data_7UV2 # _entry.id 7UV2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.368 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7UV2 pdb_00007uv2 10.2210/pdb7uv2/pdb WWPDB D_1000264927 ? ? BMRB 31014 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Ana o 1 Leader Sequence Residues 82-132' _pdbx_database_related.db_id 31014 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7UV2 _pdbx_database_status.recvd_initial_deposition_date 2022-04-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Mueller, G.A.' 1 0000-0001-8361-5323 'Foo, A.C.Y.' 2 0000-0002-4331-2085 'DeRose, E.F.' 3 0000-0003-0112-1296 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J.Agric.Food Chem.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5118 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 71 _citation.language ? _citation.page_first 2990 _citation.page_last 2998 _citation.title 'Structure and IgE Cross-Reactivity among Cashew, Pistachio, Walnut, and Peanut Vicilin-Buried Peptides.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jafc.2c07061 _citation.pdbx_database_id_PubMed 36728846 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Foo, A.C.Y.' 1 ? primary 'Nesbit, J.B.' 2 ? primary 'Gipson, S.A.Y.' 3 0000-0001-5173-3309 primary 'DeRose, E.F.' 4 0000-0003-0112-1296 primary 'Cheng, H.' 5 ? primary 'Hurlburt, B.K.' 6 0000-0001-5863-9542 primary 'Kulis, M.D.' 7 ? primary 'Kim, E.H.' 8 ? primary 'Dreskin, S.C.' 9 ? primary 'Mustafa, S.' 10 ? primary 'Maleki, S.J.' 11 0000-0002-6056-9958 primary 'Mueller, G.A.' 12 0000-0001-8361-5323 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Vicilin-like protein' _entity.formula_weight 6807.526 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GVDEPSTHEPAEKHLSQCMRQCERQEGGQQKQLCRFRCQERYKKERGQHNYKREDD _entity_poly.pdbx_seq_one_letter_code_can GVDEPSTHEPAEKHLSQCMRQCERQEGGQQKQLCRFRCQERYKKERGQHNYKREDD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 VAL n 1 3 ASP n 1 4 GLU n 1 5 PRO n 1 6 SER n 1 7 THR n 1 8 HIS n 1 9 GLU n 1 10 PRO n 1 11 ALA n 1 12 GLU n 1 13 LYS n 1 14 HIS n 1 15 LEU n 1 16 SER n 1 17 GLN n 1 18 CYS n 1 19 MET n 1 20 ARG n 1 21 GLN n 1 22 CYS n 1 23 GLU n 1 24 ARG n 1 25 GLN n 1 26 GLU n 1 27 GLY n 1 28 GLY n 1 29 GLN n 1 30 GLN n 1 31 LYS n 1 32 GLN n 1 33 LEU n 1 34 CYS n 1 35 ARG n 1 36 PHE n 1 37 ARG n 1 38 CYS n 1 39 GLN n 1 40 GLU n 1 41 ARG n 1 42 TYR n 1 43 LYS n 1 44 LYS n 1 45 GLU n 1 46 ARG n 1 47 GLY n 1 48 GLN n 1 49 HIS n 1 50 ASN n 1 51 TYR n 1 52 LYS n 1 53 ARG n 1 54 GLU n 1 55 ASP n 1 56 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 56 _entity_src_gen.gene_src_common_name cashew _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Ana o 1.0101' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Anacardium occidentale' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 171929 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8L5L5_ANAOC _struct_ref.pdbx_db_accession Q8L5L5 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GVDEPSTHEPAEKHLSQCMRQCERQEGGQQKQLCRFRCQERYKKERGQHNYKREDD _struct_ref.pdbx_align_begin 82 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7UV2 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 56 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8L5L5 _struct_ref_seq.db_align_beg 82 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 137 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 56 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D HNCO' 2 isotropic 2 1 1 '3D HNCACB' 2 isotropic 3 1 1 '3D CBCA(CO)NH' 2 isotropic 4 1 1 '3D C(CO)NH' 2 isotropic 5 1 1 '3D H(CCO)NH' 2 isotropic 7 1 1 '2D 1H-13C HSQC' 2 isotropic 6 1 1 '3D 1H-13C NOESY' 2 isotropic 8 1 1 '3D 1H-15N NOESY' 2 isotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298.15 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.details ;146 mM NaCl (8g/L) 2.68 mM KCl (0.2g/L) 4.2 mM Na2HPO4.7H20 (1.15g/L) 1.47 mM KH2PO4 (0.2g/L) ; _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label PBS _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '50 uM DSS, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label '13C 15N Ao1.2' _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details '90% PBS pH 7.4, 50 uM DSS reference standard' # _pdbx_nmr_spectrometer.spectrometer_id 2 _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 7UV2 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 3 # _pdbx_nmr_ensemble.entry_id 7UV2 _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'all calculated structures submitted' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7UV2 _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' NMRViewJ ? 'Johnson, One Moon Scientific' 2 'structure calculation' 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 3 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 4 'peak picking' NMRViewJ ? 'Johnson, One Moon Scientific' 5 'structure calculation' TALOS ? 'Cornilescu, Delaglio and Bax' 6 'structure calculation' CYANA ? 'Guntert, Mumenthaler and Wuthrich' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7UV2 _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7UV2 _struct.title 'Ana o 1 Leader Sequence Residues 82-132' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7UV2 _struct_keywords.text 'Seed storage, ALLERGEN' _struct_keywords.pdbx_keywords ALLERGEN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 10 ? GLN A 25 ? PRO A 10 GLN A 25 1 ? 16 HELX_P HELX_P2 AA2 GLY A 28 ? ARG A 46 ? GLY A 28 ARG A 46 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 18 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 18 A CYS 38 1_555 ? ? ? ? ? ? ? 2.007 ? ? disulf2 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 22 A CYS 34 1_555 ? ? ? ? ? ? ? 2.014 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 7UV2 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 HIS 8 8 8 HIS HIS A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 MET 19 19 19 MET MET A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 GLN 25 25 25 GLN GLN A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 GLN 30 30 30 GLN GLN A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 PHE 36 36 36 PHE PHE A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 GLN 48 48 48 GLN GLN A . n A 1 49 HIS 49 49 49 HIS HIS A . n A 1 50 ASN 50 50 50 ASN ASN A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 ARG 53 53 53 ARG ARG A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ASP 56 56 56 ASP ASP A . n # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 Mueller3@niehs.nih.gov Geoffrey Mueller ? 'principal investigator/group leader' 0000-0001-8361-5323 3 derose@niehs.nih.gov Eugene DeRose ? 'principal investigator/group leader' 0000-0003-0112-1296 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-04-05 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component DSS _pdbx_nmr_exptl_sample.concentration 50 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units uM _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 2 ? ? 47.98 24.77 2 1 HIS A 8 ? ? 63.70 62.38 3 2 TYR A 51 ? ? 77.39 88.02 4 3 THR A 7 ? ? -146.30 -47.85 5 3 GLU A 26 ? ? 62.93 -177.31 6 3 HIS A 49 ? ? -143.88 -33.78 7 3 GLU A 54 ? ? 61.65 111.79 8 4 SER A 6 ? ? 60.18 163.76 9 4 TYR A 51 ? ? 64.66 79.98 10 4 ARG A 53 ? ? 55.83 105.47 11 6 SER A 6 ? ? -129.30 -54.76 12 6 HIS A 8 ? ? 54.34 100.07 13 6 HIS A 49 ? ? -131.48 -33.94 14 7 GLU A 26 ? ? 63.38 -166.81 15 7 HIS A 49 ? ? -152.53 83.47 16 8 CYS A 18 ? ? -62.08 -70.65 17 8 GLU A 54 ? ? -60.02 -162.36 18 9 THR A 7 ? ? -133.99 -43.92 19 10 THR A 7 ? ? -162.14 -60.71 20 10 ASN A 50 ? ? -69.84 -88.91 21 10 TYR A 51 ? ? 46.00 -169.96 22 11 SER A 6 ? ? -126.16 -70.90 23 11 THR A 7 ? ? 51.31 18.02 24 11 CYS A 18 ? ? -70.98 -70.46 25 11 HIS A 49 ? ? -139.34 -67.55 26 11 ASN A 50 ? ? -174.12 113.52 27 12 CYS A 18 ? ? -52.21 -70.24 28 13 VAL A 2 ? ? 49.77 23.33 29 14 ARG A 53 ? ? 45.46 21.92 30 14 GLU A 54 ? ? 49.40 -177.61 31 15 SER A 6 ? ? 65.45 173.02 32 15 ARG A 53 ? ? 49.86 -172.87 33 16 THR A 7 ? ? -148.24 -45.04 34 16 GLU A 54 ? ? -122.37 -56.80 35 17 TYR A 51 ? ? 40.86 94.36 36 17 LYS A 52 ? ? -146.87 -49.84 37 17 ASP A 55 ? ? -140.99 -0.69 38 18 ASP A 3 ? ? -48.74 166.90 39 18 GLU A 26 ? ? 61.93 -169.90 40 18 HIS A 49 ? ? -154.84 28.31 41 18 ARG A 53 ? ? 61.89 -86.87 42 19 GLU A 4 ? ? 83.77 140.12 43 19 TYR A 51 ? ? -138.02 -85.65 44 20 GLU A 4 ? ? -117.61 68.74 45 20 CYS A 18 ? ? -46.98 -70.73 46 20 GLU A 54 ? ? 62.34 -131.09 47 20 ASP A 55 ? ? -175.34 -25.75 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of Environmental Health Sciences (NIH/NIEHS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number Z01-ES102906 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #