOH 214 814 87 HOH HOH A . F 5 HOH 215 815 129 HOH HOH A . F 5 HOH 216 816 77 HOH HOH A . F 5 HOH 217 817 81 HOH HOH A . F 5 HOH 218 818 79 HOH HOH A . F 5 HOH 219 819 121 HOH HOH A . F 5 HOH 220 820 209 HOH HOH A . F 5 HOH 221 821 101 HOH HOH A . F 5 HOH 222 822 232 HOH HOH A . F 5 HOH 223 823 163 HOH HOH A . F 5 HOH 224 824 136 HOH HOH A . F 5 HOH 225 825 183 HOH HOH A . F 5 HOH 226 826 29 HOH HOH A . F 5 HOH 227 827 225 HOH HOH A . F 5 HOH 228 828 202 HOH HOH A . F 5 HOH 229 829 189 HOH HOH A . F 5 HOH 230 830 51 HOH HOH A . F 5 HOH 231 831 159 HOH HOH A . F 5 HOH 232 832 173 HOH HOH A . F 5 HOH 233 833 149 HOH HOH A . F 5 HOH 234 834 111 HOH HOH A . F 5 HOH 235 835 145 HOH HOH A . F 5 HOH 236 836 252 HOH HOH A . F 5 HOH 237 837 158 HOH HOH A . F 5 HOH 238 838 207 HOH HOH A . F 5 HOH 239 839 94 HOH HOH A . F 5 HOH 240 840 180 HOH HOH A . F 5 HOH 241 841 223 HOH HOH A . F 5 HOH 242 842 162 HOH HOH A . F 5 HOH 243 843 218 HOH HOH A . F 5 HOH 244 844 178 HOH HOH A . F 5 HOH 245 845 188 HOH HOH A . F 5 HOH 246 846 196 HOH HOH A . F 5 HOH 247 847 88 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A NA 504 ? E NA . 2 1 A HOH 818 ? F HOH . 3 1 A HOH 844 ? F HOH . 4 1 A HOH 847 ? F HOH . # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id O _pdbx_struct_conn_angle.ptnr1_label_alt_id ? _pdbx_struct_conn_angle.ptnr1_label_asym_id F _pdbx_struct_conn_angle.ptnr1_label_comp_id HOH _pdbx_struct_conn_angle.ptnr1_label_seq_id . _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id A _pdbx_struct_conn_angle.ptnr1_auth_comp_id HOH _pdbx_struct_conn_angle.ptnr1_auth_seq_id 681 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id NA _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id E _pdbx_struct_conn_angle.ptnr2_label_comp_id NA _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id A _pdbx_struct_conn_angle.ptnr2_auth_comp_id NA _pdbx_struct_conn_angle.ptnr2_auth_seq_id 504 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 1_555 _pdbx_struct_conn_angle.ptnr3_label_atom_id O _pdbx_struct_conn_angle.ptnr3_label_alt_id ? _pdbx_struct_conn_angle.ptnr3_label_asym_id F _pdbx_struct_conn_angle.ptnr3_label_comp_id HOH _pdbx_struct_conn_angle.ptnr3_label_seq_id . _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id A _pdbx_struct_conn_angle.ptnr3_auth_comp_id HOH _pdbx_struct_conn_angle.ptnr3_auth_seq_id 681 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 2_555 _pdbx_struct_conn_angle.value 104.8 _pdbx_struct_conn_angle.value_esd ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-01-18 2 'Structure model' 1 1 2023-10-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.1_4122 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 7USG _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 845 ? 5.85 . 2 1 O ? A HOH 846 ? 5.87 . 3 1 O ? A HOH 847 ? 6.44 . # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 EDO C1 C N N 88 EDO O1 O N N 89 EDO C2 C N N 90 EDO O2 O N N 91 EDO H11 H N N 92 EDO H12 H N N 93 EDO HO1 H N N 94 EDO H21 H N N 95 EDO H22 H N N 96 EDO HO2 H N N 97 GLN N N N N 98 GLN CA C N S 99 GLN C C N N 100 GLN O O N N 101 GLN CB C N N 102 GLN CG C N N 103 GLN CD C N N 104 GLN OE1 O N N 105 GLN NE2 N N N 106 GLN OXT O N N 107 GLN H H N N 108 GLN H2 H N N 109 GLN HA H N N 110 GLN HB2 H N N 111 GLN HB3 H N N 112 GLN HG2 H N N 113 GLN HG3 H N N 114 GLN HE21 H N N 115 GLN HE22 H N N 116 GLN HXT H N N 117 GLU N N N N 118 GLU CA C N S 119 GLU C C N N 120 GLU O O N N 121 GLU CB C N N 122 GLU CG C N N 123 GLU CD C N N 124 GLU OE1 O N N 125 GLU OE2 O N N 126 GLU OXT O N N 127 GLU H H N N 128 GLU H2 H N N 129 GLU HA H N N 130 GLU HB2 H N N 131 GLU HB3 H N N 132 GLU HG2 H N N 133 GLU HG3 H N N 134 GLU HE2 H N N 135 GLU HXT H N N 136 GLY N N N N 137 GLY CA C N N 138 GLY C C N N 139 GLY O O N N 140 GLY OXT O N N 141 GLY H H N N 142 GLY H2 H N N 143 GLY HA2 H N N 144 GLY HA3 H N N 145 GLY HXT H N N 146 HIS N N N N 147 HIS CA C N S 148 HIS C C N N 149 HIS O O N N 150 HIS CB C N N 151 HIS CG C Y N 152 HIS ND1 N Y N 153 HIS CD2 C Y N 154 HIS CE1 C Y N 155 HIS NE2 N Y N 156 HIS OXT O N N 157 HIS H H N N 158 HIS H2 H N N 159 HIS HA H N N 160 HIS HB2 H N N 161 HIS HB3 H N N 162 HIS HD1 H N N 163 HIS HD2 H N N 164 HIS HE1 H N N 165 HIS HE2 H N N 166 HIS HXT H N N 167 HOH O O N N 168 HOH H1 H N N 169 HOH H2 H N N 170 ILE N N N N 171 ILE CA C N S 172 ILE C C N N 173 ILE O O N N 174 ILE CB C N S 175 ILE CG1 C N N 176 ILE CG2 C N N 177 ILE CD1 C N N 178 ILE OXT O N N 179 ILE H H N N 180 ILE H2 H N N 181 ILE HA H N N 182 ILE HB H N N 183 ILE HG12 H N N 184 ILE HG13 H N N 185 ILE HG21 H N N 186 ILE HG22 H N N 187 ILE HG23 H N N 188 ILE HD11 H N N 189 ILE HD12 H N N 190 ILE HD13 H N N 191 ILE HXT H N N 192 LEU N N N N 193 LEU CA C N S 194 LEU C C N N 195 LEU O O N N 196 LEU CB C N N 197 LEU CG C N N 198 LEU CD1 C N N 199 LEU CD2 C N N 200 LEU OXT O N N 201 LEU H H N N 202 LEU H2 H N N 203 LEU HA H N N 204 LEU HB2 H N N 205 LEU HB3 H N N 206 LEU HG H N N 207 LEU HD11 H N N 208 LEU HD12 H N N 209 LEU HD13 H N N 210 LEU HD21 H N N 211 LEU HD22 H N N 212 LEU HD23 H N N 213 LEU HXT H N N 214 LYS N N N N 215 LYS CA C N S 216 LYS C C N N 217 LYS O O N N 218 LYS CB C N N 219 LYS CG C N N 220 LYS CD C N N 221 LYS CE C N N 222 LYS NZ N N N 223 LYS OXT O N N 224 LYS H H N N 225 LYS H2 H N N 226 LYS HA H N N 227 LYS HB2 H N N 228 LYS HB3 H N N 229 LYS HG2 H N N 230 LYS HG3 H N N 231 LYS HD2 H N N 232 LYS HD3 H N N 233 LYS HE2 H N N 234 LYS HE3 H N N 235 LYS HZ1 H N N 236 LYS HZ2 H N N 237 LYS HZ3 H N N 238 LYS HXT H N N 239 MET N N N N 240 MET CA C N S 241 MET C C N N 242 MET O O N N 243 MET CB C N N 244 MET CG C N N 245 MET SD S N N 246 MET CE C N N 247 MET OXT O N N 248 MET H H N N 249 MET H2 H N N 250 MET HA H N N 251 MET HB2 H N N 252 MET HB3 H N N 253 MET HG2 H N N 254 MET HG3 H N N 255 MET HE1 H N N 256 MET HE2 H N N 257 MET HE3 H N N 258 MET HXT H N N 259 NA NA NA N N 260 O6O C10 C Y N 261 O6O C13 C N N 262 O6O C17 C Y N 263 O6O C20 C N N 264 O6O C22 C N N 265 O6O C26 C N N 266 O6O C02 C N N 267 O6O C03 C Y N 268 O6O C04 C Y N 269 O6O C05 C Y N 270 O6O C06 C Y N 271 O6O C07 C Y N 272 O6O C08 C Y N 273 O6O C09 C Y N 274 O6O C11 C Y N 275 O6O C14 C N N 276 O6O C16 C Y N 277 O6O C18 C Y N 278 O6O C23 C N N 279 O6O C25 C N N 280 O6O C27 C N N 281 O6O N21 N N N 282 O6O O01 O N N 283 O6O O12 O N N 284 O6O O15 O N N 285 O6O O19 O N N 286 O6O O24 O N N 287 O6O H1 H N N 288 O6O H2 H N N 289 O6O H3 H N N 290 O6O H4 H N N 291 O6O H5 H N N 292 O6O H6 H N N 293 O6O H7 H N N 294 O6O H8 H N N 295 O6O H9 H N N 296 O6O H10 H N N 297 O6O H11 H N N 298 O6O H12 H N N 299 O6O H13 H N N 300 O6O H14 H N N 301 O6O H15 H N N 302 O6O H16 H N N 303 O6O H17 H N N 304 O6O H18 H N N 305 O6O H19 H N N 306 PHE N N N N 307 PHE CA C N S 308 PHE C C N N 309 PHE O O N N 310 PHE CB C N N 311 PHE CG C Y N 312 PHE CD1 C Y N 313 PHE CD2 C Y N 314 PHE CE1 C Y N 315 PHE CE2 C Y N 316 PHE CZ C Y N 317 PHE OXT O N N 318 PHE H H N N 319 PHE H2 H N N 320 PHE HA H N N 321 PHE HB2 H N N 322 PHE HB3 H N N 323 PHE HD1 H N N 324 PHE HD2 H N N 325 PHE HE1 H N N 326 PHE HE2 H N N 327 PHE HZ H N N 328 PHE HXT H N N 329 PRO N N N N 330 PRO CA C N S 331 PRO C C N N 332 PRO O O N N 333 PRO CB C N N 334 PRO CG C N N 335 PRO CD C N N 336 PRO OXT O N N 337 PRO H H N N 338 PRO HA H N N 339 PRO HB2 H N N 340 PRO HB3 H N N 341 PRO HG2 H N N 342 PRO HG3 H N N 343 PRO HD2 H N N 344 PRO HD3 H N N 345 PRO HXT H N N 346 SER N N N N 347 SER CA C N S 348 SER C C N N 349 SER O O N N 350 SER CB C N N 351 SER OG O N N 352 SER OXT O N N 353 SER H H N N 354 SER H2 H N N 355 SER HA H N N 356 SER HB2 H N N 357 SER HB3 H N N 358 SER HG H N N 359 SER HXT H N N 360 THR N N N N 361 THR CA C N S 362 THR C C N N 363 THR O O N N 364 THR CB C N R 365 THR OG1 O N N 366 THR CG2 C N N 367 THR OXT O N N 368 THR H H N N 369 THR H2 H N N 370 THR HA H N N 371 THR HB H N N 372 THR HG1 H N N 373 THR HG21 H N N 374 THR HG22 H N N 375 THR HG23 H N N 376 THR HXT H N N 377 TRP N N N N 378 TRP CA C N S 379 TRP C C N N 380 TRP O O N N 381 TRP CB C N N 382 TRP CG C Y N 383 TRP CD1 C Y N 384 TRP CD2 C Y N 385 TRP NE1 N Y N 386 TRP CE2 C Y N 387 TRP CE3 C Y N 388 TRP CZ2 C Y N 389 TRP CZ3 C Y N 390 TRP CH2 C Y N 391 TRP OXT O N N 392 TRP H H N N 393 TRP H2 H N N 394 TRP HA H N N 395 TRP HB2 H N N 396 TRP HB3 H N N 397 TRP HD1 H N N 398 TRP HE1 H N N 399 TRP HE3 H N N 400 TRP HZ2 H N N 401 TRP HZ3 H N N 402 TRP HH2 H N N 403 TRP HXT H N N 404 TYR N N N N 405 TYR CA C N S 406 TYR C C N N 407 TYR O O N N 408 TYR CB C N N 409 TYR CG C Y N 410 TYR CD1 C Y N 411 TYR CD2 C Y N 412 TYR CE1 C Y N 413 TYR CE2 C Y N 414 TYR CZ C Y N 415 TYR OH O N N 416 TYR OXT O N N 417 TYR H H N N 418 TYR H2 H N N 419 TYR HA H N N 420 TYR HB2 H N N 421 TYR HB3 H N N 422 TYR HD1 H N N 423 TYR HD2 H N N 424 TYR HE1 H N N 425 TYR HE2 H N N 426 TYR HH H N N 427 TYR HXT H N N 428 VAL N N N N 429 VAL CA C N S 430 VAL C C N N 431 VAL O O N N 432 VAL CB C N N 433 VAL CG1 C N N 434 VAL CG2 C N N 435 VAL OXT O N N 436 VAL H H N N 437 VAL H2 H N N 438 VAL HA H N N 439 VAL HB H N N 440 VAL HG11 H N N 441 VAL HG12 H N N 442 VAL HG13 H N N 443 VAL HG21 H N N 444 VAL HG22 H N N 445 VAL HG23 H N N 446 VAL HXT H N N 447 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 EDO C1 O1 sing N N 83 EDO C1 C2 sing N N 84 EDO C1 H11 sing N N 85 EDO C1 H12 sing N N 86 EDO O1 HO1 sing N N 87 EDO C2 O2 sing N N 88 EDO C2 H21 sing N N 89 EDO C2 H22 sing N N 90 EDO O2 HO2 sing N N 91 GLN N CA sing N N 92 GLN N H sing N N 93 GLN N H2 sing N N 94 GLN CA C sing N N 95 GLN CA CB sing N N 96 GLN CA HA sing N N 97 GLN C O doub N N 98 GLN C OXT sing N N 99 GLN CB CG sing N N 100 GLN CB HB2 sing N N 101 GLN CB HB3 sing N N 102 GLN CG CD sing N N 103 GLN CG HG2 sing N N 104 GLN CG HG3 sing N N 105 GLN CD OE1 doub N N 106 GLN CD NE2 sing N N 107 GLN NE2 HE21 sing N N 108 GLN NE2 HE22 sing N N 109 GLN OXT HXT sing N N 110 GLU N CA sing N N 111 GLU N H sing N N 112 GLU N H2 sing N N 113 GLU CA C sing N N 114 GLU CA CB sing N N 115 GLU CA HA sing N N 116 GLU C O doub N N 117 GLU C OXT sing N N 118 GLU CB CG sing N N 119 GLU CB HB2 sing N N 120 GLU CB HB3 sing N N 121 GLU CG CD sing N N 122 GLU CG HG2 sing N N 123 GLU CG HG3 sing N N 124 GLU CD OE1 doub N N 125 GLU CD OE2 sing N N 126 GLU OE2 HE2 sing N N 127 GLU OXT HXT sing N N 128 GLY N CA sing N N 129 GLY N H sing N N 130 GLY N H2 sing N N 131 GLY CA C sing N N 132 GLY CA HA2 sing N N 133 GLY CA HA3 sing N N 134 GLY C O doub N N 135 GLY C OXT sing N N 136 GLY OXT HXT sing N N 137 HIS N CA sing N N 138 HIS N H sing N N 139 HIS N H2 sing N N 140 HIS CA C sing N N 141 HIS CA CB sing N N 142 HIS CA HA sing N N 143 HIS C O doub N N 144 HIS C OXT sing N N 145 HIS CB CG sing N N 146 HIS CB HB2 sing N N 147 HIS CB HB3 sing N N 148 HIS CG ND1 sing Y N 149 HIS CG CD2 doub Y N 150 HIS ND1 CE1 doub Y N 151 HIS ND1 HD1 sing N N 152 HIS CD2 NE2 sing Y N 153 HIS CD2 HD2 sing N N 154 HIS CE1 NE2 sing Y N 155 HIS CE1 HE1 sing N N 156 HIS NE2 HE2 sing N N 157 HIS OXT HXT sing N N 158 HOH O H1 sing N N 159 HOH O H2 sing N N 160 ILE N CA sing N N 161 ILE N H sing N N 162 ILE N H2 sing N N 163 ILE CA C sing N N 164 ILE CA CB sing N N 165 ILE CA HA sing N N 166 ILE C O doub N N 167 ILE C OXT sing N N 168 ILE CB CG1 sing N N 169 ILE CB CG2 sing N N 170 ILE CB HB sing N N 171 ILE CG1 CD1 sing N N 172 ILE CG1 HG12 sing N N 173 ILE CG1 HG13 sing N N 174 ILE CG2 HG21 sing N N 175 ILE CG2 HG22 sing N N 176 ILE CG2 HG23 sing N N 177 ILE CD1 HD11 sing N N 178 ILE CD1 HD12 sing N N 179 ILE CD1 HD13 sing N N 180 ILE OXT HXT sing N N 181 LEU N CA sing N N 182 LEU N H sing N N 183 LEU N H2 sing N N 184 LEU CA C sing N N 185 LEU CA CB sing N N 186 LEU CA HA sing N N 187 LEU C O doub N N 188 LEU C OXT sing N N 189 LEU CB CG sing N N 190 LEU CB HB2 sing N N 191 LEU CB HB3 sing N N 192 LEU CG CD1 sing N N 193 LEU CG CD2 sing N N 194 LEU CG HG sing N N 195 LEU CD1 HD11 sing N N 196 LEU CD1 HD12 sing N N 197 LEU CD1 HD13 sing N N 198 LEU CD2 HD21 sing N N 199 LEU CD2 HD22 sing N N 200 LEU CD2 HD23 sing N N 201 LEU OXT HXT sing N N 202 LYS N CA sing N N 203 LYS N H sing N N 204 LYS N H2 sing N N 205 LYS CA C sing N N 206 LYS CA CB sing N N 207 LYS CA HA sing N N 208 LYS C O doub N N 209 LYS C OXT sing N N 210 LYS CB CG sing N N 211 LYS CB HB2 sing N N 212 LYS CB HB3 sing N N 213 LYS CG CD sing N N 214 LYS CG HG2 sing N N 215 LYS CG HG3 sing N N 216 LYS CD CE sing N N 217 LYS CD HD2 sing N N 218 LYS CD HD3 sing N N 219 LYS CE NZ sing N N 220 LYS CE HE2 sing N N 221 LYS CE HE3 sing N N 222 LYS NZ HZ1 sing N N 223 LYS NZ HZ2 sing N N 224 LYS NZ HZ3 sing N N 225 LYS OXT HXT sing N N 226 MET N CA sing N N 227 MET N H sing N N 228 MET N H2 sing N N 229 MET CA C sing N N 230 MET CA CB sing N N 231 MET CA HA sing N N 232 MET C O doub N N 233 MET C OXT sing N N 234 MET CB CG sing N N 235 MET CB HB2 sing N N 236 MET CB HB3 sing N N 237 MET CG SD sing N N 238 MET CG HG2 sing N N 239 MET CG HG3 sing N N 240 MET SD CE sing N N 241 MET CE HE1 sing N N 242 MET CE HE2 sing N N 243 MET CE HE3 sing N N 244 MET OXT HXT sing N N 245 O6O C05 C04 doub Y N 246 O6O C05 C06 sing Y N 247 O6O C04 C03 sing Y N 248 O6O O01 C02 doub N N 249 O6O C06 C07 doub Y N 250 O6O C03 C02 sing N N 251 O6O C03 C18 doub Y N 252 O6O C02 C27 sing N N 253 O6O C07 C18 sing Y N 254 O6O C07 C08 sing N N 255 O6O C18 O19 sing N N 256 O6O C17 C08 doub Y N 257 O6O C17 C16 sing Y N 258 O6O C27 C20 doub N N 259 O6O C08 C09 sing Y N 260 O6O O19 C20 sing N N 261 O6O C16 C11 doub Y N 262 O6O C20 N21 sing N N 263 O6O N21 C22 sing N N 264 O6O N21 C26 sing N N 265 O6O C09 C10 doub Y N 266 O6O C11 C10 sing Y N 267 O6O C11 O12 sing N N 268 O6O C22 C23 sing N N 269 O6O C26 C25 sing N N 270 O6O C10 O15 sing N N 271 O6O O12 C13 sing N N 272 O6O C23 O24 sing N N 273 O6O C13 C14 sing N N 274 O6O C25 O24 sing N N 275 O6O O15 C14 sing N N 276 O6O C13 H1 sing N N 277 O6O C13 H2 sing N N 278 O6O C17 H3 sing N N 279 O6O C22 H4 sing N N 280 O6O C22 H5 sing N N 281 O6O C26 H6 sing N N 282 O6O C26 H7 sing N N 283 O6O C04 H8 sing N N 284 O6O C05 H9 sing N N 285 O6O C06 H10 sing N N 286 O6O C09 H11 sing N N 287 O6O C14 H12 sing N N 288 O6O C14 H13 sing N N 289 O6O C16 H14 sing N N 290 O6O C23 H15 sing N N 291 O6O C23 H16 sing N N 292 O6O C25 H17 sing N N 293 O6O C25 H18 sing N N 294 O6O C27 H19 sing N N 295 PHE N CA sing N N 296 PHE N H sing N N 297 PHE N H2 sing N N 298 PHE CA C sing N N 299 PHE CA CB sing N N 300 PHE CA HA sing N N 301 PHE C O doub N N 302 PHE C OXT sing N N 303 PHE CB CG sing N N 304 PHE CB HB2 sing N N 305 PHE CB HB3 sing N N 306 PHE CG CD1 doub Y N 307 PHE CG CD2 sing Y N 308 PHE CD1 CE1 sing Y N 309 PHE CD1 HD1 sing N N 310 PHE CD2 CE2 doub Y N 311 PHE CD2 HD2 sing N N 312 PHE CE1 CZ doub Y N 313 PHE CE1 HE1 sing N N 314 PHE CE2 CZ sing Y N 315 PHE CE2 HE2 sing N N 316 PHE CZ HZ sing N N 317 PHE OXT HXT sing N N 318 PRO N CA sing N N 319 PRO N CD sing N N 320 PRO N H sing N N 321 PRO CA C sing N N 322 PRO CA CB sing N N 323 PRO CA HA sing N N 324 PRO C O doub N N 325 PRO C OXT sing N N 326 PRO CB CG sing N N 327 PRO CB HB2 sing N N 328 PRO CB HB3 sing N N 329 PRO CG CD sing N N 330 PRO CG HG2 sing N N 331 PRO CG HG3 sing N N 332 PRO CD HD2 sing N N 333 PRO CD HD3 sing N N 334 PRO OXT HXT sing N N 335 SER N CA sing N N 336 SER N H sing N N 337 SER N H2 sing N N 338 SER CA C sing N N 339 SER CA CB sing N N 340 SER CA HA sing N N 341 SER C O doub N N 342 SER C OXT sing N N 343 SER CB OG sing N N 344 SER CB HB2 sing N N 345 SER CB HB3 sing N N 346 SER OG HG sing N N 347 SER OXT HXT sing N N 348 THR N CA sing N N 349 THR N H sing N N 350 THR N H2 sing N N 351 THR CA C sing N N 352 THR CA CB sing N N 353 THR CA HA sing N N 354 THR C O doub N N 355 THR C OXT sing N N 356 THR CB OG1 sing N N 357 THR CB CG2 sing N N 358 THR CB HB sing N N 359 THR OG1 HG1 sing N N 360 THR CG2 HG21 sing N N 361 THR CG2 HG22 sing N N 362 THR CG2 HG23 sing N N 363 THR OXT HXT sing N N 364 TRP N CA sing N N 365 TRP N H sing N N 366 TRP N H2 sing N N 367 TRP CA C sing N N 368 TRP CA CB sing N N 369 TRP CA HA sing N N 370 TRP C O doub N N 371 TRP C OXT sing N N 372 TRP CB CG sing N N 373 TRP CB HB2 sing N N 374 TRP CB HB3 sing N N 375 TRP CG CD1 doub Y N 376 TRP CG CD2 sing Y N 377 TRP CD1 NE1 sing Y N 378 TRP CD1 HD1 sing N N 379 TRP CD2 CE2 doub Y N 380 TRP CD2 CE3 sing Y N 381 TRP NE1 CE2 sing Y N 382 TRP NE1 HE1 sing N N 383 TRP CE2 CZ2 sing Y N 384 TRP CE3 CZ3 doub Y N 385 TRP CE3 HE3 sing N N 386 TRP CZ2 CH2 doub Y N 387 TRP CZ2 HZ2 sing N N 388 TRP CZ3 CH2 sing Y N 389 TRP CZ3 HZ3 sing N N 390 TRP CH2 HH2 sing N N 391 TRP OXT HXT sing N N 392 TYR N CA sing N N 393 TYR N H sing N N 394 TYR N H2 sing N N 395 TYR CA C sing N N 396 TYR CA CB sing N N 397 TYR CA HA sing N N 398 TYR C O doub N N 399 TYR C OXT sing N N 400 TYR CB CG sing N N 401 TYR CB HB2 sing N N 402 TYR CB HB3 sing N N 403 TYR CG CD1 doub Y N 404 TYR CG CD2 sing Y N 405 TYR CD1 CE1 sing Y N 406 TYR CD1 HD1 sing N N 407 TYR CD2 CE2 doub Y N 408 TYR CD2 HD2 sing N N 409 TYR CE1 CZ doub Y N 410 TYR CE1 HE1 sing N N 411 TYR CE2 CZ sing Y N 412 TYR CE2 HE2 sing N N 413 TYR CZ OH sing N N 414 TYR OH HH sing N N 415 TYR OXT HXT sing N N 416 VAL N CA sing N N 417 VAL N H sing N N 418 VAL N H2 sing N N 419 VAL CA C sing N N 420 VAL CA CB sing N N 421 VAL CA HA sing N N 422 VAL C O doub N N 423 VAL C OXT sing N N 424 VAL CB CG1 sing N N 425 VAL CB CG2 sing N N 426 VAL CB HB sing N N 427 VAL CG1 HG11 sing N N 428 VAL CG1 HG12 sing N N 429 VAL CG1 HG13 sing N N 430 VAL CG2 HG21 sing N N 431 VAL CG2 HG22 sing N N 432 VAL CG2 HG23 sing N N 433 VAL OXT HXT sing N N 434 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id O6O _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id O6O _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(8M)-8-(2,3-dihydro-1,4-benzodioxin-6-yl)-2-(morpholin-4-yl)-4H-1-benzopyran-4-one' O6O 3 1,2-ETHANEDIOL EDO 4 'SODIUM ION' NA 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6E6J _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #