data_7VGT # _entry.id 7VGT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7VGT pdb_00007vgt 10.2210/pdb7vgt/pdb WWPDB D_1300024657 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-02-16 2 'Structure model' 1 1 2022-03-09 3 'Structure model' 1 2 2023-09-06 4 'Structure model' 1 3 2023-11-29 5 'Structure model' 1 4 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Refinement description' 5 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_related_exp_data_set 6 4 'Structure model' pdbx_initial_refinement_model 7 5 'Structure model' pdbx_entry_details 8 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.pdbx_database_id_DOI' 3 2 'Structure model' '_citation.pdbx_database_id_PubMed' 4 2 'Structure model' '_citation_author.identifier_ORCID' 5 2 'Structure model' '_citation_author.name' 6 5 'Structure model' '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7VGT _pdbx_database_status.recvd_initial_deposition_date 2021-09-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email toshiaki.hosaka@riken.jp _pdbx_contact_author.name_first Toshiaki _pdbx_contact_author.name_last Hosaka _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7652-8114 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Hosaka, T.' 1 ? 'Nango, E.' 2 ? 'Nakane, T.' 3 ? 'Luo, F.' 4 ? 'Kimura-Someya, T.' 5 ? 'Shirouzu, M.' 6 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 119 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Conformational alterations in unidirectional ion transport of a light-driven chloride pump revealed using X-ray free electron lasers. ; _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2117433119 _citation.pdbx_database_id_PubMed 35197289 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hosaka, T.' 1 0000-0002-7652-8114 primary 'Nomura, T.' 2 0000-0002-4613-7403 primary 'Kubo, M.' 3 0000-0002-1470-942X primary 'Nakane, T.' 4 ? primary 'Fangjia, L.' 5 ? primary 'Sekine, S.I.' 6 0000-0001-8174-8704 primary 'Ito, T.' 7 0000-0003-3704-5205 primary 'Murayama, K.' 8 0000-0003-1749-4038 primary 'Ihara, K.' 9 ? primary 'Ehara, H.' 10 0000-0002-7420-145X primary 'Kashiwagi, K.' 11 ? primary 'Katsura, K.' 12 ? primary 'Akasaka, R.' 13 ? primary 'Hisano, T.' 14 ? primary 'Tanaka, T.' 15 ? primary 'Tanaka, R.' 16 ? primary 'Arima, T.' 17 ? primary 'Yamashita, A.' 18 ? primary 'Sugahara, M.' 19 ? primary 'Naitow, H.' 20 ? primary 'Matsuura, Y.' 21 ? primary 'Yoshizawa, S.' 22 ? primary 'Tono, K.' 23 0000-0003-1218-3759 primary 'Owada, S.' 24 0000-0002-1451-7612 primary 'Nureki, O.' 25 0000-0003-1813-7008 primary 'Kimura-Someya, T.' 26 0000-0003-2232-1801 primary 'Iwata, S.' 27 ? primary 'Nango, E.' 28 0000-0001-9851-7355 primary 'Shirouzu, M.' 29 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Chloride pumping rhodopsin' 30710.936 1 ? ? ? ? 2 non-polymer syn RETINAL 284.436 1 ? ? ? ? 3 non-polymer syn HEXANE 86.175 4 ? ? ? ? 4 non-polymer syn DECANE 142.282 3 ? ? ? ? 5 non-polymer syn 'BROMIDE ION' 79.904 3 ? ? ? ? 6 water nat water 18.015 53 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGMKNIESLFDYSAGQFEFIDHLLTMGVGVHFAALIFFLVVSQFVAPKYRIATALSCIVMVSAGLILNSQAVMWT DAYAYVDGSYQLQDLTFSNGYRYVNWMATIPCLLLQLLIVLNLKGKELFSTATWLILAAWGMIITGYVGQLYEVDDIAQL MIWGAVSTAFFVVMNWIVGTKIFKNRATMLGGTDSTITKVFWLMMFAWTLYPIAYLVPAFMNNADGVVLRQLLFTIADIS SKVIYGLMITYIAIQQSAAAGYVPAQQALGRIGMDSKAA ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGMKNIESLFDYSAGQFEFIDHLLTMGVGVHFAALIFFLVVSQFVAPKYRIATALSCIVMVSAGLILNSQAVMWT DAYAYVDGSYQLQDLTFSNGYRYVNWMATIPCLLLQLLIVLNLKGKELFSTATWLILAAWGMIITGYVGQLYEVDDIAQL MIWGAVSTAFFVVMNWIVGTKIFKNRATMLGGTDSTITKVFWLMMFAWTLYPIAYLVPAFMNNADGVVLRQLLFTIADIS SKVIYGLMITYIAIQQSAAAGYVPAQQALGRIGMDSKAA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 RETINAL RET 3 HEXANE HEX 4 DECANE D10 5 'BROMIDE ION' BR 6 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 MET n 1 9 LYS n 1 10 ASN n 1 11 ILE n 1 12 GLU n 1 13 SER n 1 14 LEU n 1 15 PHE n 1 16 ASP n 1 17 TYR n 1 18 SER n 1 19 ALA n 1 20 GLY n 1 21 GLN n 1 22 PHE n 1 23 GLU n 1 24 PHE n 1 25 ILE n 1 26 ASP n 1 27 HIS n 1 28 LEU n 1 29 LEU n 1 30 THR n 1 31 MET n 1 32 GLY n 1 33 VAL n 1 34 GLY n 1 35 VAL n 1 36 HIS n 1 37 PHE n 1 38 ALA n 1 39 ALA n 1 40 LEU n 1 41 ILE n 1 42 PHE n 1 43 PHE n 1 44 LEU n 1 45 VAL n 1 46 VAL n 1 47 SER n 1 48 GLN n 1 49 PHE n 1 50 VAL n 1 51 ALA n 1 52 PRO n 1 53 LYS n 1 54 TYR n 1 55 ARG n 1 56 ILE n 1 57 ALA n 1 58 THR n 1 59 ALA n 1 60 LEU n 1 61 SER n 1 62 CYS n 1 63 ILE n 1 64 VAL n 1 65 MET n 1 66 VAL n 1 67 SER n 1 68 ALA n 1 69 GLY n 1 70 LEU n 1 71 ILE n 1 72 LEU n 1 73 ASN n 1 74 SER n 1 75 GLN n 1 76 ALA n 1 77 VAL n 1 78 MET n 1 79 TRP n 1 80 THR n 1 81 ASP n 1 82 ALA n 1 83 TYR n 1 84 ALA n 1 85 TYR n 1 86 VAL n 1 87 ASP n 1 88 GLY n 1 89 SER n 1 90 TYR n 1 91 GLN n 1 92 LEU n 1 93 GLN n 1 94 ASP n 1 95 LEU n 1 96 THR n 1 97 PHE n 1 98 SER n 1 99 ASN n 1 100 GLY n 1 101 TYR n 1 102 ARG n 1 103 TYR n 1 104 VAL n 1 105 ASN n 1 106 TRP n 1 107 MET n 1 108 ALA n 1 109 THR n 1 110 ILE n 1 111 PRO n 1 112 CYS n 1 113 LEU n 1 114 LEU n 1 115 LEU n 1 116 GLN n 1 117 LEU n 1 118 LEU n 1 119 ILE n 1 120 VAL n 1 121 LEU n 1 122 ASN n 1 123 LEU n 1 124 LYS n 1 125 GLY n 1 126 LYS n 1 127 GLU n 1 128 LEU n 1 129 PHE n 1 130 SER n 1 131 THR n 1 132 ALA n 1 133 THR n 1 134 TRP n 1 135 LEU n 1 136 ILE n 1 137 LEU n 1 138 ALA n 1 139 ALA n 1 140 TRP n 1 141 GLY n 1 142 MET n 1 143 ILE n 1 144 ILE n 1 145 THR n 1 146 GLY n 1 147 TYR n 1 148 VAL n 1 149 GLY n 1 150 GLN n 1 151 LEU n 1 152 TYR n 1 153 GLU n 1 154 VAL n 1 155 ASP n 1 156 ASP n 1 157 ILE n 1 158 ALA n 1 159 GLN n 1 160 LEU n 1 161 MET n 1 162 ILE n 1 163 TRP n 1 164 GLY n 1 165 ALA n 1 166 VAL n 1 167 SER n 1 168 THR n 1 169 ALA n 1 170 PHE n 1 171 PHE n 1 172 VAL n 1 173 VAL n 1 174 MET n 1 175 ASN n 1 176 TRP n 1 177 ILE n 1 178 VAL n 1 179 GLY n 1 180 THR n 1 181 LYS n 1 182 ILE n 1 183 PHE n 1 184 LYS n 1 185 ASN n 1 186 ARG n 1 187 ALA n 1 188 THR n 1 189 MET n 1 190 LEU n 1 191 GLY n 1 192 GLY n 1 193 THR n 1 194 ASP n 1 195 SER n 1 196 THR n 1 197 ILE n 1 198 THR n 1 199 LYS n 1 200 VAL n 1 201 PHE n 1 202 TRP n 1 203 LEU n 1 204 MET n 1 205 MET n 1 206 PHE n 1 207 ALA n 1 208 TRP n 1 209 THR n 1 210 LEU n 1 211 TYR n 1 212 PRO n 1 213 ILE n 1 214 ALA n 1 215 TYR n 1 216 LEU n 1 217 VAL n 1 218 PRO n 1 219 ALA n 1 220 PHE n 1 221 MET n 1 222 ASN n 1 223 ASN n 1 224 ALA n 1 225 ASP n 1 226 GLY n 1 227 VAL n 1 228 VAL n 1 229 LEU n 1 230 ARG n 1 231 GLN n 1 232 LEU n 1 233 LEU n 1 234 PHE n 1 235 THR n 1 236 ILE n 1 237 ALA n 1 238 ASP n 1 239 ILE n 1 240 SER n 1 241 SER n 1 242 LYS n 1 243 VAL n 1 244 ILE n 1 245 TYR n 1 246 GLY n 1 247 LEU n 1 248 MET n 1 249 ILE n 1 250 THR n 1 251 TYR n 1 252 ILE n 1 253 ALA n 1 254 ILE n 1 255 GLN n 1 256 GLN n 1 257 SER n 1 258 ALA n 1 259 ALA n 1 260 ALA n 1 261 GLY n 1 262 TYR n 1 263 VAL n 1 264 PRO n 1 265 ALA n 1 266 GLN n 1 267 GLN n 1 268 ALA n 1 269 LEU n 1 270 GLY n 1 271 ARG n 1 272 ILE n 1 273 GLY n 1 274 MET n 1 275 ASP n 1 276 SER n 1 277 LYS n 1 278 ALA n 1 279 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 279 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ClR, NMS_1267' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Nonlabens marinus S1-08' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1454201 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BR non-polymer . 'BROMIDE ION' ? 'Br -1' 79.904 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 D10 non-polymer . DECANE ? 'C10 H22' 142.282 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEX non-polymer . HEXANE ? 'C6 H14' 86.175 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 RET non-polymer . RETINAL ? 'C20 H28 O' 284.436 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -6 ? ? ? A . n A 1 2 SER 2 -5 ? ? ? A . n A 1 3 SER 3 -4 ? ? ? A . n A 1 4 GLY 4 -3 ? ? ? A . n A 1 5 SER 5 -2 ? ? ? A . n A 1 6 SER 6 -1 ? ? ? A . n A 1 7 GLY 7 0 ? ? ? A . n A 1 8 MET 8 1 1 MET MET A . n A 1 9 LYS 9 2 2 LYS LYS A . n A 1 10 ASN 10 3 3 ASN ASN A . n A 1 11 ILE 11 4 4 ILE ILE A . n A 1 12 GLU 12 5 5 GLU GLU A . n A 1 13 SER 13 6 6 SER SER A . n A 1 14 LEU 14 7 7 LEU LEU A . n A 1 15 PHE 15 8 8 PHE PHE A . n A 1 16 ASP 16 9 9 ASP ASP A . n A 1 17 TYR 17 10 10 TYR TYR A . n A 1 18 SER 18 11 11 SER SER A . n A 1 19 ALA 19 12 12 ALA ALA A . n A 1 20 GLY 20 13 13 GLY GLY A . n A 1 21 GLN 21 14 14 GLN GLN A . n A 1 22 PHE 22 15 15 PHE PHE A . n A 1 23 GLU 23 16 16 GLU GLU A . n A 1 24 PHE 24 17 17 PHE PHE A . n A 1 25 ILE 25 18 18 ILE ILE A . n A 1 26 ASP 26 19 19 ASP ASP A . n A 1 27 HIS 27 20 20 HIS HIS A . n A 1 28 LEU 28 21 21 LEU LEU A . n A 1 29 LEU 29 22 22 LEU LEU A . n A 1 30 THR 30 23 23 THR THR A . n A 1 31 MET 31 24 24 MET MET A . n A 1 32 GLY 32 25 25 GLY GLY A . n A 1 33 VAL 33 26 26 VAL VAL A . n A 1 34 GLY 34 27 27 GLY GLY A . n A 1 35 VAL 35 28 28 VAL VAL A . n A 1 36 HIS 36 29 29 HIS HIS A . n A 1 37 PHE 37 30 30 PHE PHE A . n A 1 38 ALA 38 31 31 ALA ALA A . n A 1 39 ALA 39 32 32 ALA ALA A . n A 1 40 LEU 40 33 33 LEU LEU A . n A 1 41 ILE 41 34 34 ILE ILE A . n A 1 42 PHE 42 35 35 PHE PHE A . n A 1 43 PHE 43 36 36 PHE PHE A . n A 1 44 LEU 44 37 37 LEU LEU A . n A 1 45 VAL 45 38 38 VAL VAL A . n A 1 46 VAL 46 39 39 VAL VAL A . n A 1 47 SER 47 40 40 SER SER A . n A 1 48 GLN 48 41 41 GLN GLN A . n A 1 49 PHE 49 42 42 PHE PHE A . n A 1 50 VAL 50 43 43 VAL VAL A . n A 1 51 ALA 51 44 44 ALA ALA A . n A 1 52 PRO 52 45 45 PRO PRO A . n A 1 53 LYS 53 46 46 LYS LYS A . n A 1 54 TYR 54 47 47 TYR TYR A . n A 1 55 ARG 55 48 48 ARG ARG A . n A 1 56 ILE 56 49 49 ILE ILE A . n A 1 57 ALA 57 50 50 ALA ALA A . n A 1 58 THR 58 51 51 THR THR A . n A 1 59 ALA 59 52 52 ALA ALA A . n A 1 60 LEU 60 53 53 LEU LEU A . n A 1 61 SER 61 54 54 SER SER A . n A 1 62 CYS 62 55 55 CYS CYS A . n A 1 63 ILE 63 56 56 ILE ILE A . n A 1 64 VAL 64 57 57 VAL VAL A . n A 1 65 MET 65 58 58 MET MET A . n A 1 66 VAL 66 59 59 VAL VAL A . n A 1 67 SER 67 60 60 SER SER A . n A 1 68 ALA 68 61 61 ALA ALA A . n A 1 69 GLY 69 62 62 GLY GLY A . n A 1 70 LEU 70 63 63 LEU LEU A . n A 1 71 ILE 71 64 64 ILE ILE A . n A 1 72 LEU 72 65 65 LEU LEU A . n A 1 73 ASN 73 66 66 ASN ASN A . n A 1 74 SER 74 67 67 SER SER A . n A 1 75 GLN 75 68 68 GLN GLN A . n A 1 76 ALA 76 69 69 ALA ALA A . n A 1 77 VAL 77 70 70 VAL VAL A . n A 1 78 MET 78 71 71 MET MET A . n A 1 79 TRP 79 72 72 TRP TRP A . n A 1 80 THR 80 73 73 THR THR A . n A 1 81 ASP 81 74 74 ASP ASP A . n A 1 82 ALA 82 75 75 ALA ALA A . n A 1 83 TYR 83 76 76 TYR TYR A . n A 1 84 ALA 84 77 77 ALA ALA A . n A 1 85 TYR 85 78 78 TYR TYR A . n A 1 86 VAL 86 79 79 VAL VAL A . n A 1 87 ASP 87 80 80 ASP ASP A . n A 1 88 GLY 88 81 81 GLY GLY A . n A 1 89 SER 89 82 82 SER SER A . n A 1 90 TYR 90 83 83 TYR TYR A . n A 1 91 GLN 91 84 84 GLN GLN A . n A 1 92 LEU 92 85 85 LEU LEU A . n A 1 93 GLN 93 86 86 GLN GLN A . n A 1 94 ASP 94 87 87 ASP ASP A . n A 1 95 LEU 95 88 88 LEU LEU A . n A 1 96 THR 96 89 89 THR THR A . n A 1 97 PHE 97 90 90 PHE PHE A . n A 1 98 SER 98 91 91 SER SER A . n A 1 99 ASN 99 92 92 ASN ASN A . n A 1 100 GLY 100 93 93 GLY GLY A . n A 1 101 TYR 101 94 94 TYR TYR A . n A 1 102 ARG 102 95 95 ARG ARG A . n A 1 103 TYR 103 96 96 TYR TYR A . n A 1 104 VAL 104 97 97 VAL VAL A . n A 1 105 ASN 105 98 98 ASN ASN A . n A 1 106 TRP 106 99 99 TRP TRP A . n A 1 107 MET 107 100 100 MET MET A . n A 1 108 ALA 108 101 101 ALA ALA A . n A 1 109 THR 109 102 102 THR THR A . n A 1 110 ILE 110 103 103 ILE ILE A . n A 1 111 PRO 111 104 104 PRO PRO A . n A 1 112 CYS 112 105 105 CYS CYS A . n A 1 113 LEU 113 106 106 LEU LEU A . n A 1 114 LEU 114 107 107 LEU LEU A . n A 1 115 LEU 115 108 108 LEU LEU A . n A 1 116 GLN 116 109 109 GLN GLN A . n A 1 117 LEU 117 110 110 LEU LEU A . n A 1 118 LEU 118 111 111 LEU LEU A . n A 1 119 ILE 119 112 112 ILE ILE A . n A 1 120 VAL 120 113 113 VAL VAL A . n A 1 121 LEU 121 114 114 LEU LEU A . n A 1 122 ASN 122 115 115 ASN ASN A . n A 1 123 LEU 123 116 116 LEU LEU A . n A 1 124 LYS 124 117 117 LYS LYS A . n A 1 125 GLY 125 118 118 GLY GLY A . n A 1 126 LYS 126 119 119 LYS LYS A . n A 1 127 GLU 127 120 120 GLU GLU A . n A 1 128 LEU 128 121 121 LEU LEU A . n A 1 129 PHE 129 122 122 PHE PHE A . n A 1 130 SER 130 123 123 SER SER A . n A 1 131 THR 131 124 124 THR THR A . n A 1 132 ALA 132 125 125 ALA ALA A . n A 1 133 THR 133 126 126 THR THR A . n A 1 134 TRP 134 127 127 TRP TRP A . n A 1 135 LEU 135 128 128 LEU LEU A . n A 1 136 ILE 136 129 129 ILE ILE A . n A 1 137 LEU 137 130 130 LEU LEU A . n A 1 138 ALA 138 131 131 ALA ALA A . n A 1 139 ALA 139 132 132 ALA ALA A . n A 1 140 TRP 140 133 133 TRP TRP A . n A 1 141 GLY 141 134 134 GLY GLY A . n A 1 142 MET 142 135 135 MET MET A . n A 1 143 ILE 143 136 136 ILE ILE A . n A 1 144 ILE 144 137 137 ILE ILE A . n A 1 145 THR 145 138 138 THR THR A . n A 1 146 GLY 146 139 139 GLY GLY A . n A 1 147 TYR 147 140 140 TYR TYR A . n A 1 148 VAL 148 141 141 VAL VAL A . n A 1 149 GLY 149 142 142 GLY GLY A . n A 1 150 GLN 150 143 143 GLN GLN A . n A 1 151 LEU 151 144 144 LEU LEU A . n A 1 152 TYR 152 145 145 TYR TYR A . n A 1 153 GLU 153 146 146 GLU GLU A . n A 1 154 VAL 154 147 147 VAL VAL A . n A 1 155 ASP 155 148 148 ASP ASP A . n A 1 156 ASP 156 149 149 ASP ASP A . n A 1 157 ILE 157 150 150 ILE ILE A . n A 1 158 ALA 158 151 151 ALA ALA A . n A 1 159 GLN 159 152 152 GLN GLN A . n A 1 160 LEU 160 153 153 LEU LEU A . n A 1 161 MET 161 154 154 MET MET A . n A 1 162 ILE 162 155 155 ILE ILE A . n A 1 163 TRP 163 156 156 TRP TRP A . n A 1 164 GLY 164 157 157 GLY GLY A . n A 1 165 ALA 165 158 158 ALA ALA A . n A 1 166 VAL 166 159 159 VAL VAL A . n A 1 167 SER 167 160 160 SER SER A . n A 1 168 THR 168 161 161 THR THR A . n A 1 169 ALA 169 162 162 ALA ALA A . n A 1 170 PHE 170 163 163 PHE PHE A . n A 1 171 PHE 171 164 164 PHE PHE A . n A 1 172 VAL 172 165 165 VAL VAL A . n A 1 173 VAL 173 166 166 VAL VAL A . n A 1 174 MET 174 167 167 MET MET A . n A 1 175 ASN 175 168 168 ASN ASN A . n A 1 176 TRP 176 169 169 TRP TRP A . n A 1 177 ILE 177 170 170 ILE ILE A . n A 1 178 VAL 178 171 171 VAL VAL A . n A 1 179 GLY 179 172 172 GLY GLY A . n A 1 180 THR 180 173 173 THR THR A . n A 1 181 LYS 181 174 174 LYS LYS A . n A 1 182 ILE 182 175 175 ILE ILE A . n A 1 183 PHE 183 176 176 PHE PHE A . n A 1 184 LYS 184 177 177 LYS LYS A . n A 1 185 ASN 185 178 178 ASN ASN A . n A 1 186 ARG 186 179 179 ARG ARG A . n A 1 187 ALA 187 180 180 ALA ALA A . n A 1 188 THR 188 181 181 THR THR A . n A 1 189 MET 189 182 182 MET MET A . n A 1 190 LEU 190 183 183 LEU LEU A . n A 1 191 GLY 191 184 184 GLY GLY A . n A 1 192 GLY 192 185 185 GLY GLY A . n A 1 193 THR 193 186 186 THR THR A . n A 1 194 ASP 194 187 187 ASP ASP A . n A 1 195 SER 195 188 188 SER SER A . n A 1 196 THR 196 189 189 THR THR A . n A 1 197 ILE 197 190 190 ILE ILE A . n A 1 198 THR 198 191 191 THR THR A . n A 1 199 LYS 199 192 192 LYS LYS A . n A 1 200 VAL 200 193 193 VAL VAL A . n A 1 201 PHE 201 194 194 PHE PHE A . n A 1 202 TRP 202 195 195 TRP TRP A . n A 1 203 LEU 203 196 196 LEU LEU A . n A 1 204 MET 204 197 197 MET MET A . n A 1 205 MET 205 198 198 MET MET A . n A 1 206 PHE 206 199 199 PHE PHE A . n A 1 207 ALA 207 200 200 ALA ALA A . n A 1 208 TRP 208 201 201 TRP TRP A . n A 1 209 THR 209 202 202 THR THR A . n A 1 210 LEU 210 203 203 LEU LEU A . n A 1 211 TYR 211 204 204 TYR TYR A . n A 1 212 PRO 212 205 205 PRO PRO A . n A 1 213 ILE 213 206 206 ILE ILE A . n A 1 214 ALA 214 207 207 ALA ALA A . n A 1 215 TYR 215 208 208 TYR TYR A . n A 1 216 LEU 216 209 209 LEU LEU A . n A 1 217 VAL 217 210 210 VAL VAL A . n A 1 218 PRO 218 211 211 PRO PRO A . n A 1 219 ALA 219 212 212 ALA ALA A . n A 1 220 PHE 220 213 213 PHE PHE A . n A 1 221 MET 221 214 214 MET MET A . n A 1 222 ASN 222 215 215 ASN ASN A . n A 1 223 ASN 223 216 216 ASN ASN A . n A 1 224 ALA 224 217 217 ALA ALA A . n A 1 225 ASP 225 218 218 ASP ASP A . n A 1 226 GLY 226 219 219 GLY GLY A . n A 1 227 VAL 227 220 220 VAL VAL A . n A 1 228 VAL 228 221 221 VAL VAL A . n A 1 229 LEU 229 222 222 LEU LEU A . n A 1 230 ARG 230 223 223 ARG ARG A . n A 1 231 GLN 231 224 224 GLN GLN A . n A 1 232 LEU 232 225 225 LEU LEU A . n A 1 233 LEU 233 226 226 LEU LEU A . n A 1 234 PHE 234 227 227 PHE PHE A . n A 1 235 THR 235 228 228 THR THR A . n A 1 236 ILE 236 229 229 ILE ILE A . n A 1 237 ALA 237 230 230 ALA ALA A . n A 1 238 ASP 238 231 231 ASP ASP A . n A 1 239 ILE 239 232 232 ILE ILE A . n A 1 240 SER 240 233 233 SER SER A . n A 1 241 SER 241 234 234 SER SER A . n A 1 242 LYS 242 235 235 LYS LYS A . n A 1 243 VAL 243 236 236 VAL VAL A . n A 1 244 ILE 244 237 237 ILE ILE A . n A 1 245 TYR 245 238 238 TYR TYR A . n A 1 246 GLY 246 239 239 GLY GLY A . n A 1 247 LEU 247 240 240 LEU LEU A . n A 1 248 MET 248 241 241 MET MET A . n A 1 249 ILE 249 242 242 ILE ILE A . n A 1 250 THR 250 243 243 THR THR A . n A 1 251 TYR 251 244 244 TYR TYR A . n A 1 252 ILE 252 245 245 ILE ILE A . n A 1 253 ALA 253 246 246 ALA ALA A . n A 1 254 ILE 254 247 247 ILE ILE A . n A 1 255 GLN 255 248 248 GLN GLN A . n A 1 256 GLN 256 249 249 GLN GLN A . n A 1 257 SER 257 250 250 SER SER A . n A 1 258 ALA 258 251 251 ALA ALA A . n A 1 259 ALA 259 252 252 ALA ALA A . n A 1 260 ALA 260 253 253 ALA ALA A . n A 1 261 GLY 261 254 254 GLY GLY A . n A 1 262 TYR 262 255 255 TYR TYR A . n A 1 263 VAL 263 256 256 VAL VAL A . n A 1 264 PRO 264 257 257 PRO PRO A . n A 1 265 ALA 265 258 258 ALA ALA A . n A 1 266 GLN 266 259 259 GLN GLN A . n A 1 267 GLN 267 260 260 GLN GLN A . n A 1 268 ALA 268 261 261 ALA ALA A . n A 1 269 LEU 269 262 262 LEU LEU A . n A 1 270 GLY 270 263 263 GLY GLY A . n A 1 271 ARG 271 264 264 ARG ARG A . n A 1 272 ILE 272 265 265 ILE ILE A . n A 1 273 GLY 273 266 ? ? ? A . n A 1 274 MET 274 267 ? ? ? A . n A 1 275 ASP 275 268 ? ? ? A . n A 1 276 SER 276 269 ? ? ? A . n A 1 277 LYS 277 270 ? ? ? A . n A 1 278 ALA 278 271 ? ? ? A . n A 1 279 ALA 279 272 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 RET 1 301 1 RET RET A . C 3 HEX 1 302 1 HEX HEX A . D 3 HEX 1 303 2 HEX HEX A . E 3 HEX 1 304 3 HEX HEX A . F 3 HEX 1 305 4 HEX HEX A . G 4 D10 1 306 2 D10 D10 A . H 4 D10 1 307 3 D10 D10 A . I 4 D10 1 308 4 D10 D10 A . J 5 BR 1 309 1 BR BR A . K 5 BR 1 310 2 BR BR A . L 5 BR 1 311 3 BR BR A . M 6 HOH 1 401 552 HOH HOH A . M 6 HOH 2 402 404 HOH HOH A . M 6 HOH 3 403 524 HOH HOH A . M 6 HOH 4 404 507 HOH HOH A . M 6 HOH 5 405 401 HOH HOH A . M 6 HOH 6 406 411 HOH HOH A . M 6 HOH 7 407 405 HOH HOH A . M 6 HOH 8 408 410 HOH HOH A . M 6 HOH 9 409 417 HOH HOH A . M 6 HOH 10 410 435 HOH HOH A . M 6 HOH 11 411 408 HOH HOH A . M 6 HOH 12 412 504 HOH HOH A . M 6 HOH 13 413 402 HOH HOH A . M 6 HOH 14 414 406 HOH HOH A . M 6 HOH 15 415 447 HOH HOH A . M 6 HOH 16 416 528 HOH HOH A . M 6 HOH 17 417 512 HOH HOH A . M 6 HOH 18 418 420 HOH HOH A . M 6 HOH 19 419 501 HOH HOH A . M 6 HOH 20 420 514 HOH HOH A . M 6 HOH 21 421 439 HOH HOH A . M 6 HOH 22 422 503 HOH HOH A . M 6 HOH 23 423 407 HOH HOH A . M 6 HOH 24 424 429 HOH HOH A . M 6 HOH 25 425 461 HOH HOH A . M 6 HOH 26 426 523 HOH HOH A . M 6 HOH 27 427 434 HOH HOH A . M 6 HOH 28 428 508 HOH HOH A . M 6 HOH 29 429 454 HOH HOH A . M 6 HOH 30 430 511 HOH HOH A . M 6 HOH 31 431 544 HOH HOH A . M 6 HOH 32 432 462 HOH HOH A . M 6 HOH 33 433 467 HOH HOH A . M 6 HOH 34 434 502 HOH HOH A . M 6 HOH 35 435 422 HOH HOH A . M 6 HOH 36 436 513 HOH HOH A . M 6 HOH 37 437 526 HOH HOH A . M 6 HOH 38 438 510 HOH HOH A . M 6 HOH 39 439 403 HOH HOH A . M 6 HOH 40 440 424 HOH HOH A . M 6 HOH 41 441 442 HOH HOH A . M 6 HOH 42 442 509 HOH HOH A . M 6 HOH 43 443 438 HOH HOH A . M 6 HOH 44 444 433 HOH HOH A . M 6 HOH 45 445 455 HOH HOH A . M 6 HOH 46 446 421 HOH HOH A . M 6 HOH 47 447 458 HOH HOH A . M 6 HOH 48 448 425 HOH HOH A . M 6 HOH 49 449 412 HOH HOH A . M 6 HOH 50 450 457 HOH HOH A . M 6 HOH 51 451 517 HOH HOH A . M 6 HOH 52 452 515 HOH HOH A . M 6 HOH 53 453 436 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 117 ? CG ? A LYS 124 CG 2 1 Y 1 A LYS 117 ? CD ? A LYS 124 CD 3 1 Y 1 A LYS 117 ? CE ? A LYS 124 CE 4 1 Y 1 A LYS 117 ? NZ ? A LYS 124 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16_3549 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? CrystFEL ? ? ? 0.63 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? CrystFEL ? ? ? 0.63 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 131.500 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7VGT _cell.details ? _cell.formula_units_Z ? _cell.length_a 104.300 _cell.length_a_esd ? _cell.length_b 51.100 _cell.length_b_esd ? _cell.length_c 78.400 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7VGT _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7VGT _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.55 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.72 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'LIPIDIC CUBIC PHASE' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '38% PEG400, 300 mM K phosphate, and 100 mM HEPES (pH7.0)' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 293 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment Y # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type MPCCD _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-02-02 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.7714 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'FREE ELECTRON LASER' _diffrn_source.target ? _diffrn_source.type 'SACLA BEAMLINE BL3' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.7714 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL3 _diffrn_source.pdbx_synchrotron_site SACLA # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7VGT _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.10 _reflns.d_resolution_low 42.8 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18261 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 213 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.35 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.988 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.10 _reflns_shell.d_res_low 2.14 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 929 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.895 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 149.380 _refine.B_iso_mean 32.7893 _refine.B_iso_min 14.980 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7VGT _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1000 _refine.ls_d_res_low 29.3590 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18203 _refine.ls_number_reflns_R_free 899 _refine.ls_number_reflns_R_work 17304 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.7400 _refine.ls_percent_reflns_R_free 4.9400 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1775 _refine.ls_R_factor_R_free 0.2075 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1759 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.390 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5B2N _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 20.5100 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.1000 _refine_hist.d_res_low 29.3590 _refine_hist.number_atoms_solvent 53 _refine_hist.number_atoms_total 2206 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 265 _refine_hist.pdbx_B_iso_mean_ligand 45.55 _refine_hist.pdbx_B_iso_mean_solvent 41.58 _refine_hist.pdbx_number_atoms_protein 2076 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 77 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1002 2.2317 . . 140 2866 99.0000 . . . 0.2368 0.0000 0.1852 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2317 2.4040 . . 163 2828 100.0000 . . . 0.2110 0.0000 0.1698 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4040 2.6457 . . 161 2859 100.0000 . . . 0.2039 0.0000 0.1647 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6457 3.0283 . . 141 2900 100.0000 . . . 0.2001 0.0000 0.1685 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0283 3.8140 . . 143 2889 100.0000 . . . 0.1853 0.0000 0.1668 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.8140 29.3590 . . 151 2962 100.0000 . . . 0.2194 0.0000 0.1883 . . . . . . . . . . . # _struct.entry_id 7VGT _struct.title ;Time-resolved serial femtosecond crystallography structure of light-driven chloride ion-pumping rhodopsin, NM-R3: resting state structure with bromide ion ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7VGT _struct_keywords.text 'SACLA serial femtosecond crystallography CELL-FREE SYNTHESIS Bacterial type rhodopsin chloride ion pump rhodopsin, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 4 ? H N N 4 ? I N N 4 ? J N N 5 ? K N N 5 ? L N N 5 ? M N N 6 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code W8VZW3_9FLAO _struct_ref.pdbx_db_accession W8VZW3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKNIESLFDYSAGQFEFIDHLLTMGVGVHFAALIFFLVVSQFVAPKYRIATALSCIVMVSAGLILNSQAVMWTDAYAYVD GSYQLQDLTFSNGYRYVNWMATIPCLLLQLLIVLNLKGKELFSTATWLILAAWGMIITGYVGQLYEVDDIAQLMIWGAVS TAFFVVMNWIVGTKIFKNRATMLGGTDSTITKVFWLMMFAWTLYPIAYLVPAFMNNADGVVLRQLLFTIADISSKVIYGL MITYIAIQQSAAAGYVPAQQALGRIGMDSKAA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7VGT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 279 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession W8VZW3 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 272 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 272 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7VGT GLY A 1 ? UNP W8VZW3 ? ? 'expression tag' -6 1 1 7VGT SER A 2 ? UNP W8VZW3 ? ? 'expression tag' -5 2 1 7VGT SER A 3 ? UNP W8VZW3 ? ? 'expression tag' -4 3 1 7VGT GLY A 4 ? UNP W8VZW3 ? ? 'expression tag' -3 4 1 7VGT SER A 5 ? UNP W8VZW3 ? ? 'expression tag' -2 5 1 7VGT SER A 6 ? UNP W8VZW3 ? ? 'expression tag' -1 6 1 7VGT GLY A 7 ? UNP W8VZW3 ? ? 'expression tag' 0 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2270 ? 1 MORE 13 ? 1 'SSA (A^2)' 12340 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J,K,L,M # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 10 ? PHE A 15 ? ASN A 3 PHE A 8 5 ? 6 HELX_P HELX_P2 AA2 SER A 18 ? SER A 47 ? SER A 11 SER A 40 1 ? 30 HELX_P HELX_P3 AA3 GLN A 48 ? VAL A 50 ? GLN A 41 VAL A 43 5 ? 3 HELX_P HELX_P4 AA4 TYR A 54 ? ALA A 82 ? TYR A 47 ALA A 75 1 ? 29 HELX_P HELX_P5 AA5 ASN A 99 ? LEU A 121 ? ASN A 92 LEU A 114 1 ? 23 HELX_P HELX_P6 AA6 LYS A 124 ? LEU A 151 ? LYS A 117 LEU A 144 1 ? 28 HELX_P HELX_P7 AA7 ASP A 156 ? ARG A 186 ? ASP A 149 ARG A 179 1 ? 31 HELX_P HELX_P8 AA8 ALA A 187 ? MET A 189 ? ALA A 180 MET A 182 5 ? 3 HELX_P HELX_P9 AA9 GLY A 192 ? LEU A 216 ? GLY A 185 LEU A 209 1 ? 25 HELX_P HELX_P10 AB1 LEU A 216 ? MET A 221 ? LEU A 209 MET A 214 1 ? 6 HELX_P HELX_P11 AB2 ASN A 223 ? ALA A 260 ? ASN A 216 ALA A 253 1 ? 38 HELX_P HELX_P12 AB3 TYR A 262 ? ILE A 272 ? TYR A 255 ILE A 265 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id LYS _struct_conn.ptnr1_label_seq_id 242 _struct_conn.ptnr1_label_atom_id NZ _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id RET _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id C15 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id LYS _struct_conn.ptnr1_auth_seq_id 235 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id RET _struct_conn.ptnr2_auth_seq_id 301 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.310 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id RET _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id LYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 242 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id RET _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 301 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id LYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 235 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom C15 _pdbx_modification_feature.modified_residue_id_linking_atom NZ _pdbx_modification_feature.modified_residue_id LYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id RET _pdbx_modification_feature.type Retinoylation _pdbx_modification_feature.category Lipid/lipid-like # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 83 ? VAL A 86 ? TYR A 76 VAL A 79 AA1 2 SER A 89 ? LEU A 92 ? SER A 82 LEU A 85 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 86 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 79 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id SER _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 89 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id SER _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 82 # _pdbx_entry_details.entry_id 7VGT _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id GLN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 86 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -107.33 _pdbx_validate_torsion.psi -151.35 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -6 ? A GLY 1 2 1 Y 1 A SER -5 ? A SER 2 3 1 Y 1 A SER -4 ? A SER 3 4 1 Y 1 A GLY -3 ? A GLY 4 5 1 Y 1 A SER -2 ? A SER 5 6 1 Y 1 A SER -1 ? A SER 6 7 1 Y 1 A GLY 0 ? A GLY 7 8 1 Y 1 A GLY 266 ? A GLY 273 9 1 Y 1 A MET 267 ? A MET 274 10 1 Y 1 A ASP 268 ? A ASP 275 11 1 Y 1 A SER 269 ? A SER 276 12 1 Y 1 A LYS 270 ? A LYS 277 13 1 Y 1 A ALA 271 ? A ALA 278 14 1 Y 1 A ALA 272 ? A ALA 279 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BR BR BR N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 D10 C1 C N N 89 D10 C2 C N N 90 D10 C3 C N N 91 D10 C4 C N N 92 D10 C5 C N N 93 D10 C6 C N N 94 D10 C7 C N N 95 D10 C8 C N N 96 D10 C9 C N N 97 D10 C10 C N N 98 D10 H11 H N N 99 D10 H12 H N N 100 D10 H13 H N N 101 D10 H21 H N N 102 D10 H22 H N N 103 D10 H31 H N N 104 D10 H32 H N N 105 D10 H41 H N N 106 D10 H42 H N N 107 D10 H51 H N N 108 D10 H52 H N N 109 D10 H61 H N N 110 D10 H62 H N N 111 D10 H71 H N N 112 D10 H72 H N N 113 D10 H81 H N N 114 D10 H82 H N N 115 D10 H91 H N N 116 D10 H92 H N N 117 D10 H101 H N N 118 D10 H102 H N N 119 D10 H103 H N N 120 GLN N N N N 121 GLN CA C N S 122 GLN C C N N 123 GLN O O N N 124 GLN CB C N N 125 GLN CG C N N 126 GLN CD C N N 127 GLN OE1 O N N 128 GLN NE2 N N N 129 GLN OXT O N N 130 GLN H H N N 131 GLN H2 H N N 132 GLN HA H N N 133 GLN HB2 H N N 134 GLN HB3 H N N 135 GLN HG2 H N N 136 GLN HG3 H N N 137 GLN HE21 H N N 138 GLN HE22 H N N 139 GLN HXT H N N 140 GLU N N N N 141 GLU CA C N S 142 GLU C C N N 143 GLU O O N N 144 GLU CB C N N 145 GLU CG C N N 146 GLU CD C N N 147 GLU OE1 O N N 148 GLU OE2 O N N 149 GLU OXT O N N 150 GLU H H N N 151 GLU H2 H N N 152 GLU HA H N N 153 GLU HB2 H N N 154 GLU HB3 H N N 155 GLU HG2 H N N 156 GLU HG3 H N N 157 GLU HE2 H N N 158 GLU HXT H N N 159 GLY N N N N 160 GLY CA C N N 161 GLY C C N N 162 GLY O O N N 163 GLY OXT O N N 164 GLY H H N N 165 GLY H2 H N N 166 GLY HA2 H N N 167 GLY HA3 H N N 168 GLY HXT H N N 169 HEX C1 C N N 170 HEX C2 C N N 171 HEX C3 C N N 172 HEX C4 C N N 173 HEX C5 C N N 174 HEX C6 C N N 175 HEX H11 H N N 176 HEX H12 H N N 177 HEX H13 H N N 178 HEX H21 H N N 179 HEX H22 H N N 180 HEX H31 H N N 181 HEX H32 H N N 182 HEX H41 H N N 183 HEX H42 H N N 184 HEX H51 H N N 185 HEX H52 H N N 186 HEX H61 H N N 187 HEX H62 H N N 188 HEX H63 H N N 189 HIS N N N N 190 HIS CA C N S 191 HIS C C N N 192 HIS O O N N 193 HIS CB C N N 194 HIS CG C Y N 195 HIS ND1 N Y N 196 HIS CD2 C Y N 197 HIS CE1 C Y N 198 HIS NE2 N Y N 199 HIS OXT O N N 200 HIS H H N N 201 HIS H2 H N N 202 HIS HA H N N 203 HIS HB2 H N N 204 HIS HB3 H N N 205 HIS HD1 H N N 206 HIS HD2 H N N 207 HIS HE1 H N N 208 HIS HE2 H N N 209 HIS HXT H N N 210 HOH O O N N 211 HOH H1 H N N 212 HOH H2 H N N 213 ILE N N N N 214 ILE CA C N S 215 ILE C C N N 216 ILE O O N N 217 ILE CB C N S 218 ILE CG1 C N N 219 ILE CG2 C N N 220 ILE CD1 C N N 221 ILE OXT O N N 222 ILE H H N N 223 ILE H2 H N N 224 ILE HA H N N 225 ILE HB H N N 226 ILE HG12 H N N 227 ILE HG13 H N N 228 ILE HG21 H N N 229 ILE HG22 H N N 230 ILE HG23 H N N 231 ILE HD11 H N N 232 ILE HD12 H N N 233 ILE HD13 H N N 234 ILE HXT H N N 235 LEU N N N N 236 LEU CA C N S 237 LEU C C N N 238 LEU O O N N 239 LEU CB C N N 240 LEU CG C N N 241 LEU CD1 C N N 242 LEU CD2 C N N 243 LEU OXT O N N 244 LEU H H N N 245 LEU H2 H N N 246 LEU HA H N N 247 LEU HB2 H N N 248 LEU HB3 H N N 249 LEU HG H N N 250 LEU HD11 H N N 251 LEU HD12 H N N 252 LEU HD13 H N N 253 LEU HD21 H N N 254 LEU HD22 H N N 255 LEU HD23 H N N 256 LEU HXT H N N 257 LYS N N N N 258 LYS CA C N S 259 LYS C C N N 260 LYS O O N N 261 LYS CB C N N 262 LYS CG C N N 263 LYS CD C N N 264 LYS CE C N N 265 LYS NZ N N N 266 LYS OXT O N N 267 LYS H H N N 268 LYS H2 H N N 269 LYS HA H N N 270 LYS HB2 H N N 271 LYS HB3 H N N 272 LYS HG2 H N N 273 LYS HG3 H N N 274 LYS HD2 H N N 275 LYS HD3 H N N 276 LYS HE2 H N N 277 LYS HE3 H N N 278 LYS HZ1 H N N 279 LYS HZ2 H N N 280 LYS HZ3 H N N 281 LYS HXT H N N 282 MET N N N N 283 MET CA C N S 284 MET C C N N 285 MET O O N N 286 MET CB C N N 287 MET CG C N N 288 MET SD S N N 289 MET CE C N N 290 MET OXT O N N 291 MET H H N N 292 MET H2 H N N 293 MET HA H N N 294 MET HB2 H N N 295 MET HB3 H N N 296 MET HG2 H N N 297 MET HG3 H N N 298 MET HE1 H N N 299 MET HE2 H N N 300 MET HE3 H N N 301 MET HXT H N N 302 PHE N N N N 303 PHE CA C N S 304 PHE C C N N 305 PHE O O N N 306 PHE CB C N N 307 PHE CG C Y N 308 PHE CD1 C Y N 309 PHE CD2 C Y N 310 PHE CE1 C Y N 311 PHE CE2 C Y N 312 PHE CZ C Y N 313 PHE OXT O N N 314 PHE H H N N 315 PHE H2 H N N 316 PHE HA H N N 317 PHE HB2 H N N 318 PHE HB3 H N N 319 PHE HD1 H N N 320 PHE HD2 H N N 321 PHE HE1 H N N 322 PHE HE2 H N N 323 PHE HZ H N N 324 PHE HXT H N N 325 PRO N N N N 326 PRO CA C N S 327 PRO C C N N 328 PRO O O N N 329 PRO CB C N N 330 PRO CG C N N 331 PRO CD C N N 332 PRO OXT O N N 333 PRO H H N N 334 PRO HA H N N 335 PRO HB2 H N N 336 PRO HB3 H N N 337 PRO HG2 H N N 338 PRO HG3 H N N 339 PRO HD2 H N N 340 PRO HD3 H N N 341 PRO HXT H N N 342 RET C1 C N N 343 RET C2 C N N 344 RET C3 C N N 345 RET C4 C N N 346 RET C5 C N N 347 RET C6 C N N 348 RET C7 C N N 349 RET C8 C N N 350 RET C9 C N N 351 RET C10 C N N 352 RET C11 C N N 353 RET C12 C N N 354 RET C13 C N N 355 RET C14 C N N 356 RET C15 C N N 357 RET O1 O N N 358 RET C16 C N N 359 RET C17 C N N 360 RET C18 C N N 361 RET C19 C N N 362 RET C20 C N N 363 RET H21 H N N 364 RET H22 H N N 365 RET H31 H N N 366 RET H32 H N N 367 RET H41 H N N 368 RET H42 H N N 369 RET H7 H N N 370 RET H8 H N N 371 RET H10 H N N 372 RET H11 H N N 373 RET H12 H N N 374 RET H14 H N N 375 RET H15 H N N 376 RET H161 H N N 377 RET H162 H N N 378 RET H163 H N N 379 RET H171 H N N 380 RET H172 H N N 381 RET H173 H N N 382 RET H181 H N N 383 RET H182 H N N 384 RET H183 H N N 385 RET H191 H N N 386 RET H192 H N N 387 RET H193 H N N 388 RET H201 H N N 389 RET H202 H N N 390 RET H203 H N N 391 SER N N N N 392 SER CA C N S 393 SER C C N N 394 SER O O N N 395 SER CB C N N 396 SER OG O N N 397 SER OXT O N N 398 SER H H N N 399 SER H2 H N N 400 SER HA H N N 401 SER HB2 H N N 402 SER HB3 H N N 403 SER HG H N N 404 SER HXT H N N 405 THR N N N N 406 THR CA C N S 407 THR C C N N 408 THR O O N N 409 THR CB C N R 410 THR OG1 O N N 411 THR CG2 C N N 412 THR OXT O N N 413 THR H H N N 414 THR H2 H N N 415 THR HA H N N 416 THR HB H N N 417 THR HG1 H N N 418 THR HG21 H N N 419 THR HG22 H N N 420 THR HG23 H N N 421 THR HXT H N N 422 TRP N N N N 423 TRP CA C N S 424 TRP C C N N 425 TRP O O N N 426 TRP CB C N N 427 TRP CG C Y N 428 TRP CD1 C Y N 429 TRP CD2 C Y N 430 TRP NE1 N Y N 431 TRP CE2 C Y N 432 TRP CE3 C Y N 433 TRP CZ2 C Y N 434 TRP CZ3 C Y N 435 TRP CH2 C Y N 436 TRP OXT O N N 437 TRP H H N N 438 TRP H2 H N N 439 TRP HA H N N 440 TRP HB2 H N N 441 TRP HB3 H N N 442 TRP HD1 H N N 443 TRP HE1 H N N 444 TRP HE3 H N N 445 TRP HZ2 H N N 446 TRP HZ3 H N N 447 TRP HH2 H N N 448 TRP HXT H N N 449 TYR N N N N 450 TYR CA C N S 451 TYR C C N N 452 TYR O O N N 453 TYR CB C N N 454 TYR CG C Y N 455 TYR CD1 C Y N 456 TYR CD2 C Y N 457 TYR CE1 C Y N 458 TYR CE2 C Y N 459 TYR CZ C Y N 460 TYR OH O N N 461 TYR OXT O N N 462 TYR H H N N 463 TYR H2 H N N 464 TYR HA H N N 465 TYR HB2 H N N 466 TYR HB3 H N N 467 TYR HD1 H N N 468 TYR HD2 H N N 469 TYR HE1 H N N 470 TYR HE2 H N N 471 TYR HH H N N 472 TYR HXT H N N 473 VAL N N N N 474 VAL CA C N S 475 VAL C C N N 476 VAL O O N N 477 VAL CB C N N 478 VAL CG1 C N N 479 VAL CG2 C N N 480 VAL OXT O N N 481 VAL H H N N 482 VAL H2 H N N 483 VAL HA H N N 484 VAL HB H N N 485 VAL HG11 H N N 486 VAL HG12 H N N 487 VAL HG13 H N N 488 VAL HG21 H N N 489 VAL HG22 H N N 490 VAL HG23 H N N 491 VAL HXT H N N 492 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 D10 C1 C2 sing N N 83 D10 C1 H11 sing N N 84 D10 C1 H12 sing N N 85 D10 C1 H13 sing N N 86 D10 C2 C3 sing N N 87 D10 C2 H21 sing N N 88 D10 C2 H22 sing N N 89 D10 C3 C4 sing N N 90 D10 C3 H31 sing N N 91 D10 C3 H32 sing N N 92 D10 C4 C5 sing N N 93 D10 C4 H41 sing N N 94 D10 C4 H42 sing N N 95 D10 C5 C6 sing N N 96 D10 C5 H51 sing N N 97 D10 C5 H52 sing N N 98 D10 C6 C7 sing N N 99 D10 C6 H61 sing N N 100 D10 C6 H62 sing N N 101 D10 C7 C8 sing N N 102 D10 C7 H71 sing N N 103 D10 C7 H72 sing N N 104 D10 C8 C9 sing N N 105 D10 C8 H81 sing N N 106 D10 C8 H82 sing N N 107 D10 C9 C10 sing N N 108 D10 C9 H91 sing N N 109 D10 C9 H92 sing N N 110 D10 C10 H101 sing N N 111 D10 C10 H102 sing N N 112 D10 C10 H103 sing N N 113 GLN N CA sing N N 114 GLN N H sing N N 115 GLN N H2 sing N N 116 GLN CA C sing N N 117 GLN CA CB sing N N 118 GLN CA HA sing N N 119 GLN C O doub N N 120 GLN C OXT sing N N 121 GLN CB CG sing N N 122 GLN CB HB2 sing N N 123 GLN CB HB3 sing N N 124 GLN CG CD sing N N 125 GLN CG HG2 sing N N 126 GLN CG HG3 sing N N 127 GLN CD OE1 doub N N 128 GLN CD NE2 sing N N 129 GLN NE2 HE21 sing N N 130 GLN NE2 HE22 sing N N 131 GLN OXT HXT sing N N 132 GLU N CA sing N N 133 GLU N H sing N N 134 GLU N H2 sing N N 135 GLU CA C sing N N 136 GLU CA CB sing N N 137 GLU CA HA sing N N 138 GLU C O doub N N 139 GLU C OXT sing N N 140 GLU CB CG sing N N 141 GLU CB HB2 sing N N 142 GLU CB HB3 sing N N 143 GLU CG CD sing N N 144 GLU CG HG2 sing N N 145 GLU CG HG3 sing N N 146 GLU CD OE1 doub N N 147 GLU CD OE2 sing N N 148 GLU OE2 HE2 sing N N 149 GLU OXT HXT sing N N 150 GLY N CA sing N N 151 GLY N H sing N N 152 GLY N H2 sing N N 153 GLY CA C sing N N 154 GLY CA HA2 sing N N 155 GLY CA HA3 sing N N 156 GLY C O doub N N 157 GLY C OXT sing N N 158 GLY OXT HXT sing N N 159 HEX C1 C2 sing N N 160 HEX C1 H11 sing N N 161 HEX C1 H12 sing N N 162 HEX C1 H13 sing N N 163 HEX C2 C3 sing N N 164 HEX C2 H21 sing N N 165 HEX C2 H22 sing N N 166 HEX C3 C4 sing N N 167 HEX C3 H31 sing N N 168 HEX C3 H32 sing N N 169 HEX C4 C5 sing N N 170 HEX C4 H41 sing N N 171 HEX C4 H42 sing N N 172 HEX C5 C6 sing N N 173 HEX C5 H51 sing N N 174 HEX C5 H52 sing N N 175 HEX C6 H61 sing N N 176 HEX C6 H62 sing N N 177 HEX C6 H63 sing N N 178 HIS N CA sing N N 179 HIS N H sing N N 180 HIS N H2 sing N N 181 HIS CA C sing N N 182 HIS CA CB sing N N 183 HIS CA HA sing N N 184 HIS C O doub N N 185 HIS C OXT sing N N 186 HIS CB CG sing N N 187 HIS CB HB2 sing N N 188 HIS CB HB3 sing N N 189 HIS CG ND1 sing Y N 190 HIS CG CD2 doub Y N 191 HIS ND1 CE1 doub Y N 192 HIS ND1 HD1 sing N N 193 HIS CD2 NE2 sing Y N 194 HIS CD2 HD2 sing N N 195 HIS CE1 NE2 sing Y N 196 HIS CE1 HE1 sing N N 197 HIS NE2 HE2 sing N N 198 HIS OXT HXT sing N N 199 HOH O H1 sing N N 200 HOH O H2 sing N N 201 ILE N CA sing N N 202 ILE N H sing N N 203 ILE N H2 sing N N 204 ILE CA C sing N N 205 ILE CA CB sing N N 206 ILE CA HA sing N N 207 ILE C O doub N N 208 ILE C OXT sing N N 209 ILE CB CG1 sing N N 210 ILE CB CG2 sing N N 211 ILE CB HB sing N N 212 ILE CG1 CD1 sing N N 213 ILE CG1 HG12 sing N N 214 ILE CG1 HG13 sing N N 215 ILE CG2 HG21 sing N N 216 ILE CG2 HG22 sing N N 217 ILE CG2 HG23 sing N N 218 ILE CD1 HD11 sing N N 219 ILE CD1 HD12 sing N N 220 ILE CD1 HD13 sing N N 221 ILE OXT HXT sing N N 222 LEU N CA sing N N 223 LEU N H sing N N 224 LEU N H2 sing N N 225 LEU CA C sing N N 226 LEU CA CB sing N N 227 LEU CA HA sing N N 228 LEU C O doub N N 229 LEU C OXT sing N N 230 LEU CB CG sing N N 231 LEU CB HB2 sing N N 232 LEU CB HB3 sing N N 233 LEU CG CD1 sing N N 234 LEU CG CD2 sing N N 235 LEU CG HG sing N N 236 LEU CD1 HD11 sing N N 237 LEU CD1 HD12 sing N N 238 LEU CD1 HD13 sing N N 239 LEU CD2 HD21 sing N N 240 LEU CD2 HD22 sing N N 241 LEU CD2 HD23 sing N N 242 LEU OXT HXT sing N N 243 LYS N CA sing N N 244 LYS N H sing N N 245 LYS N H2 sing N N 246 LYS CA C sing N N 247 LYS CA CB sing N N 248 LYS CA HA sing N N 249 LYS C O doub N N 250 LYS C OXT sing N N 251 LYS CB CG sing N N 252 LYS CB HB2 sing N N 253 LYS CB HB3 sing N N 254 LYS CG CD sing N N 255 LYS CG HG2 sing N N 256 LYS CG HG3 sing N N 257 LYS CD CE sing N N 258 LYS CD HD2 sing N N 259 LYS CD HD3 sing N N 260 LYS CE NZ sing N N 261 LYS CE HE2 sing N N 262 LYS CE HE3 sing N N 263 LYS NZ HZ1 sing N N 264 LYS NZ HZ2 sing N N 265 LYS NZ HZ3 sing N N 266 LYS OXT HXT sing N N 267 MET N CA sing N N 268 MET N H sing N N 269 MET N H2 sing N N 270 MET CA C sing N N 271 MET CA CB sing N N 272 MET CA HA sing N N 273 MET C O doub N N 274 MET C OXT sing N N 275 MET CB CG sing N N 276 MET CB HB2 sing N N 277 MET CB HB3 sing N N 278 MET CG SD sing N N 279 MET CG HG2 sing N N 280 MET CG HG3 sing N N 281 MET SD CE sing N N 282 MET CE HE1 sing N N 283 MET CE HE2 sing N N 284 MET CE HE3 sing N N 285 MET OXT HXT sing N N 286 PHE N CA sing N N 287 PHE N H sing N N 288 PHE N H2 sing N N 289 PHE CA C sing N N 290 PHE CA CB sing N N 291 PHE CA HA sing N N 292 PHE C O doub N N 293 PHE C OXT sing N N 294 PHE CB CG sing N N 295 PHE CB HB2 sing N N 296 PHE CB HB3 sing N N 297 PHE CG CD1 doub Y N 298 PHE CG CD2 sing Y N 299 PHE CD1 CE1 sing Y N 300 PHE CD1 HD1 sing N N 301 PHE CD2 CE2 doub Y N 302 PHE CD2 HD2 sing N N 303 PHE CE1 CZ doub Y N 304 PHE CE1 HE1 sing N N 305 PHE CE2 CZ sing Y N 306 PHE CE2 HE2 sing N N 307 PHE CZ HZ sing N N 308 PHE OXT HXT sing N N 309 PRO N CA sing N N 310 PRO N CD sing N N 311 PRO N H sing N N 312 PRO CA C sing N N 313 PRO CA CB sing N N 314 PRO CA HA sing N N 315 PRO C O doub N N 316 PRO C OXT sing N N 317 PRO CB CG sing N N 318 PRO CB HB2 sing N N 319 PRO CB HB3 sing N N 320 PRO CG CD sing N N 321 PRO CG HG2 sing N N 322 PRO CG HG3 sing N N 323 PRO CD HD2 sing N N 324 PRO CD HD3 sing N N 325 PRO OXT HXT sing N N 326 RET C1 C2 sing N N 327 RET C1 C6 sing N N 328 RET C1 C16 sing N N 329 RET C1 C17 sing N N 330 RET C2 C3 sing N N 331 RET C2 H21 sing N N 332 RET C2 H22 sing N N 333 RET C3 C4 sing N N 334 RET C3 H31 sing N N 335 RET C3 H32 sing N N 336 RET C4 C5 sing N N 337 RET C4 H41 sing N N 338 RET C4 H42 sing N N 339 RET C5 C6 doub N N 340 RET C5 C18 sing N N 341 RET C6 C7 sing N N 342 RET C7 C8 doub N E 343 RET C7 H7 sing N N 344 RET C8 C9 sing N N 345 RET C8 H8 sing N N 346 RET C9 C10 doub N E 347 RET C9 C19 sing N N 348 RET C10 C11 sing N N 349 RET C10 H10 sing N N 350 RET C11 C12 doub N E 351 RET C11 H11 sing N N 352 RET C12 C13 sing N N 353 RET C12 H12 sing N N 354 RET C13 C14 doub N E 355 RET C13 C20 sing N N 356 RET C14 C15 sing N N 357 RET C14 H14 sing N N 358 RET C15 O1 doub N N 359 RET C15 H15 sing N N 360 RET C16 H161 sing N N 361 RET C16 H162 sing N N 362 RET C16 H163 sing N N 363 RET C17 H171 sing N N 364 RET C17 H172 sing N N 365 RET C17 H173 sing N N 366 RET C18 H181 sing N N 367 RET C18 H182 sing N N 368 RET C18 H183 sing N N 369 RET C19 H191 sing N N 370 RET C19 H192 sing N N 371 RET C19 H193 sing N N 372 RET C20 H201 sing N N 373 RET C20 H202 sing N N 374 RET C20 H203 sing N N 375 SER N CA sing N N 376 SER N H sing N N 377 SER N H2 sing N N 378 SER CA C sing N N 379 SER CA CB sing N N 380 SER CA HA sing N N 381 SER C O doub N N 382 SER C OXT sing N N 383 SER CB OG sing N N 384 SER CB HB2 sing N N 385 SER CB HB3 sing N N 386 SER OG HG sing N N 387 SER OXT HXT sing N N 388 THR N CA sing N N 389 THR N H sing N N 390 THR N H2 sing N N 391 THR CA C sing N N 392 THR CA CB sing N N 393 THR CA HA sing N N 394 THR C O doub N N 395 THR C OXT sing N N 396 THR CB OG1 sing N N 397 THR CB CG2 sing N N 398 THR CB HB sing N N 399 THR OG1 HG1 sing N N 400 THR CG2 HG21 sing N N 401 THR CG2 HG22 sing N N 402 THR CG2 HG23 sing N N 403 THR OXT HXT sing N N 404 TRP N CA sing N N 405 TRP N H sing N N 406 TRP N H2 sing N N 407 TRP CA C sing N N 408 TRP CA CB sing N N 409 TRP CA HA sing N N 410 TRP C O doub N N 411 TRP C OXT sing N N 412 TRP CB CG sing N N 413 TRP CB HB2 sing N N 414 TRP CB HB3 sing N N 415 TRP CG CD1 doub Y N 416 TRP CG CD2 sing Y N 417 TRP CD1 NE1 sing Y N 418 TRP CD1 HD1 sing N N 419 TRP CD2 CE2 doub Y N 420 TRP CD2 CE3 sing Y N 421 TRP NE1 CE2 sing Y N 422 TRP NE1 HE1 sing N N 423 TRP CE2 CZ2 sing Y N 424 TRP CE3 CZ3 doub Y N 425 TRP CE3 HE3 sing N N 426 TRP CZ2 CH2 doub Y N 427 TRP CZ2 HZ2 sing N N 428 TRP CZ3 CH2 sing Y N 429 TRP CZ3 HZ3 sing N N 430 TRP CH2 HH2 sing N N 431 TRP OXT HXT sing N N 432 TYR N CA sing N N 433 TYR N H sing N N 434 TYR N H2 sing N N 435 TYR CA C sing N N 436 TYR CA CB sing N N 437 TYR CA HA sing N N 438 TYR C O doub N N 439 TYR C OXT sing N N 440 TYR CB CG sing N N 441 TYR CB HB2 sing N N 442 TYR CB HB3 sing N N 443 TYR CG CD1 doub Y N 444 TYR CG CD2 sing Y N 445 TYR CD1 CE1 sing Y N 446 TYR CD1 HD1 sing N N 447 TYR CD2 CE2 doub Y N 448 TYR CD2 HD2 sing N N 449 TYR CE1 CZ doub Y N 450 TYR CE1 HE1 sing N N 451 TYR CE2 CZ sing Y N 452 TYR CE2 HE2 sing N N 453 TYR CZ OH sing N N 454 TYR OH HH sing N N 455 TYR OXT HXT sing N N 456 VAL N CA sing N N 457 VAL N H sing N N 458 VAL N H2 sing N N 459 VAL CA C sing N N 460 VAL CA CB sing N N 461 VAL CA HA sing N N 462 VAL C O doub N N 463 VAL C OXT sing N N 464 VAL CB CG1 sing N N 465 VAL CB CG2 sing N N 466 VAL CB HB sing N N 467 VAL CG1 HG11 sing N N 468 VAL CG1 HG12 sing N N 469 VAL CG1 HG13 sing N N 470 VAL CG2 HG21 sing N N 471 VAL CG2 HG22 sing N N 472 VAL CG2 HG23 sing N N 473 VAL OXT HXT sing N N 474 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5B2N _pdbx_initial_refinement_model.details ? # _pdbx_related_exp_data_set.ordinal 1 _pdbx_related_exp_data_set.data_set_type 'diffraction image data' _pdbx_related_exp_data_set.data_reference 10.11577/1843782 _pdbx_related_exp_data_set.metadata_reference ? _pdbx_related_exp_data_set.details ? # _pdbx_serial_crystallography_sample_delivery.diffrn_id 1 _pdbx_serial_crystallography_sample_delivery.description ? _pdbx_serial_crystallography_sample_delivery.method injection # _atom_sites.entry_id 7VGT _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.009588 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.008483 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019569 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017031 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol BR C N O S # loop_ #