data_7VRM # _entry.id 7VRM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7VRM pdb_00007vrm 10.2210/pdb7vrm/pdb WWPDB D_1300025264 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7VRM _pdbx_database_status.recvd_initial_deposition_date 2021-10-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Padmanabhan, B.' 1 ? 'Arole, A.' 2 ? 'Deshmukh, P.' 3 ? 'Ashok, S.' 4 ? 'Mathur, S.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr D Struct Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2059-7983 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 79 _citation.language ? _citation.page_first 758 _citation.page_last 774 _citation.title ;Structural and biochemical insights into purine-based drug molecules in hBRD2 delineate a unique binding mode opening new vistas in the design of inhibitors of the BET family. ; _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2059798323005211 _citation.pdbx_database_id_PubMed 37432115 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Arole, A.H.' 1 ? primary 'Deshmukh, P.' 2 ? primary 'Sridhar, A.' 3 ? primary 'Mathur, S.' 4 ? primary 'Mahalingaswamy, M.' 5 ? primary 'Subramanya, H.' 6 ? primary 'Dalavaikodihalli Nanjaiah, N.' 7 ? primary 'Padmanabhan, B.' 8 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 7VRM _cell.details ? _cell.formula_units_Z ? _cell.length_a 52.515 _cell.length_a_esd ? _cell.length_b 71.823 _cell.length_b_esd ? _cell.length_c 32.145 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7VRM _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bromodomain-containing protein 2' 13524.474 1 ? ? ? ? 2 non-polymer syn THEOPHYLLINE 180.164 2 ? ? ? ? 3 water nat water 18.015 225 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMQDPEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRL MFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMQDPEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRL MFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 GLN n 1 6 ASP n 1 7 PRO n 1 8 GLU n 1 9 GLN n 1 10 LEU n 1 11 LYS n 1 12 HIS n 1 13 CYS n 1 14 ASN n 1 15 GLY n 1 16 ILE n 1 17 LEU n 1 18 LYS n 1 19 GLU n 1 20 LEU n 1 21 LEU n 1 22 SER n 1 23 LYS n 1 24 LYS n 1 25 HIS n 1 26 ALA n 1 27 ALA n 1 28 TYR n 1 29 ALA n 1 30 TRP n 1 31 PRO n 1 32 PHE n 1 33 TYR n 1 34 LYS n 1 35 PRO n 1 36 VAL n 1 37 ASP n 1 38 ALA n 1 39 SER n 1 40 ALA n 1 41 LEU n 1 42 GLY n 1 43 LEU n 1 44 HIS n 1 45 ASP n 1 46 TYR n 1 47 HIS n 1 48 ASP n 1 49 ILE n 1 50 ILE n 1 51 LYS n 1 52 HIS n 1 53 PRO n 1 54 MET n 1 55 ASP n 1 56 LEU n 1 57 SER n 1 58 THR n 1 59 VAL n 1 60 LYS n 1 61 ARG n 1 62 LYS n 1 63 MET n 1 64 GLU n 1 65 ASN n 1 66 ARG n 1 67 ASP n 1 68 TYR n 1 69 ARG n 1 70 ASP n 1 71 ALA n 1 72 GLN n 1 73 GLU n 1 74 PHE n 1 75 ALA n 1 76 ALA n 1 77 ASP n 1 78 VAL n 1 79 ARG n 1 80 LEU n 1 81 MET n 1 82 PHE n 1 83 SER n 1 84 ASN n 1 85 CYS n 1 86 TYR n 1 87 LYS n 1 88 TYR n 1 89 ASN n 1 90 PRO n 1 91 PRO n 1 92 ASP n 1 93 HIS n 1 94 ASP n 1 95 VAL n 1 96 VAL n 1 97 ALA n 1 98 MET n 1 99 ALA n 1 100 ARG n 1 101 LYS n 1 102 LEU n 1 103 GLN n 1 104 ASP n 1 105 VAL n 1 106 PHE n 1 107 GLU n 1 108 PHE n 1 109 ARG n 1 110 TYR n 1 111 ALA n 1 112 LYS n 1 113 MET n 1 114 PRO n 1 115 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 115 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene BRD2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code BRD2_HUMAN _struct_ref.pdbx_db_accession P25440 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYK YNPPDHDVVAMARKLQDVFEFRYAKMPD ; _struct_ref.pdbx_align_begin 348 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7VRM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 115 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P25440 _struct_ref_seq.db_align_beg 348 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 455 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 348 _struct_ref_seq.pdbx_auth_seq_align_end 455 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7VRM GLY A 1 ? UNP P25440 ? ? 'expression tag' 341 1 1 7VRM SER A 2 ? UNP P25440 ? ? 'expression tag' 342 2 1 7VRM HIS A 3 ? UNP P25440 ? ? 'expression tag' 343 3 1 7VRM MET A 4 ? UNP P25440 ? ? 'expression tag' 344 4 1 7VRM GLN A 5 ? UNP P25440 ? ? 'expression tag' 345 5 1 7VRM ASP A 6 ? UNP P25440 ? ? 'expression tag' 346 6 1 7VRM PRO A 7 ? UNP P25440 ? ? 'expression tag' 347 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TEP non-polymer . THEOPHYLLINE ? 'C7 H8 N4 O2' 180.164 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7VRM _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.24 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.12 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 300 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG MME 2000, 50mM Tris, 50mM NaCl' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU HyPix-6000HE' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-08-28 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54056 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54056 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7VRM _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.1 _reflns.d_resolution_low 25.61 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 48535 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.6 _reflns.pdbx_Rmerge_I_obs 0.068 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.11 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.0 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.1 _reflns_shell.d_res_low 1.12 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2015 _reflns_shell.percent_possible_all 81.0 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.339 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 2.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.95 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7VRM _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.10 _refine.ls_d_res_low 25.61 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 48229 _refine.ls_number_reflns_R_free 1990 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.14 _refine.ls_percent_reflns_R_free 4.13 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1678 _refine.ls_R_factor_R_free 0.1803 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1673 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5XHK _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 17.46 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.08 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 940 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 26 _refine_hist.number_atoms_solvent 225 _refine_hist.number_atoms_total 1191 _refine_hist.d_res_high 1.10 _refine_hist.d_res_low 25.61 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.004 ? 1040 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.798 ? 1414 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 3.983 ? 159 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.079 ? 136 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 216 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.10 1.13 . . 122 2803 84.00 . . . 0.2380 . 0.2100 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.13 1.16 . . 136 3188 93.00 . . . 0.2352 . 0.1934 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.16 1.19 . . 141 3264 96.00 . . . 0.2132 . 0.1812 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.19 1.23 . . 139 3248 96.00 . . . 0.1846 . 0.1622 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.23 1.27 . . 139 3234 96.00 . . . 0.1795 . 0.1545 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.27 1.33 . . 138 3216 95.00 . . . 0.1711 . 0.1495 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.33 1.39 . . 142 3272 95.00 . . . 0.1599 . 0.1477 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.39 1.46 . . 141 3282 96.00 . . . 0.1760 . 0.1450 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.46 1.55 . . 143 3309 97.00 . . . 0.1722 . 0.1397 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.55 1.67 . . 146 3394 99.00 . . . 0.1607 . 0.1440 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.67 1.84 . . 146 3416 100.00 . . . 0.1868 . 0.1596 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.84 2.10 . . 150 3479 100.00 . . . 0.1847 . 0.1723 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.10 2.65 . . 150 3493 100.00 . . . 0.1753 . 0.1832 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.65 25.61 . . 157 3641 99.00 . . . 0.1794 . 0.1731 . . . . . . . . . . . # _struct.entry_id 7VRM _struct.title 'crystal structure of BRD2-BD2 in complex with purine derivative' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7VRM _struct_keywords.text 'BET family, BET inhibitor, Bromodomain Inhibitor, BRD2-BD1 inhibitor, TRANSCRIPTION-INHIBITOR COMPLEX' _struct_keywords.pdbx_keywords TRANSCRIPTION/INHIBITOR # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLN A 5 ? LEU A 21 ? GLN A 345 LEU A 361 1 ? 17 HELX_P HELX_P2 AA2 SER A 22 ? LYS A 24 ? SER A 362 LYS A 364 5 ? 3 HELX_P HELX_P3 AA3 HIS A 25 ? TRP A 30 ? HIS A 365 TRP A 370 1 ? 6 HELX_P HELX_P4 AA4 PRO A 31 ? TYR A 33 ? PRO A 371 TYR A 373 5 ? 3 HELX_P HELX_P5 AA5 ASP A 37 ? GLY A 42 ? ASP A 377 GLY A 382 1 ? 6 HELX_P HELX_P6 AA6 ASP A 45 ? ILE A 50 ? ASP A 385 ILE A 390 1 ? 6 HELX_P HELX_P7 AA7 ASP A 55 ? ASN A 65 ? ASP A 395 ASN A 405 1 ? 11 HELX_P HELX_P8 AA8 ASP A 70 ? ASN A 89 ? ASP A 410 ASN A 429 1 ? 20 HELX_P HELX_P9 AA9 HIS A 93 ? LYS A 112 ? HIS A 433 LYS A 452 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 7VRM _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.019042 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013923 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.031109 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 341 341 GLY GLY A . n A 1 2 SER 2 342 342 SER SER A . n A 1 3 HIS 3 343 343 HIS HIS A . n A 1 4 MET 4 344 344 MET MET A . n A 1 5 GLN 5 345 345 GLN GLN A . n A 1 6 ASP 6 346 346 ASP ASP A . n A 1 7 PRO 7 347 347 PRO PRO A . n A 1 8 GLU 8 348 348 GLU GLU A . n A 1 9 GLN 9 349 349 GLN GLN A . n A 1 10 LEU 10 350 350 LEU LEU A . n A 1 11 LYS 11 351 351 LYS LYS A . n A 1 12 HIS 12 352 352 HIS HIS A . n A 1 13 CYS 13 353 353 CYS CYS A . n A 1 14 ASN 14 354 354 ASN ASN A . n A 1 15 GLY 15 355 355 GLY GLY A . n A 1 16 ILE 16 356 356 ILE ILE A . n A 1 17 LEU 17 357 357 LEU LEU A . n A 1 18 LYS 18 358 358 LYS LYS A . n A 1 19 GLU 19 359 359 GLU GLU A . n A 1 20 LEU 20 360 360 LEU LEU A . n A 1 21 LEU 21 361 361 LEU LEU A . n A 1 22 SER 22 362 362 SER SER A . n A 1 23 LYS 23 363 363 LYS LYS A . n A 1 24 LYS 24 364 364 LYS LYS A . n A 1 25 HIS 25 365 365 HIS HIS A . n A 1 26 ALA 26 366 366 ALA ALA A . n A 1 27 ALA 27 367 367 ALA ALA A . n A 1 28 TYR 28 368 368 TYR TYR A . n A 1 29 ALA 29 369 369 ALA ALA A . n A 1 30 TRP 30 370 370 TRP TRP A . n A 1 31 PRO 31 371 371 PRO PRO A . n A 1 32 PHE 32 372 372 PHE PHE A . n A 1 33 TYR 33 373 373 TYR TYR A . n A 1 34 LYS 34 374 374 LYS LYS A . n A 1 35 PRO 35 375 375 PRO PRO A . n A 1 36 VAL 36 376 376 VAL VAL A . n A 1 37 ASP 37 377 377 ASP ASP A . n A 1 38 ALA 38 378 378 ALA ALA A . n A 1 39 SER 39 379 379 SER SER A . n A 1 40 ALA 40 380 380 ALA ALA A . n A 1 41 LEU 41 381 381 LEU LEU A . n A 1 42 GLY 42 382 382 GLY GLY A . n A 1 43 LEU 43 383 383 LEU LEU A . n A 1 44 HIS 44 384 384 HIS HIS A . n A 1 45 ASP 45 385 385 ASP ASP A . n A 1 46 TYR 46 386 386 TYR TYR A . n A 1 47 HIS 47 387 387 HIS HIS A . n A 1 48 ASP 48 388 388 ASP ASP A . n A 1 49 ILE 49 389 389 ILE ILE A . n A 1 50 ILE 50 390 390 ILE ILE A . n A 1 51 LYS 51 391 391 LYS LYS A . n A 1 52 HIS 52 392 392 HIS HIS A . n A 1 53 PRO 53 393 393 PRO PRO A . n A 1 54 MET 54 394 394 MET MET A . n A 1 55 ASP 55 395 395 ASP ASP A . n A 1 56 LEU 56 396 396 LEU LEU A . n A 1 57 SER 57 397 397 SER SER A . n A 1 58 THR 58 398 398 THR THR A . n A 1 59 VAL 59 399 399 VAL VAL A . n A 1 60 LYS 60 400 400 LYS LYS A . n A 1 61 ARG 61 401 401 ARG ARG A . n A 1 62 LYS 62 402 402 LYS LYS A . n A 1 63 MET 63 403 403 MET MET A . n A 1 64 GLU 64 404 404 GLU GLU A . n A 1 65 ASN 65 405 405 ASN ASN A . n A 1 66 ARG 66 406 406 ARG ARG A . n A 1 67 ASP 67 407 407 ASP ASP A . n A 1 68 TYR 68 408 408 TYR TYR A . n A 1 69 ARG 69 409 409 ARG ARG A . n A 1 70 ASP 70 410 410 ASP ASP A . n A 1 71 ALA 71 411 411 ALA ALA A . n A 1 72 GLN 72 412 412 GLN GLN A . n A 1 73 GLU 73 413 413 GLU GLU A . n A 1 74 PHE 74 414 414 PHE PHE A . n A 1 75 ALA 75 415 415 ALA ALA A . n A 1 76 ALA 76 416 416 ALA ALA A . n A 1 77 ASP 77 417 417 ASP ASP A . n A 1 78 VAL 78 418 418 VAL VAL A . n A 1 79 ARG 79 419 419 ARG ARG A . n A 1 80 LEU 80 420 420 LEU LEU A . n A 1 81 MET 81 421 421 MET MET A . n A 1 82 PHE 82 422 422 PHE PHE A . n A 1 83 SER 83 423 423 SER SER A . n A 1 84 ASN 84 424 424 ASN ASN A . n A 1 85 CYS 85 425 425 CYS CYS A . n A 1 86 TYR 86 426 426 TYR TYR A . n A 1 87 LYS 87 427 427 LYS LYS A . n A 1 88 TYR 88 428 428 TYR TYR A . n A 1 89 ASN 89 429 429 ASN ASN A . n A 1 90 PRO 90 430 430 PRO PRO A . n A 1 91 PRO 91 431 431 PRO PRO A . n A 1 92 ASP 92 432 432 ASP ASP A . n A 1 93 HIS 93 433 433 HIS HIS A . n A 1 94 ASP 94 434 434 ASP ASP A . n A 1 95 VAL 95 435 435 VAL VAL A . n A 1 96 VAL 96 436 436 VAL VAL A . n A 1 97 ALA 97 437 437 ALA ALA A . n A 1 98 MET 98 438 438 MET MET A . n A 1 99 ALA 99 439 439 ALA ALA A . n A 1 100 ARG 100 440 440 ARG ARG A . n A 1 101 LYS 101 441 441 LYS LYS A . n A 1 102 LEU 102 442 442 LEU LEU A . n A 1 103 GLN 103 443 443 GLN GLN A . n A 1 104 ASP 104 444 444 ASP ASP A . n A 1 105 VAL 105 445 445 VAL VAL A . n A 1 106 PHE 106 446 446 PHE PHE A . n A 1 107 GLU 107 447 447 GLU GLU A . n A 1 108 PHE 108 448 448 PHE PHE A . n A 1 109 ARG 109 449 449 ARG ARG A . n A 1 110 TYR 110 450 450 TYR TYR A . n A 1 111 ALA 111 451 451 ALA ALA A . n A 1 112 LYS 112 452 452 LYS LYS A . n A 1 113 MET 113 453 453 MET MET A . n A 1 114 PRO 114 454 454 PRO PRO A . n A 1 115 ASP 115 455 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email balapaddy@gmail.com _pdbx_contact_author.name_first Balasundaram _pdbx_contact_author.name_last Padmanabhan _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-8434-828X # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 TEP 1 501 501 TEP TEP A . C 2 TEP 1 502 601 TEP TEP A . D 3 HOH 1 601 109 HOH HOH A . D 3 HOH 2 602 111 HOH HOH A . D 3 HOH 3 603 126 HOH HOH A . D 3 HOH 4 604 154 HOH HOH A . D 3 HOH 5 605 80 HOH HOH A . D 3 HOH 6 606 201 HOH HOH A . D 3 HOH 7 607 186 HOH HOH A . D 3 HOH 8 608 129 HOH HOH A . D 3 HOH 9 609 171 HOH HOH A . D 3 HOH 10 610 85 HOH HOH A . D 3 HOH 11 611 113 HOH HOH A . D 3 HOH 12 612 198 HOH HOH A . D 3 HOH 13 613 26 HOH HOH A . D 3 HOH 14 614 79 HOH HOH A . D 3 HOH 15 615 197 HOH HOH A . D 3 HOH 16 616 88 HOH HOH A . D 3 HOH 17 617 107 HOH HOH A . D 3 HOH 18 618 213 HOH HOH A . D 3 HOH 19 619 102 HOH HOH A . D 3 HOH 20 620 101 HOH HOH A . D 3 HOH 21 621 14 HOH HOH A . D 3 HOH 22 622 145 HOH HOH A . D 3 HOH 23 623 151 HOH HOH A . D 3 HOH 24 624 44 HOH HOH A . D 3 HOH 25 625 24 HOH HOH A . D 3 HOH 26 626 165 HOH HOH A . D 3 HOH 27 627 221 HOH HOH A . D 3 HOH 28 628 161 HOH HOH A . D 3 HOH 29 629 156 HOH HOH A . D 3 HOH 30 630 12 HOH HOH A . D 3 HOH 31 631 175 HOH HOH A . D 3 HOH 32 632 93 HOH HOH A . D 3 HOH 33 633 34 HOH HOH A . D 3 HOH 34 634 47 HOH HOH A . D 3 HOH 35 635 2 HOH HOH A . D 3 HOH 36 636 160 HOH HOH A . D 3 HOH 37 637 46 HOH HOH A . D 3 HOH 38 638 16 HOH HOH A . D 3 HOH 39 639 40 HOH HOH A . D 3 HOH 40 640 94 HOH HOH A . D 3 HOH 41 641 32 HOH HOH A . D 3 HOH 42 642 52 HOH HOH A . D 3 HOH 43 643 13 HOH HOH A . D 3 HOH 44 644 95 HOH HOH A . D 3 HOH 45 645 10 HOH HOH A . D 3 HOH 46 646 123 HOH HOH A . D 3 HOH 47 647 138 HOH HOH A . D 3 HOH 48 648 71 HOH HOH A . D 3 HOH 49 649 168 HOH HOH A . D 3 HOH 50 650 35 HOH HOH A . D 3 HOH 51 651 18 HOH HOH A . D 3 HOH 52 652 25 HOH HOH A . D 3 HOH 53 653 42 HOH HOH A . D 3 HOH 54 654 114 HOH HOH A . D 3 HOH 55 655 28 HOH HOH A . D 3 HOH 56 656 203 HOH HOH A . D 3 HOH 57 657 89 HOH HOH A . D 3 HOH 58 658 76 HOH HOH A . D 3 HOH 59 659 36 HOH HOH A . D 3 HOH 60 660 11 HOH HOH A . D 3 HOH 61 661 139 HOH HOH A . D 3 HOH 62 662 122 HOH HOH A . D 3 HOH 63 663 55 HOH HOH A . D 3 HOH 64 664 59 HOH HOH A . D 3 HOH 65 665 63 HOH HOH A . D 3 HOH 66 666 39 HOH HOH A . D 3 HOH 67 667 128 HOH HOH A . D 3 HOH 68 668 7 HOH HOH A . D 3 HOH 69 669 5 HOH HOH A . D 3 HOH 70 670 87 HOH HOH A . D 3 HOH 71 671 176 HOH HOH A . D 3 HOH 72 672 177 HOH HOH A . D 3 HOH 73 673 15 HOH HOH A . D 3 HOH 74 674 118 HOH HOH A . D 3 HOH 75 675 99 HOH HOH A . D 3 HOH 76 676 92 HOH HOH A . D 3 HOH 77 677 140 HOH HOH A . D 3 HOH 78 678 50 HOH HOH A . D 3 HOH 79 679 8 HOH HOH A . D 3 HOH 80 680 96 HOH HOH A . D 3 HOH 81 681 117 HOH HOH A . D 3 HOH 82 682 136 HOH HOH A . D 3 HOH 83 683 166 HOH HOH A . D 3 HOH 84 684 3 HOH HOH A . D 3 HOH 85 685 144 HOH HOH A . D 3 HOH 86 686 98 HOH HOH A . D 3 HOH 87 687 64 HOH HOH A . D 3 HOH 88 688 31 HOH HOH A . D 3 HOH 89 689 105 HOH HOH A . D 3 HOH 90 690 103 HOH HOH A . D 3 HOH 91 691 141 HOH HOH A . D 3 HOH 92 692 194 HOH HOH A . D 3 HOH 93 693 21 HOH HOH A . D 3 HOH 94 694 30 HOH HOH A . D 3 HOH 95 695 45 HOH HOH A . D 3 HOH 96 696 143 HOH HOH A . D 3 HOH 97 697 74 HOH HOH A . D 3 HOH 98 698 19 HOH HOH A . D 3 HOH 99 699 62 HOH HOH A . D 3 HOH 100 700 195 HOH HOH A . D 3 HOH 101 701 17 HOH HOH A . D 3 HOH 102 702 9 HOH HOH A . D 3 HOH 103 703 106 HOH HOH A . D 3 HOH 104 704 217 HOH HOH A . D 3 HOH 105 705 78 HOH HOH A . D 3 HOH 106 706 86 HOH HOH A . D 3 HOH 107 707 110 HOH HOH A . D 3 HOH 108 708 1 HOH HOH A . D 3 HOH 109 709 204 HOH HOH A . D 3 HOH 110 710 6 HOH HOH A . D 3 HOH 111 711 37 HOH HOH A . D 3 HOH 112 712 205 HOH HOH A . D 3 HOH 113 713 162 HOH HOH A . D 3 HOH 114 714 66 HOH HOH A . D 3 HOH 115 715 206 HOH HOH A . D 3 HOH 116 716 60 HOH HOH A . D 3 HOH 117 717 4 HOH HOH A . D 3 HOH 118 718 38 HOH HOH A . D 3 HOH 119 719 33 HOH HOH A . D 3 HOH 120 720 120 HOH HOH A . D 3 HOH 121 721 150 HOH HOH A . D 3 HOH 122 722 49 HOH HOH A . D 3 HOH 123 723 214 HOH HOH A . D 3 HOH 124 724 189 HOH HOH A . D 3 HOH 125 725 108 HOH HOH A . D 3 HOH 126 726 119 HOH HOH A . D 3 HOH 127 727 219 HOH HOH A . D 3 HOH 128 728 210 HOH HOH A . D 3 HOH 129 729 22 HOH HOH A . D 3 HOH 130 730 223 HOH HOH A . D 3 HOH 131 731 170 HOH HOH A . D 3 HOH 132 732 152 HOH HOH A . D 3 HOH 133 733 174 HOH HOH A . D 3 HOH 134 734 212 HOH HOH A . D 3 HOH 135 735 208 HOH HOH A . D 3 HOH 136 736 183 HOH HOH A . D 3 HOH 137 737 27 HOH HOH A . D 3 HOH 138 738 134 HOH HOH A . D 3 HOH 139 739 191 HOH HOH A . D 3 HOH 140 740 132 HOH HOH A . D 3 HOH 141 741 147 HOH HOH A . D 3 HOH 142 742 23 HOH HOH A . D 3 HOH 143 743 148 HOH HOH A . D 3 HOH 144 744 172 HOH HOH A . D 3 HOH 145 745 179 HOH HOH A . D 3 HOH 146 746 48 HOH HOH A . D 3 HOH 147 747 127 HOH HOH A . D 3 HOH 148 748 164 HOH HOH A . D 3 HOH 149 749 202 HOH HOH A . D 3 HOH 150 750 225 HOH HOH A . D 3 HOH 151 751 158 HOH HOH A . D 3 HOH 152 752 104 HOH HOH A . D 3 HOH 153 753 196 HOH HOH A . D 3 HOH 154 754 58 HOH HOH A . D 3 HOH 155 755 83 HOH HOH A . D 3 HOH 156 756 67 HOH HOH A . D 3 HOH 157 757 159 HOH HOH A . D 3 HOH 158 758 41 HOH HOH A . D 3 HOH 159 759 112 HOH HOH A . D 3 HOH 160 760 69 HOH HOH A . D 3 HOH 161 761 207 HOH HOH A . D 3 HOH 162 762 222 HOH HOH A . D 3 HOH 163 763 199 HOH HOH A . D 3 HOH 164 764 82 HOH HOH A . D 3 HOH 165 765 54 HOH HOH A . D 3 HOH 166 766 72 HOH HOH A . D 3 HOH 167 767 192 HOH HOH A . D 3 HOH 168 768 90 HOH HOH A . D 3 HOH 169 769 124 HOH HOH A . D 3 HOH 170 770 53 HOH HOH A . D 3 HOH 171 771 73 HOH HOH A . D 3 HOH 172 772 51 HOH HOH A . D 3 HOH 173 773 187 HOH HOH A . D 3 HOH 174 774 133 HOH HOH A . D 3 HOH 175 775 70 HOH HOH A . D 3 HOH 176 776 61 HOH HOH A . D 3 HOH 177 777 185 HOH HOH A . D 3 HOH 178 778 224 HOH HOH A . D 3 HOH 179 779 135 HOH HOH A . D 3 HOH 180 780 190 HOH HOH A . D 3 HOH 181 781 91 HOH HOH A . D 3 HOH 182 782 142 HOH HOH A . D 3 HOH 183 783 178 HOH HOH A . D 3 HOH 184 784 215 HOH HOH A . D 3 HOH 185 785 200 HOH HOH A . D 3 HOH 186 786 84 HOH HOH A . D 3 HOH 187 787 57 HOH HOH A . D 3 HOH 188 788 173 HOH HOH A . D 3 HOH 189 789 218 HOH HOH A . D 3 HOH 190 790 149 HOH HOH A . D 3 HOH 191 791 68 HOH HOH A . D 3 HOH 192 792 43 HOH HOH A . D 3 HOH 193 793 97 HOH HOH A . D 3 HOH 194 794 81 HOH HOH A . D 3 HOH 195 795 184 HOH HOH A . D 3 HOH 196 796 167 HOH HOH A . D 3 HOH 197 797 20 HOH HOH A . D 3 HOH 198 798 137 HOH HOH A . D 3 HOH 199 799 193 HOH HOH A . D 3 HOH 200 800 163 HOH HOH A . D 3 HOH 201 801 146 HOH HOH A . D 3 HOH 202 802 100 HOH HOH A . D 3 HOH 203 803 153 HOH HOH A . D 3 HOH 204 804 180 HOH HOH A . D 3 HOH 205 805 65 HOH HOH A . D 3 HOH 206 806 116 HOH HOH A . D 3 HOH 207 807 188 HOH HOH A . D 3 HOH 208 808 75 HOH HOH A . D 3 HOH 209 809 216 HOH HOH A . D 3 HOH 210 810 115 HOH HOH A . D 3 HOH 211 811 169 HOH HOH A . D 3 HOH 212 812 29 HOH HOH A . D 3 HOH 213 813 56 HOH HOH A . D 3 HOH 214 814 209 HOH HOH A . D 3 HOH 215 815 130 HOH HOH A . D 3 HOH 216 816 131 HOH HOH A . D 3 HOH 217 817 121 HOH HOH A . D 3 HOH 218 818 125 HOH HOH A . D 3 HOH 219 819 77 HOH HOH A . D 3 HOH 220 820 211 HOH HOH A . D 3 HOH 221 821 155 HOH HOH A . D 3 HOH 222 822 181 HOH HOH A . D 3 HOH 223 823 157 HOH HOH A . D 3 HOH 224 824 182 HOH HOH A . D 3 HOH 225 825 220 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2190 ? 1 MORE 3 ? 1 'SSA (A^2)' 13540 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 756 ? D HOH . 2 1 A HOH 825 ? D HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-02-01 2 'Structure model' 1 1 2023-08-02 3 'Structure model' 1 2 2023-08-16 4 'Structure model' 1 3 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' citation 6 3 'Structure model' citation_author 7 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.journal_id_CSD' 3 2 'Structure model' '_citation.journal_id_ISSN' 4 2 'Structure model' '_citation.pdbx_database_id_DOI' 5 2 'Structure model' '_citation.pdbx_database_id_PubMed' 6 2 'Structure model' '_citation.title' 7 2 'Structure model' '_citation.year' 8 3 'Structure model' '_citation.journal_volume' 9 3 'Structure model' '_citation.page_first' 10 3 'Structure model' '_citation.page_last' 11 3 'Structure model' '_citation_author.identifier_ORCID' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.18_3855: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _pdbx_entry_details.entry_id 7VRM _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HOH _pdbx_validate_close_contact.auth_seq_id_1 606 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 749 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.19 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 723 ? ? 1_555 O A HOH 778 ? ? 3_555 2.10 2 1 O A HOH 618 ? ? 1_555 O A HOH 750 ? ? 3_545 2.19 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 823 ? 5.81 . 2 1 O ? A HOH 824 ? 6.26 . 3 1 O ? A HOH 825 ? 6.50 . # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id ASP _pdbx_unobs_or_zero_occ_residues.auth_seq_id 455 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id ASP _pdbx_unobs_or_zero_occ_residues.label_seq_id 115 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 TEP C1 C N N 304 TEP N1 N Y N 305 TEP C2 C Y N 306 TEP O2 O N N 307 TEP N3 N Y N 308 TEP C3 C N N 309 TEP C4 C Y N 310 TEP C5 C Y N 311 TEP C6 C Y N 312 TEP O6 O N N 313 TEP N7 N Y N 314 TEP C8 C Y N 315 TEP N9 N Y N 316 TEP H11 H N N 317 TEP H12 H N N 318 TEP H13 H N N 319 TEP H31 H N N 320 TEP H32 H N N 321 TEP H33 H N N 322 TEP HN7 H N N 323 TEP H8 H N N 324 THR N N N N 325 THR CA C N S 326 THR C C N N 327 THR O O N N 328 THR CB C N R 329 THR OG1 O N N 330 THR CG2 C N N 331 THR OXT O N N 332 THR H H N N 333 THR H2 H N N 334 THR HA H N N 335 THR HB H N N 336 THR HG1 H N N 337 THR HG21 H N N 338 THR HG22 H N N 339 THR HG23 H N N 340 THR HXT H N N 341 TRP N N N N 342 TRP CA C N S 343 TRP C C N N 344 TRP O O N N 345 TRP CB C N N 346 TRP CG C Y N 347 TRP CD1 C Y N 348 TRP CD2 C Y N 349 TRP NE1 N Y N 350 TRP CE2 C Y N 351 TRP CE3 C Y N 352 TRP CZ2 C Y N 353 TRP CZ3 C Y N 354 TRP CH2 C Y N 355 TRP OXT O N N 356 TRP H H N N 357 TRP H2 H N N 358 TRP HA H N N 359 TRP HB2 H N N 360 TRP HB3 H N N 361 TRP HD1 H N N 362 TRP HE1 H N N 363 TRP HE3 H N N 364 TRP HZ2 H N N 365 TRP HZ3 H N N 366 TRP HH2 H N N 367 TRP HXT H N N 368 TYR N N N N 369 TYR CA C N S 370 TYR C C N N 371 TYR O O N N 372 TYR CB C N N 373 TYR CG C Y N 374 TYR CD1 C Y N 375 TYR CD2 C Y N 376 TYR CE1 C Y N 377 TYR CE2 C Y N 378 TYR CZ C Y N 379 TYR OH O N N 380 TYR OXT O N N 381 TYR H H N N 382 TYR H2 H N N 383 TYR HA H N N 384 TYR HB2 H N N 385 TYR HB3 H N N 386 TYR HD1 H N N 387 TYR HD2 H N N 388 TYR HE1 H N N 389 TYR HE2 H N N 390 TYR HH H N N 391 TYR HXT H N N 392 VAL N N N N 393 VAL CA C N S 394 VAL C C N N 395 VAL O O N N 396 VAL CB C N N 397 VAL CG1 C N N 398 VAL CG2 C N N 399 VAL OXT O N N 400 VAL H H N N 401 VAL H2 H N N 402 VAL HA H N N 403 VAL HB H N N 404 VAL HG11 H N N 405 VAL HG12 H N N 406 VAL HG13 H N N 407 VAL HG21 H N N 408 VAL HG22 H N N 409 VAL HG23 H N N 410 VAL HXT H N N 411 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 TEP C1 N1 sing N N 290 TEP C1 H11 sing N N 291 TEP C1 H12 sing N N 292 TEP C1 H13 sing N N 293 TEP N1 C2 sing Y N 294 TEP N1 C6 sing Y N 295 TEP C2 O2 doub N N 296 TEP C2 N3 sing Y N 297 TEP N3 C3 sing N N 298 TEP N3 C4 sing Y N 299 TEP C3 H31 sing N N 300 TEP C3 H32 sing N N 301 TEP C3 H33 sing N N 302 TEP C4 C5 doub Y N 303 TEP C4 N9 sing Y N 304 TEP C5 C6 sing Y N 305 TEP C5 N7 sing Y N 306 TEP C6 O6 doub N N 307 TEP N7 C8 sing Y N 308 TEP N7 HN7 sing N N 309 TEP C8 N9 doub Y N 310 TEP C8 H8 sing N N 311 THR N CA sing N N 312 THR N H sing N N 313 THR N H2 sing N N 314 THR CA C sing N N 315 THR CA CB sing N N 316 THR CA HA sing N N 317 THR C O doub N N 318 THR C OXT sing N N 319 THR CB OG1 sing N N 320 THR CB CG2 sing N N 321 THR CB HB sing N N 322 THR OG1 HG1 sing N N 323 THR CG2 HG21 sing N N 324 THR CG2 HG22 sing N N 325 THR CG2 HG23 sing N N 326 THR OXT HXT sing N N 327 TRP N CA sing N N 328 TRP N H sing N N 329 TRP N H2 sing N N 330 TRP CA C sing N N 331 TRP CA CB sing N N 332 TRP CA HA sing N N 333 TRP C O doub N N 334 TRP C OXT sing N N 335 TRP CB CG sing N N 336 TRP CB HB2 sing N N 337 TRP CB HB3 sing N N 338 TRP CG CD1 doub Y N 339 TRP CG CD2 sing Y N 340 TRP CD1 NE1 sing Y N 341 TRP CD1 HD1 sing N N 342 TRP CD2 CE2 doub Y N 343 TRP CD2 CE3 sing Y N 344 TRP NE1 CE2 sing Y N 345 TRP NE1 HE1 sing N N 346 TRP CE2 CZ2 sing Y N 347 TRP CE3 CZ3 doub Y N 348 TRP CE3 HE3 sing N N 349 TRP CZ2 CH2 doub Y N 350 TRP CZ2 HZ2 sing N N 351 TRP CZ3 CH2 sing Y N 352 TRP CZ3 HZ3 sing N N 353 TRP CH2 HH2 sing N N 354 TRP OXT HXT sing N N 355 TYR N CA sing N N 356 TYR N H sing N N 357 TYR N H2 sing N N 358 TYR CA C sing N N 359 TYR CA CB sing N N 360 TYR CA HA sing N N 361 TYR C O doub N N 362 TYR C OXT sing N N 363 TYR CB CG sing N N 364 TYR CB HB2 sing N N 365 TYR CB HB3 sing N N 366 TYR CG CD1 doub Y N 367 TYR CG CD2 sing Y N 368 TYR CD1 CE1 sing Y N 369 TYR CD1 HD1 sing N N 370 TYR CD2 CE2 doub Y N 371 TYR CD2 HD2 sing N N 372 TYR CE1 CZ doub Y N 373 TYR CE1 HE1 sing N N 374 TYR CE2 CZ sing Y N 375 TYR CE2 HE2 sing N N 376 TYR CZ OH sing N N 377 TYR OH HH sing N N 378 TYR OXT HXT sing N N 379 VAL N CA sing N N 380 VAL N H sing N N 381 VAL N H2 sing N N 382 VAL CA C sing N N 383 VAL CA CB sing N N 384 VAL CA HA sing N N 385 VAL C O doub N N 386 VAL C OXT sing N N 387 VAL CB CG1 sing N N 388 VAL CB CG2 sing N N 389 VAL CB HB sing N N 390 VAL CG1 HG11 sing N N 391 VAL CG1 HG12 sing N N 392 VAL CG1 HG13 sing N N 393 VAL CG2 HG21 sing N N 394 VAL CG2 HG22 sing N N 395 VAL CG2 HG23 sing N N 396 VAL OXT HXT sing N N 397 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id TEP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id TEP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 THEOPHYLLINE TEP 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5XHK _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #