data_7VBW # _entry.id 7VBW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7VBW pdb_00007vbw 10.2210/pdb7vbw/pdb WWPDB D_1300024448 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7VBW _pdbx_database_status.recvd_initial_deposition_date 2021-09-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yan, X.F.' 1 0000-0001-6248-2349 'Yong, Y.' 2 0000-0001-8567-9291 'Gao, Y.G.' 3 0000-0001-7298-0835 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country NE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Febs Lett.' _citation.journal_id_ASTM FEBLAL _citation.journal_id_CSD 0165 _citation.journal_id_ISSN 0014-5793 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 596 _citation.language ? _citation.page_first 71 _citation.page_last 80 _citation.title ;Structural analyses of the AAA+ ATPase domain of the transcriptional regulator GtrR in the BDSF quorum-sensing system in Burkholderia cenocepacia. ; _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/1873-3468.14244 _citation.pdbx_database_id_PubMed 34837384 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yan, X.F.' 1 ? primary 'Yang, C.' 2 ? primary 'Wang, M.' 3 ? primary 'Yong, Y.' 4 ? primary 'Deng, Y.' 5 ? primary 'Gao, Y.G.' 6 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7VBW _cell.details ? _cell.formula_units_Z ? _cell.length_a 107.574 _cell.length_a_esd ? _cell.length_b 107.574 _cell.length_b_esd ? _cell.length_c 40.436 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7VBW _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Sigma-54 dependent trancsriptional regulator' 51747.684 1 ? ? ? ? 2 non-polymer syn "GUANOSINE-5'-TRIPHOSPHATE" 523.180 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 4 water nat water 18.015 71 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Sigma-54-dependent Fis family transcriptional regulator' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GHMRNTPAIEELDLYVWEGKADIVDRVARCMASFDVEVIRADNAAVSPERAALRRSLAIISVTMIEGGAAFLRDWQANIG MPVVWVGAARDHDASQYPPEYSHILPLDFTCAELRGMIGKLVTQLRAHAAETLQPSELVAHSESMQALLHEVDTFADCDT NVLLHGETGVGKERIAQLLHEKHSRYRHGEFVPVNCGAIPDGLFESLFFGHAKGSFTGAVVAHKGYFEQAAGGTLFLDEV GDLPLYQQVKLLRVLEDGAVLRVGATAPVKVDFRLVAASNKKLPQLVKEGLFRADLYYRLAVIELSIPSLEERGAVDKIA LFKSFVAQVVGEERLAELSDLPYWLTDSVADSYFPGNVRELRNLAERVGVTVRQTGGWDAARLQRLIAHARSAAQPVPAE SAAEVFVDRSKWDMNERNRVIAALDANGWRRQDTAQQLGISRKVLWEKMRKYQIFDEEPETRESE ; _entity_poly.pdbx_seq_one_letter_code_can ;GHMRNTPAIEELDLYVWEGKADIVDRVARCMASFDVEVIRADNAAVSPERAALRRSLAIISVTMIEGGAAFLRDWQANIG MPVVWVGAARDHDASQYPPEYSHILPLDFTCAELRGMIGKLVTQLRAHAAETLQPSELVAHSESMQALLHEVDTFADCDT NVLLHGETGVGKERIAQLLHEKHSRYRHGEFVPVNCGAIPDGLFESLFFGHAKGSFTGAVVAHKGYFEQAAGGTLFLDEV GDLPLYQQVKLLRVLEDGAVLRVGATAPVKVDFRLVAASNKKLPQLVKEGLFRADLYYRLAVIELSIPSLEERGAVDKIA LFKSFVAQVVGEERLAELSDLPYWLTDSVADSYFPGNVRELRNLAERVGVTVRQTGGWDAARLQRLIAHARSAAQPVPAE SAAEVFVDRSKWDMNERNRVIAALDANGWRRQDTAQQLGISRKVLWEKMRKYQIFDEEPETRESE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 ARG n 1 5 ASN n 1 6 THR n 1 7 PRO n 1 8 ALA n 1 9 ILE n 1 10 GLU n 1 11 GLU n 1 12 LEU n 1 13 ASP n 1 14 LEU n 1 15 TYR n 1 16 VAL n 1 17 TRP n 1 18 GLU n 1 19 GLY n 1 20 LYS n 1 21 ALA n 1 22 ASP n 1 23 ILE n 1 24 VAL n 1 25 ASP n 1 26 ARG n 1 27 VAL n 1 28 ALA n 1 29 ARG n 1 30 CYS n 1 31 MET n 1 32 ALA n 1 33 SER n 1 34 PHE n 1 35 ASP n 1 36 VAL n 1 37 GLU n 1 38 VAL n 1 39 ILE n 1 40 ARG n 1 41 ALA n 1 42 ASP n 1 43 ASN n 1 44 ALA n 1 45 ALA n 1 46 VAL n 1 47 SER n 1 48 PRO n 1 49 GLU n 1 50 ARG n 1 51 ALA n 1 52 ALA n 1 53 LEU n 1 54 ARG n 1 55 ARG n 1 56 SER n 1 57 LEU n 1 58 ALA n 1 59 ILE n 1 60 ILE n 1 61 SER n 1 62 VAL n 1 63 THR n 1 64 MET n 1 65 ILE n 1 66 GLU n 1 67 GLY n 1 68 GLY n 1 69 ALA n 1 70 ALA n 1 71 PHE n 1 72 LEU n 1 73 ARG n 1 74 ASP n 1 75 TRP n 1 76 GLN n 1 77 ALA n 1 78 ASN n 1 79 ILE n 1 80 GLY n 1 81 MET n 1 82 PRO n 1 83 VAL n 1 84 VAL n 1 85 TRP n 1 86 VAL n 1 87 GLY n 1 88 ALA n 1 89 ALA n 1 90 ARG n 1 91 ASP n 1 92 HIS n 1 93 ASP n 1 94 ALA n 1 95 SER n 1 96 GLN n 1 97 TYR n 1 98 PRO n 1 99 PRO n 1 100 GLU n 1 101 TYR n 1 102 SER n 1 103 HIS n 1 104 ILE n 1 105 LEU n 1 106 PRO n 1 107 LEU n 1 108 ASP n 1 109 PHE n 1 110 THR n 1 111 CYS n 1 112 ALA n 1 113 GLU n 1 114 LEU n 1 115 ARG n 1 116 GLY n 1 117 MET n 1 118 ILE n 1 119 GLY n 1 120 LYS n 1 121 LEU n 1 122 VAL n 1 123 THR n 1 124 GLN n 1 125 LEU n 1 126 ARG n 1 127 ALA n 1 128 HIS n 1 129 ALA n 1 130 ALA n 1 131 GLU n 1 132 THR n 1 133 LEU n 1 134 GLN n 1 135 PRO n 1 136 SER n 1 137 GLU n 1 138 LEU n 1 139 VAL n 1 140 ALA n 1 141 HIS n 1 142 SER n 1 143 GLU n 1 144 SER n 1 145 MET n 1 146 GLN n 1 147 ALA n 1 148 LEU n 1 149 LEU n 1 150 HIS n 1 151 GLU n 1 152 VAL n 1 153 ASP n 1 154 THR n 1 155 PHE n 1 156 ALA n 1 157 ASP n 1 158 CYS n 1 159 ASP n 1 160 THR n 1 161 ASN n 1 162 VAL n 1 163 LEU n 1 164 LEU n 1 165 HIS n 1 166 GLY n 1 167 GLU n 1 168 THR n 1 169 GLY n 1 170 VAL n 1 171 GLY n 1 172 LYS n 1 173 GLU n 1 174 ARG n 1 175 ILE n 1 176 ALA n 1 177 GLN n 1 178 LEU n 1 179 LEU n 1 180 HIS n 1 181 GLU n 1 182 LYS n 1 183 HIS n 1 184 SER n 1 185 ARG n 1 186 TYR n 1 187 ARG n 1 188 HIS n 1 189 GLY n 1 190 GLU n 1 191 PHE n 1 192 VAL n 1 193 PRO n 1 194 VAL n 1 195 ASN n 1 196 CYS n 1 197 GLY n 1 198 ALA n 1 199 ILE n 1 200 PRO n 1 201 ASP n 1 202 GLY n 1 203 LEU n 1 204 PHE n 1 205 GLU n 1 206 SER n 1 207 LEU n 1 208 PHE n 1 209 PHE n 1 210 GLY n 1 211 HIS n 1 212 ALA n 1 213 LYS n 1 214 GLY n 1 215 SER n 1 216 PHE n 1 217 THR n 1 218 GLY n 1 219 ALA n 1 220 VAL n 1 221 VAL n 1 222 ALA n 1 223 HIS n 1 224 LYS n 1 225 GLY n 1 226 TYR n 1 227 PHE n 1 228 GLU n 1 229 GLN n 1 230 ALA n 1 231 ALA n 1 232 GLY n 1 233 GLY n 1 234 THR n 1 235 LEU n 1 236 PHE n 1 237 LEU n 1 238 ASP n 1 239 GLU n 1 240 VAL n 1 241 GLY n 1 242 ASP n 1 243 LEU n 1 244 PRO n 1 245 LEU n 1 246 TYR n 1 247 GLN n 1 248 GLN n 1 249 VAL n 1 250 LYS n 1 251 LEU n 1 252 LEU n 1 253 ARG n 1 254 VAL n 1 255 LEU n 1 256 GLU n 1 257 ASP n 1 258 GLY n 1 259 ALA n 1 260 VAL n 1 261 LEU n 1 262 ARG n 1 263 VAL n 1 264 GLY n 1 265 ALA n 1 266 THR n 1 267 ALA n 1 268 PRO n 1 269 VAL n 1 270 LYS n 1 271 VAL n 1 272 ASP n 1 273 PHE n 1 274 ARG n 1 275 LEU n 1 276 VAL n 1 277 ALA n 1 278 ALA n 1 279 SER n 1 280 ASN n 1 281 LYS n 1 282 LYS n 1 283 LEU n 1 284 PRO n 1 285 GLN n 1 286 LEU n 1 287 VAL n 1 288 LYS n 1 289 GLU n 1 290 GLY n 1 291 LEU n 1 292 PHE n 1 293 ARG n 1 294 ALA n 1 295 ASP n 1 296 LEU n 1 297 TYR n 1 298 TYR n 1 299 ARG n 1 300 LEU n 1 301 ALA n 1 302 VAL n 1 303 ILE n 1 304 GLU n 1 305 LEU n 1 306 SER n 1 307 ILE n 1 308 PRO n 1 309 SER n 1 310 LEU n 1 311 GLU n 1 312 GLU n 1 313 ARG n 1 314 GLY n 1 315 ALA n 1 316 VAL n 1 317 ASP n 1 318 LYS n 1 319 ILE n 1 320 ALA n 1 321 LEU n 1 322 PHE n 1 323 LYS n 1 324 SER n 1 325 PHE n 1 326 VAL n 1 327 ALA n 1 328 GLN n 1 329 VAL n 1 330 VAL n 1 331 GLY n 1 332 GLU n 1 333 GLU n 1 334 ARG n 1 335 LEU n 1 336 ALA n 1 337 GLU n 1 338 LEU n 1 339 SER n 1 340 ASP n 1 341 LEU n 1 342 PRO n 1 343 TYR n 1 344 TRP n 1 345 LEU n 1 346 THR n 1 347 ASP n 1 348 SER n 1 349 VAL n 1 350 ALA n 1 351 ASP n 1 352 SER n 1 353 TYR n 1 354 PHE n 1 355 PRO n 1 356 GLY n 1 357 ASN n 1 358 VAL n 1 359 ARG n 1 360 GLU n 1 361 LEU n 1 362 ARG n 1 363 ASN n 1 364 LEU n 1 365 ALA n 1 366 GLU n 1 367 ARG n 1 368 VAL n 1 369 GLY n 1 370 VAL n 1 371 THR n 1 372 VAL n 1 373 ARG n 1 374 GLN n 1 375 THR n 1 376 GLY n 1 377 GLY n 1 378 TRP n 1 379 ASP n 1 380 ALA n 1 381 ALA n 1 382 ARG n 1 383 LEU n 1 384 GLN n 1 385 ARG n 1 386 LEU n 1 387 ILE n 1 388 ALA n 1 389 HIS n 1 390 ALA n 1 391 ARG n 1 392 SER n 1 393 ALA n 1 394 ALA n 1 395 GLN n 1 396 PRO n 1 397 VAL n 1 398 PRO n 1 399 ALA n 1 400 GLU n 1 401 SER n 1 402 ALA n 1 403 ALA n 1 404 GLU n 1 405 VAL n 1 406 PHE n 1 407 VAL n 1 408 ASP n 1 409 ARG n 1 410 SER n 1 411 LYS n 1 412 TRP n 1 413 ASP n 1 414 MET n 1 415 ASN n 1 416 GLU n 1 417 ARG n 1 418 ASN n 1 419 ARG n 1 420 VAL n 1 421 ILE n 1 422 ALA n 1 423 ALA n 1 424 LEU n 1 425 ASP n 1 426 ALA n 1 427 ASN n 1 428 GLY n 1 429 TRP n 1 430 ARG n 1 431 ARG n 1 432 GLN n 1 433 ASP n 1 434 THR n 1 435 ALA n 1 436 GLN n 1 437 GLN n 1 438 LEU n 1 439 GLY n 1 440 ILE n 1 441 SER n 1 442 ARG n 1 443 LYS n 1 444 VAL n 1 445 LEU n 1 446 TRP n 1 447 GLU n 1 448 LYS n 1 449 MET n 1 450 ARG n 1 451 LYS n 1 452 TYR n 1 453 GLN n 1 454 ILE n 1 455 PHE n 1 456 ASP n 1 457 GLU n 1 458 GLU n 1 459 PRO n 1 460 GLU n 1 461 THR n 1 462 ARG n 1 463 GLU n 1 464 SER n 1 465 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 465 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ntrC_2, A3203_18285, A8E72_13470, NCTC13227_05325' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Burkholderia cenocepacia' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 95486 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A1V2W4X9_9BURK _struct_ref.pdbx_db_accession A0A1V2W4X9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MRNTPAIEELDLYVWEGKADIVDRVARCMASFDVEVIRADNAAVSPERAALRRSLAIISVTMIEGGAAFLRDWQANIGMP VVWVGAARDHDASQYPPEYSHILPLDFTCAELRGMIGKLVTQLRAHAAETLQPSELVAHSESMQALLHEVDTFADCDTNV LLHGETGVGKERIAQLLHEKHSRYRHGEFVPVNCGAIPDGLFESLFFGHAKGSFTGAVVAHKGYFEQAAGGTLFLDEVGD LPLYQQVKLLRVLEDGAVLRVGATAPVKVDFRLVAASNKKLPQLVKEGLFRADLYYRLAVIELSIPSLEERGAVDKIALF KSFVAQVVGEERLAELSDLPYWLTDSVADSYFPGNVRELRNLAERVGVTVRQTGGWDAARLQRLIAHARSAAQPVPAESA AEVFVDRSKWDMNERNRVIAALDANGWRRQDTAQQLGISRKVLWEKMRKYQIFDEEPETRESE ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7VBW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 465 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A1V2W4X9 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 463 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 463 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7VBW GLY A 1 ? UNP A0A1V2W4X9 ? ? 'expression tag' -1 1 1 7VBW HIS A 2 ? UNP A0A1V2W4X9 ? ? 'expression tag' 0 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GTP non-polymer n "GUANOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O14 P3' 523.180 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7VBW _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.31 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 6.12 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '11% (w/v) Polyethylene glycol 6000, 100 mM Tris-HCl pH 8.1' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-05-20 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9537 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9537 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX2 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7VBW _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.5 _reflns.d_resolution_low 46.580 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9456 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.88 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 13.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.90 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.5 _reflns_shell.d_res_low 2.59 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 917 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.546 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 81.580 _refine.B_iso_mean 41.0673 _refine.B_iso_min 20.450 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7VBW _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5000 _refine.ls_d_res_low 46.5800 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9449 _refine.ls_number_reflns_R_free 946 _refine.ls_number_reflns_R_work 8503 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9200 _refine.ls_percent_reflns_R_free 10.0100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1977 _refine.ls_R_factor_R_free 0.2379 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1933 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.370 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7VBS _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 25.8900 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.5000 _refine_hist.d_res_low 46.5800 _refine_hist.number_atoms_solvent 71 _refine_hist.number_atoms_total 1937 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 238 _refine_hist.pdbx_B_iso_mean_ligand 61.14 _refine_hist.pdbx_B_iso_mean_solvent 40.00 _refine_hist.pdbx_number_atoms_protein 1833 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 33 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.5000 2.6300 1317 . 132 1185 100.0000 . . . 0.3660 0.0000 0.3216 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.6300 2.8000 1335 . 133 1202 100.0000 . . . 0.3006 0.0000 0.2669 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 2.8000 3.0100 1337 . 134 1203 100.0000 . . . 0.2798 0.0000 0.2357 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 3.0100 3.3200 1346 . 135 1211 100.0000 . . . 0.2790 0.0000 0.2193 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 3.3200 3.7900 1343 . 134 1209 100.0000 . . . 0.2170 0.0000 0.1855 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 3.8000 4.7800 1368 . 137 1231 100.0000 . . . 0.2026 0.0000 0.1503 . . . . . . . 7 . . . 'X-RAY DIFFRACTION' 4.7900 46.5800 1403 . 141 1262 100.0000 . . . 0.2129 0.0000 0.1709 . . . . . . . 7 . . . # _struct.entry_id 7VBW _struct.title 'Structure of the GTP-bound AAA+ ATPase domain of the transcriptional regulator GtrR in Burkholderia cenocepacia' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7VBW _struct_keywords.text 'Bacterial enhancer-binding protein, AAA+ ATPase, Quorum sensing, Transcriptional regulator, TRANSCRIPTION' _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 142 ? ALA A 156 ? SER A 140 ALA A 154 1 ? 15 HELX_P HELX_P2 AA2 GLY A 171 ? HIS A 183 ? GLY A 169 HIS A 181 1 ? 13 HELX_P HELX_P3 AA3 ARG A 185 ? GLY A 189 ? ARG A 183 GLY A 187 5 ? 5 HELX_P HELX_P4 AA4 GLY A 197 ? ILE A 199 ? GLY A 195 ILE A 197 5 ? 3 HELX_P HELX_P5 AA5 PRO A 200 ? GLY A 210 ? PRO A 198 GLY A 208 1 ? 11 HELX_P HELX_P6 AA6 GLY A 225 ? ALA A 230 ? GLY A 223 ALA A 228 1 ? 6 HELX_P HELX_P7 AA7 VAL A 240 ? LEU A 243 ? VAL A 238 LEU A 241 5 ? 4 HELX_P HELX_P8 AA8 PRO A 244 ? GLY A 258 ? PRO A 242 GLY A 256 1 ? 15 HELX_P HELX_P9 AA9 LYS A 282 ? GLU A 289 ? LYS A 280 GLU A 287 1 ? 8 HELX_P HELX_P10 AB1 ARG A 293 ? ALA A 301 ? ARG A 291 ALA A 299 1 ? 9 HELX_P HELX_P11 AB2 SER A 309 ? GLY A 314 ? SER A 307 GLY A 312 1 ? 6 HELX_P HELX_P12 AB3 GLY A 314 ? GLY A 331 ? GLY A 312 GLY A 329 1 ? 18 HELX_P HELX_P13 AB4 GLY A 331 ? GLU A 337 ? GLY A 329 GLU A 335 1 ? 7 HELX_P HELX_P14 AB5 PRO A 342 ? ASP A 351 ? PRO A 340 ASP A 349 1 ? 10 HELX_P HELX_P15 AB6 GLY A 356 ? GLY A 376 ? GLY A 354 GLY A 374 1 ? 21 HELX_P HELX_P16 AB7 ASP A 379 ? ILE A 387 ? ASP A 377 ILE A 385 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 238 OD2 ? ? ? 1_555 C MG . MG ? ? A ASP 236 A MG 502 1_555 ? ? ? ? ? ? ? 2.719 ? ? metalc2 metalc ? ? B GTP . O3G ? ? ? 1_555 C MG . MG ? ? A GTP 501 A MG 502 1_555 ? ? ? ? ? ? ? 2.929 ? ? metalc3 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 502 A HOH 616 1_555 ? ? ? ? ? ? ? 2.840 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 191 ? ASN A 195 ? PHE A 189 ASN A 193 AA1 2 THR A 234 ? ASP A 238 ? THR A 232 ASP A 236 AA1 3 ARG A 274 ? SER A 279 ? ARG A 272 SER A 277 AA1 4 VAL A 162 ? HIS A 165 ? VAL A 160 HIS A 163 AA1 5 ILE A 303 ? SER A 306 ? ILE A 301 SER A 304 AA2 1 ALA A 259 ? VAL A 260 ? ALA A 257 VAL A 258 AA2 2 VAL A 269 ? LYS A 270 ? VAL A 267 LYS A 268 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 192 ? N VAL A 190 O PHE A 236 ? O PHE A 234 AA1 2 3 N LEU A 235 ? N LEU A 233 O ARG A 274 ? O ARG A 272 AA1 3 4 O ALA A 277 ? O ALA A 275 N VAL A 162 ? N VAL A 160 AA1 4 5 N LEU A 163 ? N LEU A 161 O ILE A 303 ? O ILE A 301 AA2 1 2 N VAL A 260 ? N VAL A 258 O VAL A 269 ? O VAL A 267 # _atom_sites.entry_id 7VBW _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.009296 _atom_sites.fract_transf_matrix[1][2] 0.005367 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010734 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.024730 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C MG N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 HIS 2 0 ? ? ? A . n A 1 3 MET 3 1 ? ? ? A . n A 1 4 ARG 4 2 ? ? ? A . n A 1 5 ASN 5 3 ? ? ? A . n A 1 6 THR 6 4 ? ? ? A . n A 1 7 PRO 7 5 ? ? ? A . n A 1 8 ALA 8 6 ? ? ? A . n A 1 9 ILE 9 7 ? ? ? A . n A 1 10 GLU 10 8 ? ? ? A . n A 1 11 GLU 11 9 ? ? ? A . n A 1 12 LEU 12 10 ? ? ? A . n A 1 13 ASP 13 11 ? ? ? A . n A 1 14 LEU 14 12 ? ? ? A . n A 1 15 TYR 15 13 ? ? ? A . n A 1 16 VAL 16 14 ? ? ? A . n A 1 17 TRP 17 15 ? ? ? A . n A 1 18 GLU 18 16 ? ? ? A . n A 1 19 GLY 19 17 ? ? ? A . n A 1 20 LYS 20 18 ? ? ? A . n A 1 21 ALA 21 19 ? ? ? A . n A 1 22 ASP 22 20 ? ? ? A . n A 1 23 ILE 23 21 ? ? ? A . n A 1 24 VAL 24 22 ? ? ? A . n A 1 25 ASP 25 23 ? ? ? A . n A 1 26 ARG 26 24 ? ? ? A . n A 1 27 VAL 27 25 ? ? ? A . n A 1 28 ALA 28 26 ? ? ? A . n A 1 29 ARG 29 27 ? ? ? A . n A 1 30 CYS 30 28 ? ? ? A . n A 1 31 MET 31 29 ? ? ? A . n A 1 32 ALA 32 30 ? ? ? A . n A 1 33 SER 33 31 ? ? ? A . n A 1 34 PHE 34 32 ? ? ? A . n A 1 35 ASP 35 33 ? ? ? A . n A 1 36 VAL 36 34 ? ? ? A . n A 1 37 GLU 37 35 ? ? ? A . n A 1 38 VAL 38 36 ? ? ? A . n A 1 39 ILE 39 37 ? ? ? A . n A 1 40 ARG 40 38 ? ? ? A . n A 1 41 ALA 41 39 ? ? ? A . n A 1 42 ASP 42 40 ? ? ? A . n A 1 43 ASN 43 41 ? ? ? A . n A 1 44 ALA 44 42 ? ? ? A . n A 1 45 ALA 45 43 ? ? ? A . n A 1 46 VAL 46 44 ? ? ? A . n A 1 47 SER 47 45 ? ? ? A . n A 1 48 PRO 48 46 ? ? ? A . n A 1 49 GLU 49 47 ? ? ? A . n A 1 50 ARG 50 48 ? ? ? A . n A 1 51 ALA 51 49 ? ? ? A . n A 1 52 ALA 52 50 ? ? ? A . n A 1 53 LEU 53 51 ? ? ? A . n A 1 54 ARG 54 52 ? ? ? A . n A 1 55 ARG 55 53 ? ? ? A . n A 1 56 SER 56 54 ? ? ? A . n A 1 57 LEU 57 55 ? ? ? A . n A 1 58 ALA 58 56 ? ? ? A . n A 1 59 ILE 59 57 ? ? ? A . n A 1 60 ILE 60 58 ? ? ? A . n A 1 61 SER 61 59 ? ? ? A . n A 1 62 VAL 62 60 ? ? ? A . n A 1 63 THR 63 61 ? ? ? A . n A 1 64 MET 64 62 ? ? ? A . n A 1 65 ILE 65 63 ? ? ? A . n A 1 66 GLU 66 64 ? ? ? A . n A 1 67 GLY 67 65 ? ? ? A . n A 1 68 GLY 68 66 ? ? ? A . n A 1 69 ALA 69 67 ? ? ? A . n A 1 70 ALA 70 68 ? ? ? A . n A 1 71 PHE 71 69 ? ? ? A . n A 1 72 LEU 72 70 ? ? ? A . n A 1 73 ARG 73 71 ? ? ? A . n A 1 74 ASP 74 72 ? ? ? A . n A 1 75 TRP 75 73 ? ? ? A . n A 1 76 GLN 76 74 ? ? ? A . n A 1 77 ALA 77 75 ? ? ? A . n A 1 78 ASN 78 76 ? ? ? A . n A 1 79 ILE 79 77 ? ? ? A . n A 1 80 GLY 80 78 ? ? ? A . n A 1 81 MET 81 79 ? ? ? A . n A 1 82 PRO 82 80 ? ? ? A . n A 1 83 VAL 83 81 ? ? ? A . n A 1 84 VAL 84 82 ? ? ? A . n A 1 85 TRP 85 83 ? ? ? A . n A 1 86 VAL 86 84 ? ? ? A . n A 1 87 GLY 87 85 ? ? ? A . n A 1 88 ALA 88 86 ? ? ? A . n A 1 89 ALA 89 87 ? ? ? A . n A 1 90 ARG 90 88 ? ? ? A . n A 1 91 ASP 91 89 ? ? ? A . n A 1 92 HIS 92 90 ? ? ? A . n A 1 93 ASP 93 91 ? ? ? A . n A 1 94 ALA 94 92 ? ? ? A . n A 1 95 SER 95 93 ? ? ? A . n A 1 96 GLN 96 94 ? ? ? A . n A 1 97 TYR 97 95 ? ? ? A . n A 1 98 PRO 98 96 ? ? ? A . n A 1 99 PRO 99 97 ? ? ? A . n A 1 100 GLU 100 98 ? ? ? A . n A 1 101 TYR 101 99 ? ? ? A . n A 1 102 SER 102 100 ? ? ? A . n A 1 103 HIS 103 101 ? ? ? A . n A 1 104 ILE 104 102 ? ? ? A . n A 1 105 LEU 105 103 ? ? ? A . n A 1 106 PRO 106 104 ? ? ? A . n A 1 107 LEU 107 105 ? ? ? A . n A 1 108 ASP 108 106 ? ? ? A . n A 1 109 PHE 109 107 ? ? ? A . n A 1 110 THR 110 108 ? ? ? A . n A 1 111 CYS 111 109 ? ? ? A . n A 1 112 ALA 112 110 ? ? ? A . n A 1 113 GLU 113 111 ? ? ? A . n A 1 114 LEU 114 112 ? ? ? A . n A 1 115 ARG 115 113 ? ? ? A . n A 1 116 GLY 116 114 ? ? ? A . n A 1 117 MET 117 115 ? ? ? A . n A 1 118 ILE 118 116 ? ? ? A . n A 1 119 GLY 119 117 ? ? ? A . n A 1 120 LYS 120 118 ? ? ? A . n A 1 121 LEU 121 119 ? ? ? A . n A 1 122 VAL 122 120 ? ? ? A . n A 1 123 THR 123 121 ? ? ? A . n A 1 124 GLN 124 122 ? ? ? A . n A 1 125 LEU 125 123 ? ? ? A . n A 1 126 ARG 126 124 ? ? ? A . n A 1 127 ALA 127 125 ? ? ? A . n A 1 128 HIS 128 126 ? ? ? A . n A 1 129 ALA 129 127 ? ? ? A . n A 1 130 ALA 130 128 ? ? ? A . n A 1 131 GLU 131 129 ? ? ? A . n A 1 132 THR 132 130 ? ? ? A . n A 1 133 LEU 133 131 ? ? ? A . n A 1 134 GLN 134 132 ? ? ? A . n A 1 135 PRO 135 133 ? ? ? A . n A 1 136 SER 136 134 ? ? ? A . n A 1 137 GLU 137 135 ? ? ? A . n A 1 138 LEU 138 136 ? ? ? A . n A 1 139 VAL 139 137 ? ? ? A . n A 1 140 ALA 140 138 ? ? ? A . n A 1 141 HIS 141 139 139 HIS HIS A . n A 1 142 SER 142 140 140 SER SER A . n A 1 143 GLU 143 141 141 GLU GLU A . n A 1 144 SER 144 142 142 SER SER A . n A 1 145 MET 145 143 143 MET MET A . n A 1 146 GLN 146 144 144 GLN GLN A . n A 1 147 ALA 147 145 145 ALA ALA A . n A 1 148 LEU 148 146 146 LEU LEU A . n A 1 149 LEU 149 147 147 LEU LEU A . n A 1 150 HIS 150 148 148 HIS HIS A . n A 1 151 GLU 151 149 149 GLU GLU A . n A 1 152 VAL 152 150 150 VAL VAL A . n A 1 153 ASP 153 151 151 ASP ASP A . n A 1 154 THR 154 152 152 THR THR A . n A 1 155 PHE 155 153 153 PHE PHE A . n A 1 156 ALA 156 154 154 ALA ALA A . n A 1 157 ASP 157 155 155 ASP ASP A . n A 1 158 CYS 158 156 156 CYS CYS A . n A 1 159 ASP 159 157 157 ASP ASP A . n A 1 160 THR 160 158 158 THR THR A . n A 1 161 ASN 161 159 159 ASN ASN A . n A 1 162 VAL 162 160 160 VAL VAL A . n A 1 163 LEU 163 161 161 LEU LEU A . n A 1 164 LEU 164 162 162 LEU LEU A . n A 1 165 HIS 165 163 163 HIS HIS A . n A 1 166 GLY 166 164 164 GLY GLY A . n A 1 167 GLU 167 165 165 GLU GLU A . n A 1 168 THR 168 166 166 THR THR A . n A 1 169 GLY 169 167 167 GLY GLY A . n A 1 170 VAL 170 168 168 VAL VAL A . n A 1 171 GLY 171 169 169 GLY GLY A . n A 1 172 LYS 172 170 170 LYS LYS A . n A 1 173 GLU 173 171 171 GLU GLU A . n A 1 174 ARG 174 172 172 ARG ARG A . n A 1 175 ILE 175 173 173 ILE ILE A . n A 1 176 ALA 176 174 174 ALA ALA A . n A 1 177 GLN 177 175 175 GLN GLN A . n A 1 178 LEU 178 176 176 LEU LEU A . n A 1 179 LEU 179 177 177 LEU LEU A . n A 1 180 HIS 180 178 178 HIS HIS A . n A 1 181 GLU 181 179 179 GLU GLU A . n A 1 182 LYS 182 180 180 LYS LYS A . n A 1 183 HIS 183 181 181 HIS HIS A . n A 1 184 SER 184 182 182 SER SER A . n A 1 185 ARG 185 183 183 ARG ARG A . n A 1 186 TYR 186 184 184 TYR TYR A . n A 1 187 ARG 187 185 185 ARG ARG A . n A 1 188 HIS 188 186 186 HIS HIS A . n A 1 189 GLY 189 187 187 GLY GLY A . n A 1 190 GLU 190 188 188 GLU GLU A . n A 1 191 PHE 191 189 189 PHE PHE A . n A 1 192 VAL 192 190 190 VAL VAL A . n A 1 193 PRO 193 191 191 PRO PRO A . n A 1 194 VAL 194 192 192 VAL VAL A . n A 1 195 ASN 195 193 193 ASN ASN A . n A 1 196 CYS 196 194 194 CYS CYS A . n A 1 197 GLY 197 195 195 GLY GLY A . n A 1 198 ALA 198 196 196 ALA ALA A . n A 1 199 ILE 199 197 197 ILE ILE A . n A 1 200 PRO 200 198 198 PRO PRO A . n A 1 201 ASP 201 199 199 ASP ASP A . n A 1 202 GLY 202 200 200 GLY GLY A . n A 1 203 LEU 203 201 201 LEU LEU A . n A 1 204 PHE 204 202 202 PHE PHE A . n A 1 205 GLU 205 203 203 GLU GLU A . n A 1 206 SER 206 204 204 SER SER A . n A 1 207 LEU 207 205 205 LEU LEU A . n A 1 208 PHE 208 206 206 PHE PHE A . n A 1 209 PHE 209 207 207 PHE PHE A . n A 1 210 GLY 210 208 208 GLY GLY A . n A 1 211 HIS 211 209 209 HIS HIS A . n A 1 212 ALA 212 210 210 ALA ALA A . n A 1 213 LYS 213 211 ? ? ? A . n A 1 214 GLY 214 212 ? ? ? A . n A 1 215 SER 215 213 ? ? ? A . n A 1 216 PHE 216 214 ? ? ? A . n A 1 217 THR 217 215 ? ? ? A . n A 1 218 GLY 218 216 ? ? ? A . n A 1 219 ALA 219 217 ? ? ? A . n A 1 220 VAL 220 218 ? ? ? A . n A 1 221 VAL 221 219 ? ? ? A . n A 1 222 ALA 222 220 220 ALA ALA A . n A 1 223 HIS 223 221 221 HIS HIS A . n A 1 224 LYS 224 222 222 LYS LYS A . n A 1 225 GLY 225 223 223 GLY GLY A . n A 1 226 TYR 226 224 224 TYR TYR A . n A 1 227 PHE 227 225 225 PHE PHE A . n A 1 228 GLU 228 226 226 GLU GLU A . n A 1 229 GLN 229 227 227 GLN GLN A . n A 1 230 ALA 230 228 228 ALA ALA A . n A 1 231 ALA 231 229 229 ALA ALA A . n A 1 232 GLY 232 230 230 GLY GLY A . n A 1 233 GLY 233 231 231 GLY GLY A . n A 1 234 THR 234 232 232 THR THR A . n A 1 235 LEU 235 233 233 LEU LEU A . n A 1 236 PHE 236 234 234 PHE PHE A . n A 1 237 LEU 237 235 235 LEU LEU A . n A 1 238 ASP 238 236 236 ASP ASP A . n A 1 239 GLU 239 237 237 GLU GLU A . n A 1 240 VAL 240 238 238 VAL VAL A . n A 1 241 GLY 241 239 239 GLY GLY A . n A 1 242 ASP 242 240 240 ASP ASP A . n A 1 243 LEU 243 241 241 LEU LEU A . n A 1 244 PRO 244 242 242 PRO PRO A . n A 1 245 LEU 245 243 243 LEU LEU A . n A 1 246 TYR 246 244 244 TYR TYR A . n A 1 247 GLN 247 245 245 GLN GLN A . n A 1 248 GLN 248 246 246 GLN GLN A . n A 1 249 VAL 249 247 247 VAL VAL A . n A 1 250 LYS 250 248 248 LYS LYS A . n A 1 251 LEU 251 249 249 LEU LEU A . n A 1 252 LEU 252 250 250 LEU LEU A . n A 1 253 ARG 253 251 251 ARG ARG A . n A 1 254 VAL 254 252 252 VAL VAL A . n A 1 255 LEU 255 253 253 LEU LEU A . n A 1 256 GLU 256 254 254 GLU GLU A . n A 1 257 ASP 257 255 255 ASP ASP A . n A 1 258 GLY 258 256 256 GLY GLY A . n A 1 259 ALA 259 257 257 ALA ALA A . n A 1 260 VAL 260 258 258 VAL VAL A . n A 1 261 LEU 261 259 259 LEU LEU A . n A 1 262 ARG 262 260 260 ARG ARG A . n A 1 263 VAL 263 261 261 VAL VAL A . n A 1 264 GLY 264 262 262 GLY GLY A . n A 1 265 ALA 265 263 263 ALA ALA A . n A 1 266 THR 266 264 264 THR THR A . n A 1 267 ALA 267 265 265 ALA ALA A . n A 1 268 PRO 268 266 266 PRO PRO A . n A 1 269 VAL 269 267 267 VAL VAL A . n A 1 270 LYS 270 268 268 LYS LYS A . n A 1 271 VAL 271 269 269 VAL VAL A . n A 1 272 ASP 272 270 270 ASP ASP A . n A 1 273 PHE 273 271 271 PHE PHE A . n A 1 274 ARG 274 272 272 ARG ARG A . n A 1 275 LEU 275 273 273 LEU LEU A . n A 1 276 VAL 276 274 274 VAL VAL A . n A 1 277 ALA 277 275 275 ALA ALA A . n A 1 278 ALA 278 276 276 ALA ALA A . n A 1 279 SER 279 277 277 SER SER A . n A 1 280 ASN 280 278 278 ASN ASN A . n A 1 281 LYS 281 279 279 LYS LYS A . n A 1 282 LYS 282 280 280 LYS LYS A . n A 1 283 LEU 283 281 281 LEU LEU A . n A 1 284 PRO 284 282 282 PRO PRO A . n A 1 285 GLN 285 283 283 GLN GLN A . n A 1 286 LEU 286 284 284 LEU LEU A . n A 1 287 VAL 287 285 285 VAL VAL A . n A 1 288 LYS 288 286 286 LYS LYS A . n A 1 289 GLU 289 287 287 GLU GLU A . n A 1 290 GLY 290 288 288 GLY GLY A . n A 1 291 LEU 291 289 289 LEU LEU A . n A 1 292 PHE 292 290 290 PHE PHE A . n A 1 293 ARG 293 291 291 ARG ARG A . n A 1 294 ALA 294 292 292 ALA ALA A . n A 1 295 ASP 295 293 293 ASP ASP A . n A 1 296 LEU 296 294 294 LEU LEU A . n A 1 297 TYR 297 295 295 TYR TYR A . n A 1 298 TYR 298 296 296 TYR TYR A . n A 1 299 ARG 299 297 297 ARG ARG A . n A 1 300 LEU 300 298 298 LEU LEU A . n A 1 301 ALA 301 299 299 ALA ALA A . n A 1 302 VAL 302 300 300 VAL VAL A . n A 1 303 ILE 303 301 301 ILE ILE A . n A 1 304 GLU 304 302 302 GLU GLU A . n A 1 305 LEU 305 303 303 LEU LEU A . n A 1 306 SER 306 304 304 SER SER A . n A 1 307 ILE 307 305 305 ILE ILE A . n A 1 308 PRO 308 306 306 PRO PRO A . n A 1 309 SER 309 307 307 SER SER A . n A 1 310 LEU 310 308 308 LEU LEU A . n A 1 311 GLU 311 309 309 GLU GLU A . n A 1 312 GLU 312 310 310 GLU GLU A . n A 1 313 ARG 313 311 311 ARG ARG A . n A 1 314 GLY 314 312 312 GLY GLY A . n A 1 315 ALA 315 313 313 ALA ALA A . n A 1 316 VAL 316 314 314 VAL VAL A . n A 1 317 ASP 317 315 315 ASP ASP A . n A 1 318 LYS 318 316 316 LYS LYS A . n A 1 319 ILE 319 317 317 ILE ILE A . n A 1 320 ALA 320 318 318 ALA ALA A . n A 1 321 LEU 321 319 319 LEU LEU A . n A 1 322 PHE 322 320 320 PHE PHE A . n A 1 323 LYS 323 321 321 LYS LYS A . n A 1 324 SER 324 322 322 SER SER A . n A 1 325 PHE 325 323 323 PHE PHE A . n A 1 326 VAL 326 324 324 VAL VAL A . n A 1 327 ALA 327 325 325 ALA ALA A . n A 1 328 GLN 328 326 326 GLN GLN A . n A 1 329 VAL 329 327 327 VAL VAL A . n A 1 330 VAL 330 328 328 VAL VAL A . n A 1 331 GLY 331 329 329 GLY GLY A . n A 1 332 GLU 332 330 330 GLU GLU A . n A 1 333 GLU 333 331 331 GLU GLU A . n A 1 334 ARG 334 332 332 ARG ARG A . n A 1 335 LEU 335 333 333 LEU LEU A . n A 1 336 ALA 336 334 334 ALA ALA A . n A 1 337 GLU 337 335 335 GLU GLU A . n A 1 338 LEU 338 336 336 LEU LEU A . n A 1 339 SER 339 337 337 SER SER A . n A 1 340 ASP 340 338 338 ASP ASP A . n A 1 341 LEU 341 339 339 LEU LEU A . n A 1 342 PRO 342 340 340 PRO PRO A . n A 1 343 TYR 343 341 341 TYR TYR A . n A 1 344 TRP 344 342 342 TRP TRP A . n A 1 345 LEU 345 343 343 LEU LEU A . n A 1 346 THR 346 344 344 THR THR A . n A 1 347 ASP 347 345 345 ASP ASP A . n A 1 348 SER 348 346 346 SER SER A . n A 1 349 VAL 349 347 347 VAL VAL A . n A 1 350 ALA 350 348 348 ALA ALA A . n A 1 351 ASP 351 349 349 ASP ASP A . n A 1 352 SER 352 350 350 SER SER A . n A 1 353 TYR 353 351 351 TYR TYR A . n A 1 354 PHE 354 352 352 PHE PHE A . n A 1 355 PRO 355 353 353 PRO PRO A . n A 1 356 GLY 356 354 354 GLY GLY A . n A 1 357 ASN 357 355 355 ASN ASN A . n A 1 358 VAL 358 356 356 VAL VAL A . n A 1 359 ARG 359 357 357 ARG ARG A . n A 1 360 GLU 360 358 358 GLU GLU A . n A 1 361 LEU 361 359 359 LEU LEU A . n A 1 362 ARG 362 360 360 ARG ARG A . n A 1 363 ASN 363 361 361 ASN ASN A . n A 1 364 LEU 364 362 362 LEU LEU A . n A 1 365 ALA 365 363 363 ALA ALA A . n A 1 366 GLU 366 364 364 GLU GLU A . n A 1 367 ARG 367 365 365 ARG ARG A . n A 1 368 VAL 368 366 366 VAL VAL A . n A 1 369 GLY 369 367 367 GLY GLY A . n A 1 370 VAL 370 368 368 VAL VAL A . n A 1 371 THR 371 369 369 THR THR A . n A 1 372 VAL 372 370 370 VAL VAL A . n A 1 373 ARG 373 371 371 ARG ARG A . n A 1 374 GLN 374 372 372 GLN GLN A . n A 1 375 THR 375 373 373 THR THR A . n A 1 376 GLY 376 374 374 GLY GLY A . n A 1 377 GLY 377 375 375 GLY GLY A . n A 1 378 TRP 378 376 376 TRP TRP A . n A 1 379 ASP 379 377 377 ASP ASP A . n A 1 380 ALA 380 378 378 ALA ALA A . n A 1 381 ALA 381 379 379 ALA ALA A . n A 1 382 ARG 382 380 380 ARG ARG A . n A 1 383 LEU 383 381 381 LEU LEU A . n A 1 384 GLN 384 382 382 GLN GLN A . n A 1 385 ARG 385 383 383 ARG ARG A . n A 1 386 LEU 386 384 384 LEU LEU A . n A 1 387 ILE 387 385 385 ILE ILE A . n A 1 388 ALA 388 386 ? ? ? A . n A 1 389 HIS 389 387 ? ? ? A . n A 1 390 ALA 390 388 ? ? ? A . n A 1 391 ARG 391 389 ? ? ? A . n A 1 392 SER 392 390 ? ? ? A . n A 1 393 ALA 393 391 ? ? ? A . n A 1 394 ALA 394 392 ? ? ? A . n A 1 395 GLN 395 393 ? ? ? A . n A 1 396 PRO 396 394 ? ? ? A . n A 1 397 VAL 397 395 ? ? ? A . n A 1 398 PRO 398 396 ? ? ? A . n A 1 399 ALA 399 397 ? ? ? A . n A 1 400 GLU 400 398 ? ? ? A . n A 1 401 SER 401 399 ? ? ? A . n A 1 402 ALA 402 400 ? ? ? A . n A 1 403 ALA 403 401 ? ? ? A . n A 1 404 GLU 404 402 ? ? ? A . n A 1 405 VAL 405 403 ? ? ? A . n A 1 406 PHE 406 404 ? ? ? A . n A 1 407 VAL 407 405 ? ? ? A . n A 1 408 ASP 408 406 ? ? ? A . n A 1 409 ARG 409 407 ? ? ? A . n A 1 410 SER 410 408 ? ? ? A . n A 1 411 LYS 411 409 ? ? ? A . n A 1 412 TRP 412 410 ? ? ? A . n A 1 413 ASP 413 411 ? ? ? A . n A 1 414 MET 414 412 ? ? ? A . n A 1 415 ASN 415 413 ? ? ? A . n A 1 416 GLU 416 414 ? ? ? A . n A 1 417 ARG 417 415 ? ? ? A . n A 1 418 ASN 418 416 ? ? ? A . n A 1 419 ARG 419 417 ? ? ? A . n A 1 420 VAL 420 418 ? ? ? A . n A 1 421 ILE 421 419 ? ? ? A . n A 1 422 ALA 422 420 ? ? ? A . n A 1 423 ALA 423 421 ? ? ? A . n A 1 424 LEU 424 422 ? ? ? A . n A 1 425 ASP 425 423 ? ? ? A . n A 1 426 ALA 426 424 ? ? ? A . n A 1 427 ASN 427 425 ? ? ? A . n A 1 428 GLY 428 426 ? ? ? A . n A 1 429 TRP 429 427 ? ? ? A . n A 1 430 ARG 430 428 ? ? ? A . n A 1 431 ARG 431 429 ? ? ? A . n A 1 432 GLN 432 430 ? ? ? A . n A 1 433 ASP 433 431 ? ? ? A . n A 1 434 THR 434 432 ? ? ? A . n A 1 435 ALA 435 433 ? ? ? A . n A 1 436 GLN 436 434 ? ? ? A . n A 1 437 GLN 437 435 ? ? ? A . n A 1 438 LEU 438 436 ? ? ? A . n A 1 439 GLY 439 437 ? ? ? A . n A 1 440 ILE 440 438 ? ? ? A . n A 1 441 SER 441 439 ? ? ? A . n A 1 442 ARG 442 440 ? ? ? A . n A 1 443 LYS 443 441 ? ? ? A . n A 1 444 VAL 444 442 ? ? ? A . n A 1 445 LEU 445 443 ? ? ? A . n A 1 446 TRP 446 444 ? ? ? A . n A 1 447 GLU 447 445 ? ? ? A . n A 1 448 LYS 448 446 ? ? ? A . n A 1 449 MET 449 447 ? ? ? A . n A 1 450 ARG 450 448 ? ? ? A . n A 1 451 LYS 451 449 ? ? ? A . n A 1 452 TYR 452 450 ? ? ? A . n A 1 453 GLN 453 451 ? ? ? A . n A 1 454 ILE 454 452 ? ? ? A . n A 1 455 PHE 455 453 ? ? ? A . n A 1 456 ASP 456 454 ? ? ? A . n A 1 457 GLU 457 455 ? ? ? A . n A 1 458 GLU 458 456 ? ? ? A . n A 1 459 PRO 459 457 ? ? ? A . n A 1 460 GLU 460 458 ? ? ? A . n A 1 461 THR 461 459 ? ? ? A . n A 1 462 ARG 462 460 ? ? ? A . n A 1 463 GLU 463 461 ? ? ? A . n A 1 464 SER 464 462 ? ? ? A . n A 1 465 GLU 465 463 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GTP 1 501 401 GTP GTP A . C 3 MG 1 502 1 MG MG A . D 4 HOH 1 601 29 HOH HOH A . D 4 HOH 2 602 43 HOH HOH A . D 4 HOH 3 603 37 HOH HOH A . D 4 HOH 4 604 71 HOH HOH A . D 4 HOH 5 605 16 HOH HOH A . D 4 HOH 6 606 60 HOH HOH A . D 4 HOH 7 607 59 HOH HOH A . D 4 HOH 8 608 25 HOH HOH A . D 4 HOH 9 609 51 HOH HOH A . D 4 HOH 10 610 32 HOH HOH A . D 4 HOH 11 611 5 HOH HOH A . D 4 HOH 12 612 3 HOH HOH A . D 4 HOH 13 613 70 HOH HOH A . D 4 HOH 14 614 45 HOH HOH A . D 4 HOH 15 615 55 HOH HOH A . D 4 HOH 16 616 28 HOH HOH A . D 4 HOH 17 617 27 HOH HOH A . D 4 HOH 18 618 69 HOH HOH A . D 4 HOH 19 619 17 HOH HOH A . D 4 HOH 20 620 23 HOH HOH A . D 4 HOH 21 621 4 HOH HOH A . D 4 HOH 22 622 21 HOH HOH A . D 4 HOH 23 623 11 HOH HOH A . D 4 HOH 24 624 68 HOH HOH A . D 4 HOH 25 625 2 HOH HOH A . D 4 HOH 26 626 20 HOH HOH A . D 4 HOH 27 627 1 HOH HOH A . D 4 HOH 28 628 40 HOH HOH A . D 4 HOH 29 629 6 HOH HOH A . D 4 HOH 30 630 61 HOH HOH A . D 4 HOH 31 631 47 HOH HOH A . D 4 HOH 32 632 22 HOH HOH A . D 4 HOH 33 633 48 HOH HOH A . D 4 HOH 34 634 18 HOH HOH A . D 4 HOH 35 635 50 HOH HOH A . D 4 HOH 36 636 49 HOH HOH A . D 4 HOH 37 637 9 HOH HOH A . D 4 HOH 38 638 7 HOH HOH A . D 4 HOH 39 639 8 HOH HOH A . D 4 HOH 40 640 30 HOH HOH A . D 4 HOH 41 641 14 HOH HOH A . D 4 HOH 42 642 34 HOH HOH A . D 4 HOH 43 643 10 HOH HOH A . D 4 HOH 44 644 58 HOH HOH A . D 4 HOH 45 645 67 HOH HOH A . D 4 HOH 46 646 15 HOH HOH A . D 4 HOH 47 647 52 HOH HOH A . D 4 HOH 48 648 53 HOH HOH A . D 4 HOH 49 649 57 HOH HOH A . D 4 HOH 50 650 26 HOH HOH A . D 4 HOH 51 651 65 HOH HOH A . D 4 HOH 52 652 36 HOH HOH A . D 4 HOH 53 653 35 HOH HOH A . D 4 HOH 54 654 31 HOH HOH A . D 4 HOH 55 655 46 HOH HOH A . D 4 HOH 56 656 63 HOH HOH A . D 4 HOH 57 657 62 HOH HOH A . D 4 HOH 58 658 54 HOH HOH A . D 4 HOH 59 659 33 HOH HOH A . D 4 HOH 60 660 24 HOH HOH A . D 4 HOH 61 661 42 HOH HOH A . D 4 HOH 62 662 44 HOH HOH A . D 4 HOH 63 663 19 HOH HOH A . D 4 HOH 64 664 39 HOH HOH A . D 4 HOH 65 665 12 HOH HOH A . D 4 HOH 66 666 66 HOH HOH A . D 4 HOH 67 667 38 HOH HOH A . D 4 HOH 68 668 41 HOH HOH A . D 4 HOH 69 669 64 HOH HOH A . D 4 HOH 70 670 13 HOH HOH A . D 4 HOH 71 671 56 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1010 ? 1 MORE -10 ? 1 'SSA (A^2)' 11790 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 238 ? A ASP 236 ? 1_555 MG ? C MG . ? A MG 502 ? 1_555 O3G ? B GTP . ? A GTP 501 ? 1_555 59.4 ? 2 OD2 ? A ASP 238 ? A ASP 236 ? 1_555 MG ? C MG . ? A MG 502 ? 1_555 O ? D HOH . ? A HOH 616 ? 1_555 119.7 ? 3 O3G ? B GTP . ? A GTP 501 ? 1_555 MG ? C MG . ? A MG 502 ? 1_555 O ? D HOH . ? A HOH 616 ? 1_555 147.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-12-15 2 'Structure model' 1 1 2022-02-16 3 'Structure model' 1 2 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.year' 5 2 'Structure model' '_citation_author.identifier_ORCID' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.18.2_3874 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 7VBW _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 300 ? ? -103.78 -78.56 2 1 ASN A 355 ? ? 49.37 -129.34 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 141 ? CD ? A GLU 143 CD 2 1 Y 1 A GLU 141 ? OE1 ? A GLU 143 OE1 3 1 Y 1 A GLU 141 ? OE2 ? A GLU 143 OE2 4 1 Y 1 A GLU 188 ? CD ? A GLU 190 CD 5 1 Y 1 A GLU 188 ? OE1 ? A GLU 190 OE1 6 1 Y 1 A GLU 188 ? OE2 ? A GLU 190 OE2 7 1 Y 1 A GLU 310 ? CG ? A GLU 312 CG 8 1 Y 1 A GLU 310 ? CD ? A GLU 312 CD 9 1 Y 1 A GLU 310 ? OE1 ? A GLU 312 OE1 10 1 Y 1 A GLU 310 ? OE2 ? A GLU 312 OE2 11 1 Y 1 A GLN 326 ? CG ? A GLN 328 CG 12 1 Y 1 A GLN 326 ? CD ? A GLN 328 CD 13 1 Y 1 A GLN 326 ? OE1 ? A GLN 328 OE1 14 1 Y 1 A GLN 326 ? NE2 ? A GLN 328 NE2 15 1 Y 1 A GLU 330 ? CG ? A GLU 332 CG 16 1 Y 1 A GLU 330 ? CD ? A GLU 332 CD 17 1 Y 1 A GLU 330 ? OE1 ? A GLU 332 OE1 18 1 Y 1 A GLU 330 ? OE2 ? A GLU 332 OE2 19 1 Y 1 A ASP 349 ? CG ? A ASP 351 CG 20 1 Y 1 A ASP 349 ? OD1 ? A ASP 351 OD1 21 1 Y 1 A ASP 349 ? OD2 ? A ASP 351 OD2 22 1 Y 1 A GLU 364 ? CD ? A GLU 366 CD 23 1 Y 1 A GLU 364 ? OE1 ? A GLU 366 OE1 24 1 Y 1 A GLU 364 ? OE2 ? A GLU 366 OE2 25 1 Y 1 A ARG 371 ? NE ? A ARG 373 NE 26 1 Y 1 A ARG 371 ? CZ ? A ARG 373 CZ 27 1 Y 1 A ARG 371 ? NH1 ? A ARG 373 NH1 28 1 Y 1 A ARG 371 ? NH2 ? A ARG 373 NH2 29 1 Y 1 A ARG 383 ? CG ? A ARG 385 CG 30 1 Y 1 A ARG 383 ? CD ? A ARG 385 CD 31 1 Y 1 A ARG 383 ? NE ? A ARG 385 NE 32 1 Y 1 A ARG 383 ? CZ ? A ARG 385 CZ 33 1 Y 1 A ARG 383 ? NH1 ? A ARG 385 NH1 34 1 Y 1 A ARG 383 ? NH2 ? A ARG 385 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A HIS 0 ? A HIS 2 3 1 Y 1 A MET 1 ? A MET 3 4 1 Y 1 A ARG 2 ? A ARG 4 5 1 Y 1 A ASN 3 ? A ASN 5 6 1 Y 1 A THR 4 ? A THR 6 7 1 Y 1 A PRO 5 ? A PRO 7 8 1 Y 1 A ALA 6 ? A ALA 8 9 1 Y 1 A ILE 7 ? A ILE 9 10 1 Y 1 A GLU 8 ? A GLU 10 11 1 Y 1 A GLU 9 ? A GLU 11 12 1 Y 1 A LEU 10 ? A LEU 12 13 1 Y 1 A ASP 11 ? A ASP 13 14 1 Y 1 A LEU 12 ? A LEU 14 15 1 Y 1 A TYR 13 ? A TYR 15 16 1 Y 1 A VAL 14 ? A VAL 16 17 1 Y 1 A TRP 15 ? A TRP 17 18 1 Y 1 A GLU 16 ? A GLU 18 19 1 Y 1 A GLY 17 ? A GLY 19 20 1 Y 1 A LYS 18 ? A LYS 20 21 1 Y 1 A ALA 19 ? A ALA 21 22 1 Y 1 A ASP 20 ? A ASP 22 23 1 Y 1 A ILE 21 ? A ILE 23 24 1 Y 1 A VAL 22 ? A VAL 24 25 1 Y 1 A ASP 23 ? A ASP 25 26 1 Y 1 A ARG 24 ? A ARG 26 27 1 Y 1 A VAL 25 ? A VAL 27 28 1 Y 1 A ALA 26 ? A ALA 28 29 1 Y 1 A ARG 27 ? A ARG 29 30 1 Y 1 A CYS 28 ? A CYS 30 31 1 Y 1 A MET 29 ? A MET 31 32 1 Y 1 A ALA 30 ? A ALA 32 33 1 Y 1 A SER 31 ? A SER 33 34 1 Y 1 A PHE 32 ? A PHE 34 35 1 Y 1 A ASP 33 ? A ASP 35 36 1 Y 1 A VAL 34 ? A VAL 36 37 1 Y 1 A GLU 35 ? A GLU 37 38 1 Y 1 A VAL 36 ? A VAL 38 39 1 Y 1 A ILE 37 ? A ILE 39 40 1 Y 1 A ARG 38 ? A ARG 40 41 1 Y 1 A ALA 39 ? A ALA 41 42 1 Y 1 A ASP 40 ? A ASP 42 43 1 Y 1 A ASN 41 ? A ASN 43 44 1 Y 1 A ALA 42 ? A ALA 44 45 1 Y 1 A ALA 43 ? A ALA 45 46 1 Y 1 A VAL 44 ? A VAL 46 47 1 Y 1 A SER 45 ? A SER 47 48 1 Y 1 A PRO 46 ? A PRO 48 49 1 Y 1 A GLU 47 ? A GLU 49 50 1 Y 1 A ARG 48 ? A ARG 50 51 1 Y 1 A ALA 49 ? A ALA 51 52 1 Y 1 A ALA 50 ? A ALA 52 53 1 Y 1 A LEU 51 ? A LEU 53 54 1 Y 1 A ARG 52 ? A ARG 54 55 1 Y 1 A ARG 53 ? A ARG 55 56 1 Y 1 A SER 54 ? A SER 56 57 1 Y 1 A LEU 55 ? A LEU 57 58 1 Y 1 A ALA 56 ? A ALA 58 59 1 Y 1 A ILE 57 ? A ILE 59 60 1 Y 1 A ILE 58 ? A ILE 60 61 1 Y 1 A SER 59 ? A SER 61 62 1 Y 1 A VAL 60 ? A VAL 62 63 1 Y 1 A THR 61 ? A THR 63 64 1 Y 1 A MET 62 ? A MET 64 65 1 Y 1 A ILE 63 ? A ILE 65 66 1 Y 1 A GLU 64 ? A GLU 66 67 1 Y 1 A GLY 65 ? A GLY 67 68 1 Y 1 A GLY 66 ? A GLY 68 69 1 Y 1 A ALA 67 ? A ALA 69 70 1 Y 1 A ALA 68 ? A ALA 70 71 1 Y 1 A PHE 69 ? A PHE 71 72 1 Y 1 A LEU 70 ? A LEU 72 73 1 Y 1 A ARG 71 ? A ARG 73 74 1 Y 1 A ASP 72 ? A ASP 74 75 1 Y 1 A TRP 73 ? A TRP 75 76 1 Y 1 A GLN 74 ? A GLN 76 77 1 Y 1 A ALA 75 ? A ALA 77 78 1 Y 1 A ASN 76 ? A ASN 78 79 1 Y 1 A ILE 77 ? A ILE 79 80 1 Y 1 A GLY 78 ? A GLY 80 81 1 Y 1 A MET 79 ? A MET 81 82 1 Y 1 A PRO 80 ? A PRO 82 83 1 Y 1 A VAL 81 ? A VAL 83 84 1 Y 1 A VAL 82 ? A VAL 84 85 1 Y 1 A TRP 83 ? A TRP 85 86 1 Y 1 A VAL 84 ? A VAL 86 87 1 Y 1 A GLY 85 ? A GLY 87 88 1 Y 1 A ALA 86 ? A ALA 88 89 1 Y 1 A ALA 87 ? A ALA 89 90 1 Y 1 A ARG 88 ? A ARG 90 91 1 Y 1 A ASP 89 ? A ASP 91 92 1 Y 1 A HIS 90 ? A HIS 92 93 1 Y 1 A ASP 91 ? A ASP 93 94 1 Y 1 A ALA 92 ? A ALA 94 95 1 Y 1 A SER 93 ? A SER 95 96 1 Y 1 A GLN 94 ? A GLN 96 97 1 Y 1 A TYR 95 ? A TYR 97 98 1 Y 1 A PRO 96 ? A PRO 98 99 1 Y 1 A PRO 97 ? A PRO 99 100 1 Y 1 A GLU 98 ? A GLU 100 101 1 Y 1 A TYR 99 ? A TYR 101 102 1 Y 1 A SER 100 ? A SER 102 103 1 Y 1 A HIS 101 ? A HIS 103 104 1 Y 1 A ILE 102 ? A ILE 104 105 1 Y 1 A LEU 103 ? A LEU 105 106 1 Y 1 A PRO 104 ? A PRO 106 107 1 Y 1 A LEU 105 ? A LEU 107 108 1 Y 1 A ASP 106 ? A ASP 108 109 1 Y 1 A PHE 107 ? A PHE 109 110 1 Y 1 A THR 108 ? A THR 110 111 1 Y 1 A CYS 109 ? A CYS 111 112 1 Y 1 A ALA 110 ? A ALA 112 113 1 Y 1 A GLU 111 ? A GLU 113 114 1 Y 1 A LEU 112 ? A LEU 114 115 1 Y 1 A ARG 113 ? A ARG 115 116 1 Y 1 A GLY 114 ? A GLY 116 117 1 Y 1 A MET 115 ? A MET 117 118 1 Y 1 A ILE 116 ? A ILE 118 119 1 Y 1 A GLY 117 ? A GLY 119 120 1 Y 1 A LYS 118 ? A LYS 120 121 1 Y 1 A LEU 119 ? A LEU 121 122 1 Y 1 A VAL 120 ? A VAL 122 123 1 Y 1 A THR 121 ? A THR 123 124 1 Y 1 A GLN 122 ? A GLN 124 125 1 Y 1 A LEU 123 ? A LEU 125 126 1 Y 1 A ARG 124 ? A ARG 126 127 1 Y 1 A ALA 125 ? A ALA 127 128 1 Y 1 A HIS 126 ? A HIS 128 129 1 Y 1 A ALA 127 ? A ALA 129 130 1 Y 1 A ALA 128 ? A ALA 130 131 1 Y 1 A GLU 129 ? A GLU 131 132 1 Y 1 A THR 130 ? A THR 132 133 1 Y 1 A LEU 131 ? A LEU 133 134 1 Y 1 A GLN 132 ? A GLN 134 135 1 Y 1 A PRO 133 ? A PRO 135 136 1 Y 1 A SER 134 ? A SER 136 137 1 Y 1 A GLU 135 ? A GLU 137 138 1 Y 1 A LEU 136 ? A LEU 138 139 1 Y 1 A VAL 137 ? A VAL 139 140 1 Y 1 A ALA 138 ? A ALA 140 141 1 Y 1 A LYS 211 ? A LYS 213 142 1 Y 1 A GLY 212 ? A GLY 214 143 1 Y 1 A SER 213 ? A SER 215 144 1 Y 1 A PHE 214 ? A PHE 216 145 1 Y 1 A THR 215 ? A THR 217 146 1 Y 1 A GLY 216 ? A GLY 218 147 1 Y 1 A ALA 217 ? A ALA 219 148 1 Y 1 A VAL 218 ? A VAL 220 149 1 Y 1 A VAL 219 ? A VAL 221 150 1 Y 1 A ALA 386 ? A ALA 388 151 1 Y 1 A HIS 387 ? A HIS 389 152 1 Y 1 A ALA 388 ? A ALA 390 153 1 Y 1 A ARG 389 ? A ARG 391 154 1 Y 1 A SER 390 ? A SER 392 155 1 Y 1 A ALA 391 ? A ALA 393 156 1 Y 1 A ALA 392 ? A ALA 394 157 1 Y 1 A GLN 393 ? A GLN 395 158 1 Y 1 A PRO 394 ? A PRO 396 159 1 Y 1 A VAL 395 ? A VAL 397 160 1 Y 1 A PRO 396 ? A PRO 398 161 1 Y 1 A ALA 397 ? A ALA 399 162 1 Y 1 A GLU 398 ? A GLU 400 163 1 Y 1 A SER 399 ? A SER 401 164 1 Y 1 A ALA 400 ? A ALA 402 165 1 Y 1 A ALA 401 ? A ALA 403 166 1 Y 1 A GLU 402 ? A GLU 404 167 1 Y 1 A VAL 403 ? A VAL 405 168 1 Y 1 A PHE 404 ? A PHE 406 169 1 Y 1 A VAL 405 ? A VAL 407 170 1 Y 1 A ASP 406 ? A ASP 408 171 1 Y 1 A ARG 407 ? A ARG 409 172 1 Y 1 A SER 408 ? A SER 410 173 1 Y 1 A LYS 409 ? A LYS 411 174 1 Y 1 A TRP 410 ? A TRP 412 175 1 Y 1 A ASP 411 ? A ASP 413 176 1 Y 1 A MET 412 ? A MET 414 177 1 Y 1 A ASN 413 ? A ASN 415 178 1 Y 1 A GLU 414 ? A GLU 416 179 1 Y 1 A ARG 415 ? A ARG 417 180 1 Y 1 A ASN 416 ? A ASN 418 181 1 Y 1 A ARG 417 ? A ARG 419 182 1 Y 1 A VAL 418 ? A VAL 420 183 1 Y 1 A ILE 419 ? A ILE 421 184 1 Y 1 A ALA 420 ? A ALA 422 185 1 Y 1 A ALA 421 ? A ALA 423 186 1 Y 1 A LEU 422 ? A LEU 424 187 1 Y 1 A ASP 423 ? A ASP 425 188 1 Y 1 A ALA 424 ? A ALA 426 189 1 Y 1 A ASN 425 ? A ASN 427 190 1 Y 1 A GLY 426 ? A GLY 428 191 1 Y 1 A TRP 427 ? A TRP 429 192 1 Y 1 A ARG 428 ? A ARG 430 193 1 Y 1 A ARG 429 ? A ARG 431 194 1 Y 1 A GLN 430 ? A GLN 432 195 1 Y 1 A ASP 431 ? A ASP 433 196 1 Y 1 A THR 432 ? A THR 434 197 1 Y 1 A ALA 433 ? A ALA 435 198 1 Y 1 A GLN 434 ? A GLN 436 199 1 Y 1 A GLN 435 ? A GLN 437 200 1 Y 1 A LEU 436 ? A LEU 438 201 1 Y 1 A GLY 437 ? A GLY 439 202 1 Y 1 A ILE 438 ? A ILE 440 203 1 Y 1 A SER 439 ? A SER 441 204 1 Y 1 A ARG 440 ? A ARG 442 205 1 Y 1 A LYS 441 ? A LYS 443 206 1 Y 1 A VAL 442 ? A VAL 444 207 1 Y 1 A LEU 443 ? A LEU 445 208 1 Y 1 A TRP 444 ? A TRP 446 209 1 Y 1 A GLU 445 ? A GLU 447 210 1 Y 1 A LYS 446 ? A LYS 448 211 1 Y 1 A MET 447 ? A MET 449 212 1 Y 1 A ARG 448 ? A ARG 450 213 1 Y 1 A LYS 449 ? A LYS 451 214 1 Y 1 A TYR 450 ? A TYR 452 215 1 Y 1 A GLN 451 ? A GLN 453 216 1 Y 1 A ILE 452 ? A ILE 454 217 1 Y 1 A PHE 453 ? A PHE 455 218 1 Y 1 A ASP 454 ? A ASP 456 219 1 Y 1 A GLU 455 ? A GLU 457 220 1 Y 1 A GLU 456 ? A GLU 458 221 1 Y 1 A PRO 457 ? A PRO 459 222 1 Y 1 A GLU 458 ? A GLU 460 223 1 Y 1 A THR 459 ? A THR 461 224 1 Y 1 A ARG 460 ? A ARG 462 225 1 Y 1 A GLU 461 ? A GLU 463 226 1 Y 1 A SER 462 ? A SER 464 227 1 Y 1 A GLU 463 ? A GLU 465 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 GTP PG P N N 137 GTP O1G O N N 138 GTP O2G O N N 139 GTP O3G O N N 140 GTP O3B O N N 141 GTP PB P N N 142 GTP O1B O N N 143 GTP O2B O N N 144 GTP O3A O N N 145 GTP PA P N N 146 GTP O1A O N N 147 GTP O2A O N N 148 GTP "O5'" O N N 149 GTP "C5'" C N N 150 GTP "C4'" C N R 151 GTP "O4'" O N N 152 GTP "C3'" C N S 153 GTP "O3'" O N N 154 GTP "C2'" C N R 155 GTP "O2'" O N N 156 GTP "C1'" C N R 157 GTP N9 N Y N 158 GTP C8 C Y N 159 GTP N7 N Y N 160 GTP C5 C Y N 161 GTP C6 C N N 162 GTP O6 O N N 163 GTP N1 N N N 164 GTP C2 C N N 165 GTP N2 N N N 166 GTP N3 N N N 167 GTP C4 C Y N 168 GTP HOG2 H N N 169 GTP HOG3 H N N 170 GTP HOB2 H N N 171 GTP HOA2 H N N 172 GTP "H5'" H N N 173 GTP "H5''" H N N 174 GTP "H4'" H N N 175 GTP "H3'" H N N 176 GTP "HO3'" H N N 177 GTP "H2'" H N N 178 GTP "HO2'" H N N 179 GTP "H1'" H N N 180 GTP H8 H N N 181 GTP HN1 H N N 182 GTP HN21 H N N 183 GTP HN22 H N N 184 HIS N N N N 185 HIS CA C N S 186 HIS C C N N 187 HIS O O N N 188 HIS CB C N N 189 HIS CG C Y N 190 HIS ND1 N Y N 191 HIS CD2 C Y N 192 HIS CE1 C Y N 193 HIS NE2 N Y N 194 HIS OXT O N N 195 HIS H H N N 196 HIS H2 H N N 197 HIS HA H N N 198 HIS HB2 H N N 199 HIS HB3 H N N 200 HIS HD1 H N N 201 HIS HD2 H N N 202 HIS HE1 H N N 203 HIS HE2 H N N 204 HIS HXT H N N 205 HOH O O N N 206 HOH H1 H N N 207 HOH H2 H N N 208 ILE N N N N 209 ILE CA C N S 210 ILE C C N N 211 ILE O O N N 212 ILE CB C N S 213 ILE CG1 C N N 214 ILE CG2 C N N 215 ILE CD1 C N N 216 ILE OXT O N N 217 ILE H H N N 218 ILE H2 H N N 219 ILE HA H N N 220 ILE HB H N N 221 ILE HG12 H N N 222 ILE HG13 H N N 223 ILE HG21 H N N 224 ILE HG22 H N N 225 ILE HG23 H N N 226 ILE HD11 H N N 227 ILE HD12 H N N 228 ILE HD13 H N N 229 ILE HXT H N N 230 LEU N N N N 231 LEU CA C N S 232 LEU C C N N 233 LEU O O N N 234 LEU CB C N N 235 LEU CG C N N 236 LEU CD1 C N N 237 LEU CD2 C N N 238 LEU OXT O N N 239 LEU H H N N 240 LEU H2 H N N 241 LEU HA H N N 242 LEU HB2 H N N 243 LEU HB3 H N N 244 LEU HG H N N 245 LEU HD11 H N N 246 LEU HD12 H N N 247 LEU HD13 H N N 248 LEU HD21 H N N 249 LEU HD22 H N N 250 LEU HD23 H N N 251 LEU HXT H N N 252 LYS N N N N 253 LYS CA C N S 254 LYS C C N N 255 LYS O O N N 256 LYS CB C N N 257 LYS CG C N N 258 LYS CD C N N 259 LYS CE C N N 260 LYS NZ N N N 261 LYS OXT O N N 262 LYS H H N N 263 LYS H2 H N N 264 LYS HA H N N 265 LYS HB2 H N N 266 LYS HB3 H N N 267 LYS HG2 H N N 268 LYS HG3 H N N 269 LYS HD2 H N N 270 LYS HD3 H N N 271 LYS HE2 H N N 272 LYS HE3 H N N 273 LYS HZ1 H N N 274 LYS HZ2 H N N 275 LYS HZ3 H N N 276 LYS HXT H N N 277 MET N N N N 278 MET CA C N S 279 MET C C N N 280 MET O O N N 281 MET CB C N N 282 MET CG C N N 283 MET SD S N N 284 MET CE C N N 285 MET OXT O N N 286 MET H H N N 287 MET H2 H N N 288 MET HA H N N 289 MET HB2 H N N 290 MET HB3 H N N 291 MET HG2 H N N 292 MET HG3 H N N 293 MET HE1 H N N 294 MET HE2 H N N 295 MET HE3 H N N 296 MET HXT H N N 297 MG MG MG N N 298 PHE N N N N 299 PHE CA C N S 300 PHE C C N N 301 PHE O O N N 302 PHE CB C N N 303 PHE CG C Y N 304 PHE CD1 C Y N 305 PHE CD2 C Y N 306 PHE CE1 C Y N 307 PHE CE2 C Y N 308 PHE CZ C Y N 309 PHE OXT O N N 310 PHE H H N N 311 PHE H2 H N N 312 PHE HA H N N 313 PHE HB2 H N N 314 PHE HB3 H N N 315 PHE HD1 H N N 316 PHE HD2 H N N 317 PHE HE1 H N N 318 PHE HE2 H N N 319 PHE HZ H N N 320 PHE HXT H N N 321 PRO N N N N 322 PRO CA C N S 323 PRO C C N N 324 PRO O O N N 325 PRO CB C N N 326 PRO CG C N N 327 PRO CD C N N 328 PRO OXT O N N 329 PRO H H N N 330 PRO HA H N N 331 PRO HB2 H N N 332 PRO HB3 H N N 333 PRO HG2 H N N 334 PRO HG3 H N N 335 PRO HD2 H N N 336 PRO HD3 H N N 337 PRO HXT H N N 338 SER N N N N 339 SER CA C N S 340 SER C C N N 341 SER O O N N 342 SER CB C N N 343 SER OG O N N 344 SER OXT O N N 345 SER H H N N 346 SER H2 H N N 347 SER HA H N N 348 SER HB2 H N N 349 SER HB3 H N N 350 SER HG H N N 351 SER HXT H N N 352 THR N N N N 353 THR CA C N S 354 THR C C N N 355 THR O O N N 356 THR CB C N R 357 THR OG1 O N N 358 THR CG2 C N N 359 THR OXT O N N 360 THR H H N N 361 THR H2 H N N 362 THR HA H N N 363 THR HB H N N 364 THR HG1 H N N 365 THR HG21 H N N 366 THR HG22 H N N 367 THR HG23 H N N 368 THR HXT H N N 369 TRP N N N N 370 TRP CA C N S 371 TRP C C N N 372 TRP O O N N 373 TRP CB C N N 374 TRP CG C Y N 375 TRP CD1 C Y N 376 TRP CD2 C Y N 377 TRP NE1 N Y N 378 TRP CE2 C Y N 379 TRP CE3 C Y N 380 TRP CZ2 C Y N 381 TRP CZ3 C Y N 382 TRP CH2 C Y N 383 TRP OXT O N N 384 TRP H H N N 385 TRP H2 H N N 386 TRP HA H N N 387 TRP HB2 H N N 388 TRP HB3 H N N 389 TRP HD1 H N N 390 TRP HE1 H N N 391 TRP HE3 H N N 392 TRP HZ2 H N N 393 TRP HZ3 H N N 394 TRP HH2 H N N 395 TRP HXT H N N 396 TYR N N N N 397 TYR CA C N S 398 TYR C C N N 399 TYR O O N N 400 TYR CB C N N 401 TYR CG C Y N 402 TYR CD1 C Y N 403 TYR CD2 C Y N 404 TYR CE1 C Y N 405 TYR CE2 C Y N 406 TYR CZ C Y N 407 TYR OH O N N 408 TYR OXT O N N 409 TYR H H N N 410 TYR H2 H N N 411 TYR HA H N N 412 TYR HB2 H N N 413 TYR HB3 H N N 414 TYR HD1 H N N 415 TYR HD2 H N N 416 TYR HE1 H N N 417 TYR HE2 H N N 418 TYR HH H N N 419 TYR HXT H N N 420 VAL N N N N 421 VAL CA C N S 422 VAL C C N N 423 VAL O O N N 424 VAL CB C N N 425 VAL CG1 C N N 426 VAL CG2 C N N 427 VAL OXT O N N 428 VAL H H N N 429 VAL H2 H N N 430 VAL HA H N N 431 VAL HB H N N 432 VAL HG11 H N N 433 VAL HG12 H N N 434 VAL HG13 H N N 435 VAL HG21 H N N 436 VAL HG22 H N N 437 VAL HG23 H N N 438 VAL HXT H N N 439 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GTP PG O1G doub N N 129 GTP PG O2G sing N N 130 GTP PG O3G sing N N 131 GTP PG O3B sing N N 132 GTP O2G HOG2 sing N N 133 GTP O3G HOG3 sing N N 134 GTP O3B PB sing N N 135 GTP PB O1B doub N N 136 GTP PB O2B sing N N 137 GTP PB O3A sing N N 138 GTP O2B HOB2 sing N N 139 GTP O3A PA sing N N 140 GTP PA O1A doub N N 141 GTP PA O2A sing N N 142 GTP PA "O5'" sing N N 143 GTP O2A HOA2 sing N N 144 GTP "O5'" "C5'" sing N N 145 GTP "C5'" "C4'" sing N N 146 GTP "C5'" "H5'" sing N N 147 GTP "C5'" "H5''" sing N N 148 GTP "C4'" "O4'" sing N N 149 GTP "C4'" "C3'" sing N N 150 GTP "C4'" "H4'" sing N N 151 GTP "O4'" "C1'" sing N N 152 GTP "C3'" "O3'" sing N N 153 GTP "C3'" "C2'" sing N N 154 GTP "C3'" "H3'" sing N N 155 GTP "O3'" "HO3'" sing N N 156 GTP "C2'" "O2'" sing N N 157 GTP "C2'" "C1'" sing N N 158 GTP "C2'" "H2'" sing N N 159 GTP "O2'" "HO2'" sing N N 160 GTP "C1'" N9 sing N N 161 GTP "C1'" "H1'" sing N N 162 GTP N9 C8 sing Y N 163 GTP N9 C4 sing Y N 164 GTP C8 N7 doub Y N 165 GTP C8 H8 sing N N 166 GTP N7 C5 sing Y N 167 GTP C5 C6 sing N N 168 GTP C5 C4 doub Y N 169 GTP C6 O6 doub N N 170 GTP C6 N1 sing N N 171 GTP N1 C2 sing N N 172 GTP N1 HN1 sing N N 173 GTP C2 N2 sing N N 174 GTP C2 N3 doub N N 175 GTP N2 HN21 sing N N 176 GTP N2 HN22 sing N N 177 GTP N3 C4 sing N N 178 HIS N CA sing N N 179 HIS N H sing N N 180 HIS N H2 sing N N 181 HIS CA C sing N N 182 HIS CA CB sing N N 183 HIS CA HA sing N N 184 HIS C O doub N N 185 HIS C OXT sing N N 186 HIS CB CG sing N N 187 HIS CB HB2 sing N N 188 HIS CB HB3 sing N N 189 HIS CG ND1 sing Y N 190 HIS CG CD2 doub Y N 191 HIS ND1 CE1 doub Y N 192 HIS ND1 HD1 sing N N 193 HIS CD2 NE2 sing Y N 194 HIS CD2 HD2 sing N N 195 HIS CE1 NE2 sing Y N 196 HIS CE1 HE1 sing N N 197 HIS NE2 HE2 sing N N 198 HIS OXT HXT sing N N 199 HOH O H1 sing N N 200 HOH O H2 sing N N 201 ILE N CA sing N N 202 ILE N H sing N N 203 ILE N H2 sing N N 204 ILE CA C sing N N 205 ILE CA CB sing N N 206 ILE CA HA sing N N 207 ILE C O doub N N 208 ILE C OXT sing N N 209 ILE CB CG1 sing N N 210 ILE CB CG2 sing N N 211 ILE CB HB sing N N 212 ILE CG1 CD1 sing N N 213 ILE CG1 HG12 sing N N 214 ILE CG1 HG13 sing N N 215 ILE CG2 HG21 sing N N 216 ILE CG2 HG22 sing N N 217 ILE CG2 HG23 sing N N 218 ILE CD1 HD11 sing N N 219 ILE CD1 HD12 sing N N 220 ILE CD1 HD13 sing N N 221 ILE OXT HXT sing N N 222 LEU N CA sing N N 223 LEU N H sing N N 224 LEU N H2 sing N N 225 LEU CA C sing N N 226 LEU CA CB sing N N 227 LEU CA HA sing N N 228 LEU C O doub N N 229 LEU C OXT sing N N 230 LEU CB CG sing N N 231 LEU CB HB2 sing N N 232 LEU CB HB3 sing N N 233 LEU CG CD1 sing N N 234 LEU CG CD2 sing N N 235 LEU CG HG sing N N 236 LEU CD1 HD11 sing N N 237 LEU CD1 HD12 sing N N 238 LEU CD1 HD13 sing N N 239 LEU CD2 HD21 sing N N 240 LEU CD2 HD22 sing N N 241 LEU CD2 HD23 sing N N 242 LEU OXT HXT sing N N 243 LYS N CA sing N N 244 LYS N H sing N N 245 LYS N H2 sing N N 246 LYS CA C sing N N 247 LYS CA CB sing N N 248 LYS CA HA sing N N 249 LYS C O doub N N 250 LYS C OXT sing N N 251 LYS CB CG sing N N 252 LYS CB HB2 sing N N 253 LYS CB HB3 sing N N 254 LYS CG CD sing N N 255 LYS CG HG2 sing N N 256 LYS CG HG3 sing N N 257 LYS CD CE sing N N 258 LYS CD HD2 sing N N 259 LYS CD HD3 sing N N 260 LYS CE NZ sing N N 261 LYS CE HE2 sing N N 262 LYS CE HE3 sing N N 263 LYS NZ HZ1 sing N N 264 LYS NZ HZ2 sing N N 265 LYS NZ HZ3 sing N N 266 LYS OXT HXT sing N N 267 MET N CA sing N N 268 MET N H sing N N 269 MET N H2 sing N N 270 MET CA C sing N N 271 MET CA CB sing N N 272 MET CA HA sing N N 273 MET C O doub N N 274 MET C OXT sing N N 275 MET CB CG sing N N 276 MET CB HB2 sing N N 277 MET CB HB3 sing N N 278 MET CG SD sing N N 279 MET CG HG2 sing N N 280 MET CG HG3 sing N N 281 MET SD CE sing N N 282 MET CE HE1 sing N N 283 MET CE HE2 sing N N 284 MET CE HE3 sing N N 285 MET OXT HXT sing N N 286 PHE N CA sing N N 287 PHE N H sing N N 288 PHE N H2 sing N N 289 PHE CA C sing N N 290 PHE CA CB sing N N 291 PHE CA HA sing N N 292 PHE C O doub N N 293 PHE C OXT sing N N 294 PHE CB CG sing N N 295 PHE CB HB2 sing N N 296 PHE CB HB3 sing N N 297 PHE CG CD1 doub Y N 298 PHE CG CD2 sing Y N 299 PHE CD1 CE1 sing Y N 300 PHE CD1 HD1 sing N N 301 PHE CD2 CE2 doub Y N 302 PHE CD2 HD2 sing N N 303 PHE CE1 CZ doub Y N 304 PHE CE1 HE1 sing N N 305 PHE CE2 CZ sing Y N 306 PHE CE2 HE2 sing N N 307 PHE CZ HZ sing N N 308 PHE OXT HXT sing N N 309 PRO N CA sing N N 310 PRO N CD sing N N 311 PRO N H sing N N 312 PRO CA C sing N N 313 PRO CA CB sing N N 314 PRO CA HA sing N N 315 PRO C O doub N N 316 PRO C OXT sing N N 317 PRO CB CG sing N N 318 PRO CB HB2 sing N N 319 PRO CB HB3 sing N N 320 PRO CG CD sing N N 321 PRO CG HG2 sing N N 322 PRO CG HG3 sing N N 323 PRO CD HD2 sing N N 324 PRO CD HD3 sing N N 325 PRO OXT HXT sing N N 326 SER N CA sing N N 327 SER N H sing N N 328 SER N H2 sing N N 329 SER CA C sing N N 330 SER CA CB sing N N 331 SER CA HA sing N N 332 SER C O doub N N 333 SER C OXT sing N N 334 SER CB OG sing N N 335 SER CB HB2 sing N N 336 SER CB HB3 sing N N 337 SER OG HG sing N N 338 SER OXT HXT sing N N 339 THR N CA sing N N 340 THR N H sing N N 341 THR N H2 sing N N 342 THR CA C sing N N 343 THR CA CB sing N N 344 THR CA HA sing N N 345 THR C O doub N N 346 THR C OXT sing N N 347 THR CB OG1 sing N N 348 THR CB CG2 sing N N 349 THR CB HB sing N N 350 THR OG1 HG1 sing N N 351 THR CG2 HG21 sing N N 352 THR CG2 HG22 sing N N 353 THR CG2 HG23 sing N N 354 THR OXT HXT sing N N 355 TRP N CA sing N N 356 TRP N H sing N N 357 TRP N H2 sing N N 358 TRP CA C sing N N 359 TRP CA CB sing N N 360 TRP CA HA sing N N 361 TRP C O doub N N 362 TRP C OXT sing N N 363 TRP CB CG sing N N 364 TRP CB HB2 sing N N 365 TRP CB HB3 sing N N 366 TRP CG CD1 doub Y N 367 TRP CG CD2 sing Y N 368 TRP CD1 NE1 sing Y N 369 TRP CD1 HD1 sing N N 370 TRP CD2 CE2 doub Y N 371 TRP CD2 CE3 sing Y N 372 TRP NE1 CE2 sing Y N 373 TRP NE1 HE1 sing N N 374 TRP CE2 CZ2 sing Y N 375 TRP CE3 CZ3 doub Y N 376 TRP CE3 HE3 sing N N 377 TRP CZ2 CH2 doub Y N 378 TRP CZ2 HZ2 sing N N 379 TRP CZ3 CH2 sing Y N 380 TRP CZ3 HZ3 sing N N 381 TRP CH2 HH2 sing N N 382 TRP OXT HXT sing N N 383 TYR N CA sing N N 384 TYR N H sing N N 385 TYR N H2 sing N N 386 TYR CA C sing N N 387 TYR CA CB sing N N 388 TYR CA HA sing N N 389 TYR C O doub N N 390 TYR C OXT sing N N 391 TYR CB CG sing N N 392 TYR CB HB2 sing N N 393 TYR CB HB3 sing N N 394 TYR CG CD1 doub Y N 395 TYR CG CD2 sing Y N 396 TYR CD1 CE1 sing Y N 397 TYR CD1 HD1 sing N N 398 TYR CD2 CE2 doub Y N 399 TYR CD2 HD2 sing N N 400 TYR CE1 CZ doub Y N 401 TYR CE1 HE1 sing N N 402 TYR CE2 CZ sing Y N 403 TYR CE2 HE2 sing N N 404 TYR CZ OH sing N N 405 TYR OH HH sing N N 406 TYR OXT HXT sing N N 407 VAL N CA sing N N 408 VAL N H sing N N 409 VAL N H2 sing N N 410 VAL CA C sing N N 411 VAL CA CB sing N N 412 VAL CA HA sing N N 413 VAL C O doub N N 414 VAL C OXT sing N N 415 VAL CB CG1 sing N N 416 VAL CB CG2 sing N N 417 VAL CB HB sing N N 418 VAL CG1 HG11 sing N N 419 VAL CG1 HG12 sing N N 420 VAL CG1 HG13 sing N N 421 VAL CG2 HG21 sing N N 422 VAL CG2 HG22 sing N N 423 VAL CG2 HG23 sing N N 424 VAL OXT HXT sing N N 425 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Ministry of Education (MoE, Singapore)' Singapore MOE2019-T2-2-099 1 'Ministry of Education (MoE, Singapore)' Singapore RG108/20 2 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 GTP ? ? GTP ? ? 'SUBJECT OF INVESTIGATION' ? 2 MG ? ? MG ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "GUANOSINE-5'-TRIPHOSPHATE" GTP 3 'MAGNESIUM ION' MG 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7VBS _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #