data_7UV1 # _entry.id 7UV1 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7UV1 pdb_00007uv1 10.2210/pdb7uv1/pdb WWPDB D_1000264915 ? ? BMRB 31013 ? 10.13018/BMR31013 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-04-05 2 'Structure model' 1 1 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_entry_details 5 2 'Structure model' pdbx_modification_feature # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 2 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7UV1 _pdbx_database_status.recvd_initial_deposition_date 2022-04-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Vicilin Ana o 1.0101 leader sequence residues 20-75' _pdbx_database_related.db_id 31013 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email Mueller3@niehs.nih.gov _pdbx_contact_author.name_first Geoffrey _pdbx_contact_author.name_last Mueller _pdbx_contact_author.name_mi A _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-8361-5323 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mueller, G.A.' 1 0000-0001-8361-5323 'Foo, A.C.Y.' 2 0000-0002-4331-2085 'DeRose, E.F.' 3 0000-0003-0112-1296 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J.Agric.Food Chem.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5118 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 71 _citation.language ? _citation.page_first 2990 _citation.page_last 2998 _citation.title 'Structure and IgE Cross-Reactivity among Cashew, Pistachio, Walnut, and Peanut Vicilin-Buried Peptides.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jafc.2c07061 _citation.pdbx_database_id_PubMed 36728846 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Foo, A.C.Y.' 1 ? primary 'Nesbit, J.B.' 2 ? primary 'Gipson, S.A.Y.' 3 0000-0001-5173-3309 primary 'DeRose, E.F.' 4 0000-0003-0112-1296 primary 'Cheng, H.' 5 ? primary 'Hurlburt, B.K.' 6 0000-0001-5863-9542 primary 'Kulis, M.D.' 7 ? primary 'Kim, E.H.' 8 ? primary 'Dreskin, S.C.' 9 ? primary 'Mustafa, S.' 10 ? primary 'Maleki, S.J.' 11 0000-0002-6056-9958 primary 'Mueller, G.A.' 12 0000-0001-8361-5323 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Vicilin-like protein' _entity.formula_weight 6867.802 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GLGFALAKIDPELKQCKHQCKVQRQYDEQQKEQCVKECEKYYKEKKGREREHEHRD _entity_poly.pdbx_seq_one_letter_code_can GLGFALAKIDPELKQCKHQCKVQRQYDEQQKEQCVKECEKYYKEKKGREREHEHRD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 LEU n 1 3 GLY n 1 4 PHE n 1 5 ALA n 1 6 LEU n 1 7 ALA n 1 8 LYS n 1 9 ILE n 1 10 ASP n 1 11 PRO n 1 12 GLU n 1 13 LEU n 1 14 LYS n 1 15 GLN n 1 16 CYS n 1 17 LYS n 1 18 HIS n 1 19 GLN n 1 20 CYS n 1 21 LYS n 1 22 VAL n 1 23 GLN n 1 24 ARG n 1 25 GLN n 1 26 TYR n 1 27 ASP n 1 28 GLU n 1 29 GLN n 1 30 GLN n 1 31 LYS n 1 32 GLU n 1 33 GLN n 1 34 CYS n 1 35 VAL n 1 36 LYS n 1 37 GLU n 1 38 CYS n 1 39 GLU n 1 40 LYS n 1 41 TYR n 1 42 TYR n 1 43 LYS n 1 44 GLU n 1 45 LYS n 1 46 LYS n 1 47 GLY n 1 48 ARG n 1 49 GLU n 1 50 ARG n 1 51 GLU n 1 52 HIS n 1 53 GLU n 1 54 HIS n 1 55 ARG n 1 56 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 56 _entity_src_gen.gene_src_common_name cashew _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Ana o 1.0102' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Anacardium occidentale' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 171929 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 GLN 19 19 19 GLN GLN A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 HIS 54 54 54 HIS HIS A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 ASP 56 56 56 ASP ASP A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7UV1 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7UV1 _struct.title 'Vicilin Ana o 1.0101 leader sequence residues 20-75' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7UV1 _struct_keywords.text 'Seed storage, ALLERGEN' _struct_keywords.pdbx_keywords ALLERGEN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8L5L6_ANAOC _struct_ref.pdbx_db_accession Q8L5L6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code LGFALAKIDPELKQCKHQCKVQRQYDEQQKEQCVKECEKYYKEKKGREREHE _struct_ref.pdbx_align_begin 19 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7UV1 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 53 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8L5L6 _struct_ref_seq.db_align_beg 19 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 70 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 53 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7UV1 GLY A 1 ? UNP Q8L5L6 ? ? 'expression tag' 1 1 1 7UV1 HIS A 54 ? UNP Q8L5L6 ? ? 'expression tag' 54 2 1 7UV1 ARG A 55 ? UNP Q8L5L6 ? ? 'expression tag' 55 3 1 7UV1 ASP A 56 ? UNP Q8L5L6 ? ? 'expression tag' 56 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 11 ? GLN A 23 ? PRO A 11 GLN A 23 1 ? 13 HELX_P HELX_P2 AA2 ASP A 27 ? LYS A 46 ? ASP A 27 LYS A 46 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 16 A CYS 38 1_555 ? ? ? ? ? ? ? 2.017 ? ? disulf2 disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 20 A CYS 34 1_555 ? ? ? ? ? ? ? 2.012 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 16 ? CYS A 38 ? CYS A 16 ? 1_555 CYS A 38 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 20 ? CYS A 34 ? CYS A 20 ? 1_555 CYS A 34 ? 1_555 SG SG . . . None 'Disulfide bridge' # _pdbx_entry_details.entry_id 7UV1 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 2 ? ? -100.02 67.09 2 1 ILE A 9 ? ? -125.70 -169.91 3 1 ARG A 24 ? ? 52.03 95.93 4 1 LYS A 46 ? ? 38.42 31.43 5 1 GLU A 49 ? ? 64.59 132.79 6 2 LEU A 2 ? ? 64.32 -74.42 7 2 LYS A 46 ? ? 61.84 176.78 8 3 LEU A 6 ? ? -168.13 -62.47 9 3 HIS A 52 ? ? -160.98 -47.99 10 4 LEU A 6 ? ? 74.15 123.41 11 4 GLN A 23 ? ? -37.28 131.13 12 4 ARG A 48 ? ? 60.63 147.17 13 5 LEU A 2 ? ? 58.33 78.24 14 5 LEU A 6 ? ? 8.53 -78.83 15 5 LYS A 8 ? ? -89.31 36.43 16 6 PHE A 4 ? ? 65.41 -177.61 17 6 LEU A 6 ? ? -169.60 118.33 18 6 GLU A 49 ? ? -174.66 121.98 19 7 LEU A 2 ? ? 53.16 -93.20 20 7 ALA A 5 ? ? 61.22 170.62 21 7 ARG A 24 ? ? -59.94 95.97 22 8 ALA A 5 ? ? 74.48 91.54 23 8 ARG A 24 ? ? 75.25 154.88 24 9 PHE A 4 ? ? 49.70 -174.38 25 9 LYS A 8 ? ? -45.37 167.63 26 9 LYS A 46 ? ? 55.86 -154.68 27 9 GLU A 49 ? ? 62.75 63.41 28 10 LEU A 2 ? ? 68.76 -71.20 29 10 ALA A 7 ? ? 54.21 178.64 30 11 GLN A 23 ? ? 69.15 -175.65 31 11 ARG A 24 ? ? 80.06 -38.17 32 11 LYS A 46 ? ? 68.18 162.66 33 11 HIS A 52 ? ? -136.69 -48.17 34 11 GLU A 53 ? ? 59.65 96.75 35 12 ARG A 24 ? ? 53.38 -178.43 36 12 GLU A 51 ? ? -99.36 -112.18 37 12 HIS A 52 ? ? 62.46 151.10 38 13 PHE A 4 ? ? -116.10 51.88 39 13 ALA A 5 ? ? 64.25 -74.18 40 13 LEU A 6 ? ? 63.57 138.72 41 13 LYS A 8 ? ? 37.89 -93.69 42 13 GLN A 23 ? ? 77.94 38.58 43 13 GLN A 25 ? ? -143.52 26.69 44 13 GLU A 53 ? ? 178.96 -96.69 45 14 PHE A 4 ? ? -131.11 -73.38 46 14 ALA A 5 ? ? 173.12 -34.13 47 14 LEU A 6 ? ? 60.31 104.65 48 14 LYS A 8 ? ? -165.03 -166.83 49 14 LYS A 46 ? ? 63.28 75.65 50 14 GLU A 51 ? ? -140.11 -68.32 51 15 PHE A 4 ? ? 62.74 160.53 52 15 ALA A 5 ? ? 62.48 128.59 53 15 LEU A 6 ? ? 63.83 133.98 54 15 GLN A 25 ? ? 174.26 64.56 55 15 LYS A 46 ? ? 58.92 -169.55 56 15 HIS A 54 ? ? 52.71 159.80 57 16 ALA A 5 ? ? 49.13 -174.83 58 16 LYS A 46 ? ? 53.51 178.57 59 16 ARG A 48 ? ? -170.76 78.12 60 16 ARG A 50 ? ? 19.67 -83.88 61 16 GLU A 51 ? ? 65.47 163.54 62 17 GLU A 51 ? ? 69.51 -116.28 63 17 HIS A 52 ? ? 61.08 154.23 64 18 GLN A 23 ? ? -68.16 -165.33 65 18 LYS A 46 ? ? 51.73 74.18 66 19 ARG A 24 ? ? 73.41 -14.82 67 19 LYS A 46 ? ? 64.38 168.43 68 19 GLU A 49 ? ? 57.40 80.22 69 19 GLU A 51 ? ? -92.91 -66.17 70 19 HIS A 52 ? ? 43.89 -166.06 71 19 GLU A 53 ? ? 63.29 139.49 72 20 ALA A 5 ? ? 49.34 89.51 73 20 LYS A 8 ? ? -54.01 -175.67 74 20 ILE A 9 ? ? 77.27 125.32 75 20 GLU A 51 ? ? 169.95 135.35 76 20 HIS A 52 ? ? -93.87 -64.96 77 20 GLU A 53 ? ? -149.80 -49.32 # _pdbx_nmr_ensemble.entry_id 7UV1 _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'all calculated structures submitted' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7UV1 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '50 uM DSS, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label '13C)15N' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details '90% PBS pH 7.4, 50 uM DSS reference standard' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component DSS _pdbx_nmr_exptl_sample.concentration 50 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units uM _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298.15 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.details ;146 mM NaCl (8g/L) 2.68 mM KCl (0.2g/L) 4.2 mM Na2HPO4.7H20 (1.15g/L) 1.47 mM KH2PO4 (0.2g/L) ; _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label PBS _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D HNCO' 2 isotropic 2 1 1 '3D HNCA' 2 isotropic 3 1 1 '3D HNCACB' 2 isotropic 4 1 1 '3D CBCA(CO)NH' 2 isotropic 5 1 1 '2D 1H-13C HSQC aliphatic' 2 isotropic 6 1 1 '2D 1H-13C HSQC aromatic' 2 isotropic 7 1 1 '3D C(CO)NH' 2 isotropic 8 1 1 '3D H(CCO)NH' 2 isotropic 9 1 1 '3D 1H-13C NOESY' 2 isotropic 10 1 1 '3D 1H-15N NOESY' 2 isotropic # _pdbx_nmr_refine.entry_id 7UV1 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 3 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' NMRViewJ ? 'Johnson, One Moon Scientific' 2 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 3 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 4 'peak picking' NMRViewJ ? 'Johnson, One Moon Scientific' 5 'structure calculation' TALOS ? 'Cornilescu, Delaglio and Bax' 6 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLN N N N N 71 GLN CA C N S 72 GLN C C N N 73 GLN O O N N 74 GLN CB C N N 75 GLN CG C N N 76 GLN CD C N N 77 GLN OE1 O N N 78 GLN NE2 N N N 79 GLN OXT O N N 80 GLN H H N N 81 GLN H2 H N N 82 GLN HA H N N 83 GLN HB2 H N N 84 GLN HB3 H N N 85 GLN HG2 H N N 86 GLN HG3 H N N 87 GLN HE21 H N N 88 GLN HE22 H N N 89 GLN HXT H N N 90 GLU N N N N 91 GLU CA C N S 92 GLU C C N N 93 GLU O O N N 94 GLU CB C N N 95 GLU CG C N N 96 GLU CD C N N 97 GLU OE1 O N N 98 GLU OE2 O N N 99 GLU OXT O N N 100 GLU H H N N 101 GLU H2 H N N 102 GLU HA H N N 103 GLU HB2 H N N 104 GLU HB3 H N N 105 GLU HG2 H N N 106 GLU HG3 H N N 107 GLU HE2 H N N 108 GLU HXT H N N 109 GLY N N N N 110 GLY CA C N N 111 GLY C C N N 112 GLY O O N N 113 GLY OXT O N N 114 GLY H H N N 115 GLY H2 H N N 116 GLY HA2 H N N 117 GLY HA3 H N N 118 GLY HXT H N N 119 HIS N N N N 120 HIS CA C N S 121 HIS C C N N 122 HIS O O N N 123 HIS CB C N N 124 HIS CG C Y N 125 HIS ND1 N Y N 126 HIS CD2 C Y N 127 HIS CE1 C Y N 128 HIS NE2 N Y N 129 HIS OXT O N N 130 HIS H H N N 131 HIS H2 H N N 132 HIS HA H N N 133 HIS HB2 H N N 134 HIS HB3 H N N 135 HIS HD1 H N N 136 HIS HD2 H N N 137 HIS HE1 H N N 138 HIS HE2 H N N 139 HIS HXT H N N 140 ILE N N N N 141 ILE CA C N S 142 ILE C C N N 143 ILE O O N N 144 ILE CB C N S 145 ILE CG1 C N N 146 ILE CG2 C N N 147 ILE CD1 C N N 148 ILE OXT O N N 149 ILE H H N N 150 ILE H2 H N N 151 ILE HA H N N 152 ILE HB H N N 153 ILE HG12 H N N 154 ILE HG13 H N N 155 ILE HG21 H N N 156 ILE HG22 H N N 157 ILE HG23 H N N 158 ILE HD11 H N N 159 ILE HD12 H N N 160 ILE HD13 H N N 161 ILE HXT H N N 162 LEU N N N N 163 LEU CA C N S 164 LEU C C N N 165 LEU O O N N 166 LEU CB C N N 167 LEU CG C N N 168 LEU CD1 C N N 169 LEU CD2 C N N 170 LEU OXT O N N 171 LEU H H N N 172 LEU H2 H N N 173 LEU HA H N N 174 LEU HB2 H N N 175 LEU HB3 H N N 176 LEU HG H N N 177 LEU HD11 H N N 178 LEU HD12 H N N 179 LEU HD13 H N N 180 LEU HD21 H N N 181 LEU HD22 H N N 182 LEU HD23 H N N 183 LEU HXT H N N 184 LYS N N N N 185 LYS CA C N S 186 LYS C C N N 187 LYS O O N N 188 LYS CB C N N 189 LYS CG C N N 190 LYS CD C N N 191 LYS CE C N N 192 LYS NZ N N N 193 LYS OXT O N N 194 LYS H H N N 195 LYS H2 H N N 196 LYS HA H N N 197 LYS HB2 H N N 198 LYS HB3 H N N 199 LYS HG2 H N N 200 LYS HG3 H N N 201 LYS HD2 H N N 202 LYS HD3 H N N 203 LYS HE2 H N N 204 LYS HE3 H N N 205 LYS HZ1 H N N 206 LYS HZ2 H N N 207 LYS HZ3 H N N 208 LYS HXT H N N 209 PHE N N N N 210 PHE CA C N S 211 PHE C C N N 212 PHE O O N N 213 PHE CB C N N 214 PHE CG C Y N 215 PHE CD1 C Y N 216 PHE CD2 C Y N 217 PHE CE1 C Y N 218 PHE CE2 C Y N 219 PHE CZ C Y N 220 PHE OXT O N N 221 PHE H H N N 222 PHE H2 H N N 223 PHE HA H N N 224 PHE HB2 H N N 225 PHE HB3 H N N 226 PHE HD1 H N N 227 PHE HD2 H N N 228 PHE HE1 H N N 229 PHE HE2 H N N 230 PHE HZ H N N 231 PHE HXT H N N 232 PRO N N N N 233 PRO CA C N S 234 PRO C C N N 235 PRO O O N N 236 PRO CB C N N 237 PRO CG C N N 238 PRO CD C N N 239 PRO OXT O N N 240 PRO H H N N 241 PRO HA H N N 242 PRO HB2 H N N 243 PRO HB3 H N N 244 PRO HG2 H N N 245 PRO HG3 H N N 246 PRO HD2 H N N 247 PRO HD3 H N N 248 PRO HXT H N N 249 TYR N N N N 250 TYR CA C N S 251 TYR C C N N 252 TYR O O N N 253 TYR CB C N N 254 TYR CG C Y N 255 TYR CD1 C Y N 256 TYR CD2 C Y N 257 TYR CE1 C Y N 258 TYR CE2 C Y N 259 TYR CZ C Y N 260 TYR OH O N N 261 TYR OXT O N N 262 TYR H H N N 263 TYR H2 H N N 264 TYR HA H N N 265 TYR HB2 H N N 266 TYR HB3 H N N 267 TYR HD1 H N N 268 TYR HD2 H N N 269 TYR HE1 H N N 270 TYR HE2 H N N 271 TYR HH H N N 272 TYR HXT H N N 273 VAL N N N N 274 VAL CA C N S 275 VAL C C N N 276 VAL O O N N 277 VAL CB C N N 278 VAL CG1 C N N 279 VAL CG2 C N N 280 VAL OXT O N N 281 VAL H H N N 282 VAL H2 H N N 283 VAL HA H N N 284 VAL HB H N N 285 VAL HG11 H N N 286 VAL HG12 H N N 287 VAL HG13 H N N 288 VAL HG21 H N N 289 VAL HG22 H N N 290 VAL HG23 H N N 291 VAL HXT H N N 292 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLU N CA sing N N 86 GLU N H sing N N 87 GLU N H2 sing N N 88 GLU CA C sing N N 89 GLU CA CB sing N N 90 GLU CA HA sing N N 91 GLU C O doub N N 92 GLU C OXT sing N N 93 GLU CB CG sing N N 94 GLU CB HB2 sing N N 95 GLU CB HB3 sing N N 96 GLU CG CD sing N N 97 GLU CG HG2 sing N N 98 GLU CG HG3 sing N N 99 GLU CD OE1 doub N N 100 GLU CD OE2 sing N N 101 GLU OE2 HE2 sing N N 102 GLU OXT HXT sing N N 103 GLY N CA sing N N 104 GLY N H sing N N 105 GLY N H2 sing N N 106 GLY CA C sing N N 107 GLY CA HA2 sing N N 108 GLY CA HA3 sing N N 109 GLY C O doub N N 110 GLY C OXT sing N N 111 GLY OXT HXT sing N N 112 HIS N CA sing N N 113 HIS N H sing N N 114 HIS N H2 sing N N 115 HIS CA C sing N N 116 HIS CA CB sing N N 117 HIS CA HA sing N N 118 HIS C O doub N N 119 HIS C OXT sing N N 120 HIS CB CG sing N N 121 HIS CB HB2 sing N N 122 HIS CB HB3 sing N N 123 HIS CG ND1 sing Y N 124 HIS CG CD2 doub Y N 125 HIS ND1 CE1 doub Y N 126 HIS ND1 HD1 sing N N 127 HIS CD2 NE2 sing Y N 128 HIS CD2 HD2 sing N N 129 HIS CE1 NE2 sing Y N 130 HIS CE1 HE1 sing N N 131 HIS NE2 HE2 sing N N 132 HIS OXT HXT sing N N 133 ILE N CA sing N N 134 ILE N H sing N N 135 ILE N H2 sing N N 136 ILE CA C sing N N 137 ILE CA CB sing N N 138 ILE CA HA sing N N 139 ILE C O doub N N 140 ILE C OXT sing N N 141 ILE CB CG1 sing N N 142 ILE CB CG2 sing N N 143 ILE CB HB sing N N 144 ILE CG1 CD1 sing N N 145 ILE CG1 HG12 sing N N 146 ILE CG1 HG13 sing N N 147 ILE CG2 HG21 sing N N 148 ILE CG2 HG22 sing N N 149 ILE CG2 HG23 sing N N 150 ILE CD1 HD11 sing N N 151 ILE CD1 HD12 sing N N 152 ILE CD1 HD13 sing N N 153 ILE OXT HXT sing N N 154 LEU N CA sing N N 155 LEU N H sing N N 156 LEU N H2 sing N N 157 LEU CA C sing N N 158 LEU CA CB sing N N 159 LEU CA HA sing N N 160 LEU C O doub N N 161 LEU C OXT sing N N 162 LEU CB CG sing N N 163 LEU CB HB2 sing N N 164 LEU CB HB3 sing N N 165 LEU CG CD1 sing N N 166 LEU CG CD2 sing N N 167 LEU CG HG sing N N 168 LEU CD1 HD11 sing N N 169 LEU CD1 HD12 sing N N 170 LEU CD1 HD13 sing N N 171 LEU CD2 HD21 sing N N 172 LEU CD2 HD22 sing N N 173 LEU CD2 HD23 sing N N 174 LEU OXT HXT sing N N 175 LYS N CA sing N N 176 LYS N H sing N N 177 LYS N H2 sing N N 178 LYS CA C sing N N 179 LYS CA CB sing N N 180 LYS CA HA sing N N 181 LYS C O doub N N 182 LYS C OXT sing N N 183 LYS CB CG sing N N 184 LYS CB HB2 sing N N 185 LYS CB HB3 sing N N 186 LYS CG CD sing N N 187 LYS CG HG2 sing N N 188 LYS CG HG3 sing N N 189 LYS CD CE sing N N 190 LYS CD HD2 sing N N 191 LYS CD HD3 sing N N 192 LYS CE NZ sing N N 193 LYS CE HE2 sing N N 194 LYS CE HE3 sing N N 195 LYS NZ HZ1 sing N N 196 LYS NZ HZ2 sing N N 197 LYS NZ HZ3 sing N N 198 LYS OXT HXT sing N N 199 PHE N CA sing N N 200 PHE N H sing N N 201 PHE N H2 sing N N 202 PHE CA C sing N N 203 PHE CA CB sing N N 204 PHE CA HA sing N N 205 PHE C O doub N N 206 PHE C OXT sing N N 207 PHE CB CG sing N N 208 PHE CB HB2 sing N N 209 PHE CB HB3 sing N N 210 PHE CG CD1 doub Y N 211 PHE CG CD2 sing Y N 212 PHE CD1 CE1 sing Y N 213 PHE CD1 HD1 sing N N 214 PHE CD2 CE2 doub Y N 215 PHE CD2 HD2 sing N N 216 PHE CE1 CZ doub Y N 217 PHE CE1 HE1 sing N N 218 PHE CE2 CZ sing Y N 219 PHE CE2 HE2 sing N N 220 PHE CZ HZ sing N N 221 PHE OXT HXT sing N N 222 PRO N CA sing N N 223 PRO N CD sing N N 224 PRO N H sing N N 225 PRO CA C sing N N 226 PRO CA CB sing N N 227 PRO CA HA sing N N 228 PRO C O doub N N 229 PRO C OXT sing N N 230 PRO CB CG sing N N 231 PRO CB HB2 sing N N 232 PRO CB HB3 sing N N 233 PRO CG CD sing N N 234 PRO CG HG2 sing N N 235 PRO CG HG3 sing N N 236 PRO CD HD2 sing N N 237 PRO CD HD3 sing N N 238 PRO OXT HXT sing N N 239 TYR N CA sing N N 240 TYR N H sing N N 241 TYR N H2 sing N N 242 TYR CA C sing N N 243 TYR CA CB sing N N 244 TYR CA HA sing N N 245 TYR C O doub N N 246 TYR C OXT sing N N 247 TYR CB CG sing N N 248 TYR CB HB2 sing N N 249 TYR CB HB3 sing N N 250 TYR CG CD1 doub Y N 251 TYR CG CD2 sing Y N 252 TYR CD1 CE1 sing Y N 253 TYR CD1 HD1 sing N N 254 TYR CD2 CE2 doub Y N 255 TYR CD2 HD2 sing N N 256 TYR CE1 CZ doub Y N 257 TYR CE1 HE1 sing N N 258 TYR CE2 CZ sing Y N 259 TYR CE2 HE2 sing N N 260 TYR CZ OH sing N N 261 TYR OH HH sing N N 262 TYR OXT HXT sing N N 263 VAL N CA sing N N 264 VAL N H sing N N 265 VAL N H2 sing N N 266 VAL CA C sing N N 267 VAL CA CB sing N N 268 VAL CA HA sing N N 269 VAL C O doub N N 270 VAL C OXT sing N N 271 VAL CB CG1 sing N N 272 VAL CB CG2 sing N N 273 VAL CB HB sing N N 274 VAL CG1 HG11 sing N N 275 VAL CG1 HG12 sing N N 276 VAL CG1 HG13 sing N N 277 VAL CG2 HG21 sing N N 278 VAL CG2 HG22 sing N N 279 VAL CG2 HG23 sing N N 280 VAL OXT HXT sing N N 281 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of Environmental Health Sciences (NIH/NIEHS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number Z01-ES102906 _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 2 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 7UV1 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_