data_7VS3 # _entry.id 7VS3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7VS3 pdb_00007vs3 10.2210/pdb7vs3/pdb WWPDB D_1300025295 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7VS3 _pdbx_database_status.recvd_initial_deposition_date 2021-10-25 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhou, H.' 1 ? 'Wei, Z.Q.' 2 ? 'Zhang, L.' 3 ? 'Ren, Y.J.' 4 ? 'Ma, C.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Structure _citation.journal_id_ASTM STRUE6 _citation.journal_id_CSD 2005 _citation.journal_id_ISSN 0969-2126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 31 _citation.language ? _citation.page_first 424 _citation.page_last ? _citation.title 'The C 2 and PH domains of CAPS constitute an effective PI(4,5)P2-binding unit essential for Ca 2+ -regulated exocytosis.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.str.2023.02.004 _citation.pdbx_database_id_PubMed 36863339 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, L.' 1 ? primary 'Li, L.' 2 ? primary 'Wei, Z.' 3 ? primary 'Zhou, H.' 4 ? primary 'Liu, H.' 5 ? primary 'Wang, S.' 6 ? primary 'Ren, Y.' 7 ? primary 'Dai, T.' 8 ? primary 'Wang, J.' 9 ? primary 'Hu, Z.' 10 ? primary 'Ma, C.' 11 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7VS3 _cell.details ? _cell.formula_units_Z ? _cell.length_a 56.940 _cell.length_a_esd ? _cell.length_b 62.452 _cell.length_b_esd ? _cell.length_c 64.071 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7VS3 _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Calcium-dependent secretion activator 1' 27685.623 1 ? ? 'C2PH domain' ? 2 non-polymer syn 'SULFATE ION' 96.063 3 ? ? ? ? 3 water nat water 18.015 22 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Calcium-dependent activator protein for secretion 1,CAPS-1,rCAPS' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;DVLLSFSLEVVIMEVQGLKSLAPNRIVYCTMEVEGGEKLQTDQAEASKPTWGTQGDFSTTHALPAVKVKLFTESTGVLAL EDKELGRVILHPTPNSPKQSEWHKMTVSKNCPDQDLKIKLAVRMDKPQNMKHSGYLWTIGKNVWKRWKKRFFVLVQVSQY TFAMCSYREKKAEPQELLQLDGYTVDYTDPQPGLEGGRAFFNAVKEGDTVIFASDDEQDRILWVQAMYRATGQSHKPVPP TQVQ ; _entity_poly.pdbx_seq_one_letter_code_can ;DVLLSFSLEVVIMEVQGLKSLAPNRIVYCTMEVEGGEKLQTDQAEASKPTWGTQGDFSTTHALPAVKVKLFTESTGVLAL EDKELGRVILHPTPNSPKQSEWHKMTVSKNCPDQDLKIKLAVRMDKPQNMKHSGYLWTIGKNVWKRWKKRFFVLVQVSQY TFAMCSYREKKAEPQELLQLDGYTVDYTDPQPGLEGGRAFFNAVKEGDTVIFASDDEQDRILWVQAMYRATGQSHKPVPP TQVQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASP n 1 2 VAL n 1 3 LEU n 1 4 LEU n 1 5 SER n 1 6 PHE n 1 7 SER n 1 8 LEU n 1 9 GLU n 1 10 VAL n 1 11 VAL n 1 12 ILE n 1 13 MET n 1 14 GLU n 1 15 VAL n 1 16 GLN n 1 17 GLY n 1 18 LEU n 1 19 LYS n 1 20 SER n 1 21 LEU n 1 22 ALA n 1 23 PRO n 1 24 ASN n 1 25 ARG n 1 26 ILE n 1 27 VAL n 1 28 TYR n 1 29 CYS n 1 30 THR n 1 31 MET n 1 32 GLU n 1 33 VAL n 1 34 GLU n 1 35 GLY n 1 36 GLY n 1 37 GLU n 1 38 LYS n 1 39 LEU n 1 40 GLN n 1 41 THR n 1 42 ASP n 1 43 GLN n 1 44 ALA n 1 45 GLU n 1 46 ALA n 1 47 SER n 1 48 LYS n 1 49 PRO n 1 50 THR n 1 51 TRP n 1 52 GLY n 1 53 THR n 1 54 GLN n 1 55 GLY n 1 56 ASP n 1 57 PHE n 1 58 SER n 1 59 THR n 1 60 THR n 1 61 HIS n 1 62 ALA n 1 63 LEU n 1 64 PRO n 1 65 ALA n 1 66 VAL n 1 67 LYS n 1 68 VAL n 1 69 LYS n 1 70 LEU n 1 71 PHE n 1 72 THR n 1 73 GLU n 1 74 SER n 1 75 THR n 1 76 GLY n 1 77 VAL n 1 78 LEU n 1 79 ALA n 1 80 LEU n 1 81 GLU n 1 82 ASP n 1 83 LYS n 1 84 GLU n 1 85 LEU n 1 86 GLY n 1 87 ARG n 1 88 VAL n 1 89 ILE n 1 90 LEU n 1 91 HIS n 1 92 PRO n 1 93 THR n 1 94 PRO n 1 95 ASN n 1 96 SER n 1 97 PRO n 1 98 LYS n 1 99 GLN n 1 100 SER n 1 101 GLU n 1 102 TRP n 1 103 HIS n 1 104 LYS n 1 105 MET n 1 106 THR n 1 107 VAL n 1 108 SER n 1 109 LYS n 1 110 ASN n 1 111 CYS n 1 112 PRO n 1 113 ASP n 1 114 GLN n 1 115 ASP n 1 116 LEU n 1 117 LYS n 1 118 ILE n 1 119 LYS n 1 120 LEU n 1 121 ALA n 1 122 VAL n 1 123 ARG n 1 124 MET n 1 125 ASP n 1 126 LYS n 1 127 PRO n 1 128 GLN n 1 129 ASN n 1 130 MET n 1 131 LYS n 1 132 HIS n 1 133 SER n 1 134 GLY n 1 135 TYR n 1 136 LEU n 1 137 TRP n 1 138 THR n 1 139 ILE n 1 140 GLY n 1 141 LYS n 1 142 ASN n 1 143 VAL n 1 144 TRP n 1 145 LYS n 1 146 ARG n 1 147 TRP n 1 148 LYS n 1 149 LYS n 1 150 ARG n 1 151 PHE n 1 152 PHE n 1 153 VAL n 1 154 LEU n 1 155 VAL n 1 156 GLN n 1 157 VAL n 1 158 SER n 1 159 GLN n 1 160 TYR n 1 161 THR n 1 162 PHE n 1 163 ALA n 1 164 MET n 1 165 CYS n 1 166 SER n 1 167 TYR n 1 168 ARG n 1 169 GLU n 1 170 LYS n 1 171 LYS n 1 172 ALA n 1 173 GLU n 1 174 PRO n 1 175 GLN n 1 176 GLU n 1 177 LEU n 1 178 LEU n 1 179 GLN n 1 180 LEU n 1 181 ASP n 1 182 GLY n 1 183 TYR n 1 184 THR n 1 185 VAL n 1 186 ASP n 1 187 TYR n 1 188 THR n 1 189 ASP n 1 190 PRO n 1 191 GLN n 1 192 PRO n 1 193 GLY n 1 194 LEU n 1 195 GLU n 1 196 GLY n 1 197 GLY n 1 198 ARG n 1 199 ALA n 1 200 PHE n 1 201 PHE n 1 202 ASN n 1 203 ALA n 1 204 VAL n 1 205 LYS n 1 206 GLU n 1 207 GLY n 1 208 ASP n 1 209 THR n 1 210 VAL n 1 211 ILE n 1 212 PHE n 1 213 ALA n 1 214 SER n 1 215 ASP n 1 216 ASP n 1 217 GLU n 1 218 GLN n 1 219 ASP n 1 220 ARG n 1 221 ILE n 1 222 LEU n 1 223 TRP n 1 224 VAL n 1 225 GLN n 1 226 ALA n 1 227 MET n 1 228 TYR n 1 229 ARG n 1 230 ALA n 1 231 THR n 1 232 GLY n 1 233 GLN n 1 234 SER n 1 235 HIS n 1 236 LYS n 1 237 PRO n 1 238 VAL n 1 239 PRO n 1 240 PRO n 1 241 THR n 1 242 GLN n 1 243 VAL n 1 244 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 244 _entity_src_gen.gene_src_common_name Rat _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Cadps, Caps, Caps1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CAPS1_RAT _struct_ref.pdbx_db_accession Q62717 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DVLLSFSLEVVIMEVQGLKSLAPNRIVYCTMEVEGGEKLQTDQAEASKPTWGTQGDFSTTHALPAVKVKLFTESTGVLAL EDKELGRVILHPTPNSPKQSEWHKMTVSKNCPDQDLKIKLAVRMDKPQNMKHSGYLWTIGKNVWKRWKKRFFVLVQVSQY TFAMCSYREKKAEPQELLQLDGYTVDYTDPQPGLEGGRAFFNAVKEGDTVIFASDDEQDRILWVQAMYRATGQSHKPVPP TQVQ ; _struct_ref.pdbx_align_begin 391 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7VS3 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 244 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q62717 _struct_ref_seq.db_align_beg 391 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 634 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 391 _struct_ref_seq.pdbx_auth_seq_align_end 634 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7VS3 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.06 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 40.21 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.4 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M Tris pH 8.5, 2.5M ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range '8.0 - 8.5' # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2017-11-11 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator M _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9793 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL18U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9793 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL18U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7VS3 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.59 _reflns.d_resolution_low 50.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7469 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.0 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.225 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.59 _reflns_shell.d_res_low 2.69 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.0 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 716 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 8.1 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 0.779 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 65.300 _refine.B_iso_mean 40.8747 _refine.B_iso_min 30.210 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7VS3 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5950 _refine.ls_d_res_low 42.5610 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7388 _refine.ls_number_reflns_R_free 375 _refine.ls_number_reflns_R_work 7013 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.0300 _refine.ls_percent_reflns_R_free 5.0800 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2261 _refine.ls_R_factor_R_free 0.2790 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2230 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model '1WI1, 3W56' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.5800 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3500 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.5950 _refine_hist.d_res_low 42.5610 _refine_hist.number_atoms_solvent 22 _refine_hist.number_atoms_total 1860 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 235 _refine_hist.pdbx_B_iso_mean_ligand 53.81 _refine_hist.pdbx_B_iso_mean_solvent 40.55 _refine_hist.pdbx_number_atoms_protein 1823 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 15 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 1880 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.613 ? 2557 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.043 ? 282 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 325 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.162 ? 1118 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.5952 2.9706 . . 115 2271 98.0000 . . . 0.3491 0.0000 0.2823 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9706 3.7424 . . 127 2320 100.0000 . . . 0.2859 0.0000 0.2267 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7424 42.5610 . . 133 2422 99.0000 . . . 0.2553 0.0000 0.2028 . . . . . . . . . . . # _struct.entry_id 7VS3 _struct.title 'The crystal structure of rat calcium-dependent activator protein for secretion (CAPS) C2PH' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7VS3 _struct_keywords.text 'Ca2+-dependent exocytosis; Vesicle priming; Munc13; CAPS; SNARE complex assembly, EXOCYTOSIS' _struct_keywords.pdbx_keywords EXOCYTOSIS # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id ASP _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 216 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLY _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 232 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id ASP _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 606 _struct_conf.end_auth_comp_id GLY _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 622 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 3 ? AA3 ? 4 ? AA4 ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? anti-parallel AA4 4 5 ? anti-parallel AA4 5 6 ? anti-parallel AA4 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 50 ? THR A 59 ? THR A 440 THR A 449 AA1 2 PHE A 6 ? GLN A 16 ? PHE A 396 GLN A 406 AA1 3 LYS A 117 ? MET A 124 ? LYS A 507 MET A 514 AA1 4 GLU A 101 ? LYS A 104 ? GLU A 491 LYS A 494 AA2 1 LYS A 38 ? GLN A 40 ? LYS A 428 GLN A 430 AA2 2 ILE A 26 ? VAL A 33 ? ILE A 416 VAL A 423 AA2 3 ALA A 44 ? GLU A 45 ? ALA A 434 GLU A 435 AA3 1 LYS A 38 ? GLN A 40 ? LYS A 428 GLN A 430 AA3 2 ILE A 26 ? VAL A 33 ? ILE A 416 VAL A 423 AA3 3 VAL A 66 ? GLU A 73 ? VAL A 456 GLU A 463 AA3 4 ASP A 82 ? LEU A 90 ? ASP A 472 LEU A 480 AA4 1 GLU A 176 ? GLN A 179 ? GLU A 566 GLN A 569 AA4 2 PHE A 162 ? TYR A 167 ? PHE A 552 TYR A 557 AA4 3 LYS A 148 ? GLN A 156 ? LYS A 538 GLN A 546 AA4 4 MET A 130 ? GLY A 140 ? MET A 520 GLY A 530 AA4 5 ASP A 208 ? SER A 214 ? ASP A 598 SER A 604 AA4 6 ALA A 199 ? LYS A 205 ? ALA A 589 LYS A 595 AA4 7 THR A 184 ? TYR A 187 ? THR A 574 TYR A 577 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O PHE A 57 ? O PHE A 447 N LEU A 8 ? N LEU A 398 AA1 2 3 N GLN A 16 ? N GLN A 406 O LYS A 117 ? O LYS A 507 AA1 3 4 O LEU A 120 ? O LEU A 510 N GLU A 101 ? N GLU A 491 AA2 1 2 O LEU A 39 ? O LEU A 429 N MET A 31 ? N MET A 421 AA2 2 3 N VAL A 27 ? N VAL A 417 O ALA A 44 ? O ALA A 434 AA3 1 2 O LEU A 39 ? O LEU A 429 N MET A 31 ? N MET A 421 AA3 2 3 N TYR A 28 ? N TYR A 418 O PHE A 71 ? O PHE A 461 AA3 3 4 N VAL A 66 ? N VAL A 456 O LEU A 90 ? O LEU A 480 AA4 1 2 O LEU A 178 ? O LEU A 568 N MET A 164 ? N MET A 554 AA4 2 3 O CYS A 165 ? O CYS A 555 N VAL A 153 ? N VAL A 543 AA4 3 4 O LEU A 154 ? O LEU A 544 N HIS A 132 ? N HIS A 522 AA4 4 5 N ILE A 139 ? N ILE A 529 O ILE A 211 ? O ILE A 601 AA4 5 6 O PHE A 212 ? O PHE A 602 N PHE A 201 ? N PHE A 591 AA4 6 7 O VAL A 204 ? O VAL A 594 N THR A 184 ? N THR A 574 # _atom_sites.entry_id 7VS3 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.017562 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016012 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015608 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASP 1 391 391 ASP ASP A . n A 1 2 VAL 2 392 392 VAL VAL A . n A 1 3 LEU 3 393 393 LEU LEU A . n A 1 4 LEU 4 394 394 LEU LEU A . n A 1 5 SER 5 395 395 SER SER A . n A 1 6 PHE 6 396 396 PHE PHE A . n A 1 7 SER 7 397 397 SER SER A . n A 1 8 LEU 8 398 398 LEU LEU A . n A 1 9 GLU 9 399 399 GLU GLU A . n A 1 10 VAL 10 400 400 VAL VAL A . n A 1 11 VAL 11 401 401 VAL VAL A . n A 1 12 ILE 12 402 402 ILE ILE A . n A 1 13 MET 13 403 403 MET MET A . n A 1 14 GLU 14 404 404 GLU GLU A . n A 1 15 VAL 15 405 405 VAL VAL A . n A 1 16 GLN 16 406 406 GLN GLN A . n A 1 17 GLY 17 407 407 GLY GLY A . n A 1 18 LEU 18 408 408 LEU LEU A . n A 1 19 LYS 19 409 409 LYS LYS A . n A 1 20 SER 20 410 410 SER SER A . n A 1 21 LEU 21 411 411 LEU LEU A . n A 1 22 ALA 22 412 412 ALA ALA A . n A 1 23 PRO 23 413 413 PRO PRO A . n A 1 24 ASN 24 414 414 ASN ASN A . n A 1 25 ARG 25 415 415 ARG ARG A . n A 1 26 ILE 26 416 416 ILE ILE A . n A 1 27 VAL 27 417 417 VAL VAL A . n A 1 28 TYR 28 418 418 TYR TYR A . n A 1 29 CYS 29 419 419 CYS CYS A . n A 1 30 THR 30 420 420 THR THR A . n A 1 31 MET 31 421 421 MET MET A . n A 1 32 GLU 32 422 422 GLU GLU A . n A 1 33 VAL 33 423 423 VAL VAL A . n A 1 34 GLU 34 424 424 GLU GLU A . n A 1 35 GLY 35 425 425 GLY GLY A . n A 1 36 GLY 36 426 426 GLY GLY A . n A 1 37 GLU 37 427 427 GLU GLU A . n A 1 38 LYS 38 428 428 LYS LYS A . n A 1 39 LEU 39 429 429 LEU LEU A . n A 1 40 GLN 40 430 430 GLN GLN A . n A 1 41 THR 41 431 431 THR THR A . n A 1 42 ASP 42 432 432 ASP ASP A . n A 1 43 GLN 43 433 433 GLN GLN A . n A 1 44 ALA 44 434 434 ALA ALA A . n A 1 45 GLU 45 435 435 GLU GLU A . n A 1 46 ALA 46 436 436 ALA ALA A . n A 1 47 SER 47 437 437 SER SER A . n A 1 48 LYS 48 438 438 LYS LYS A . n A 1 49 PRO 49 439 439 PRO PRO A . n A 1 50 THR 50 440 440 THR THR A . n A 1 51 TRP 51 441 441 TRP TRP A . n A 1 52 GLY 52 442 442 GLY GLY A . n A 1 53 THR 53 443 443 THR THR A . n A 1 54 GLN 54 444 444 GLN GLN A . n A 1 55 GLY 55 445 445 GLY GLY A . n A 1 56 ASP 56 446 446 ASP ASP A . n A 1 57 PHE 57 447 447 PHE PHE A . n A 1 58 SER 58 448 448 SER SER A . n A 1 59 THR 59 449 449 THR THR A . n A 1 60 THR 60 450 450 THR THR A . n A 1 61 HIS 61 451 451 HIS HIS A . n A 1 62 ALA 62 452 452 ALA ALA A . n A 1 63 LEU 63 453 453 LEU LEU A . n A 1 64 PRO 64 454 454 PRO PRO A . n A 1 65 ALA 65 455 455 ALA ALA A . n A 1 66 VAL 66 456 456 VAL VAL A . n A 1 67 LYS 67 457 457 LYS LYS A . n A 1 68 VAL 68 458 458 VAL VAL A . n A 1 69 LYS 69 459 459 LYS LYS A . n A 1 70 LEU 70 460 460 LEU LEU A . n A 1 71 PHE 71 461 461 PHE PHE A . n A 1 72 THR 72 462 462 THR THR A . n A 1 73 GLU 73 463 463 GLU GLU A . n A 1 74 SER 74 464 464 SER SER A . n A 1 75 THR 75 465 ? ? ? A . n A 1 76 GLY 76 466 ? ? ? A . n A 1 77 VAL 77 467 ? ? ? A . n A 1 78 LEU 78 468 ? ? ? A . n A 1 79 ALA 79 469 ? ? ? A . n A 1 80 LEU 80 470 470 LEU LEU A . n A 1 81 GLU 81 471 471 GLU GLU A . n A 1 82 ASP 82 472 472 ASP ASP A . n A 1 83 LYS 83 473 473 LYS LYS A . n A 1 84 GLU 84 474 474 GLU GLU A . n A 1 85 LEU 85 475 475 LEU LEU A . n A 1 86 GLY 86 476 476 GLY GLY A . n A 1 87 ARG 87 477 477 ARG ARG A . n A 1 88 VAL 88 478 478 VAL VAL A . n A 1 89 ILE 89 479 479 ILE ILE A . n A 1 90 LEU 90 480 480 LEU LEU A . n A 1 91 HIS 91 481 481 HIS HIS A . n A 1 92 PRO 92 482 482 PRO PRO A . n A 1 93 THR 93 483 483 THR THR A . n A 1 94 PRO 94 484 484 PRO PRO A . n A 1 95 ASN 95 485 485 ASN ASN A . n A 1 96 SER 96 486 486 SER SER A . n A 1 97 PRO 97 487 487 PRO PRO A . n A 1 98 LYS 98 488 488 LYS LYS A . n A 1 99 GLN 99 489 489 GLN GLN A . n A 1 100 SER 100 490 490 SER SER A . n A 1 101 GLU 101 491 491 GLU GLU A . n A 1 102 TRP 102 492 492 TRP TRP A . n A 1 103 HIS 103 493 493 HIS HIS A . n A 1 104 LYS 104 494 494 LYS LYS A . n A 1 105 MET 105 495 495 MET MET A . n A 1 106 THR 106 496 496 THR THR A . n A 1 107 VAL 107 497 497 VAL VAL A . n A 1 108 SER 108 498 498 SER SER A . n A 1 109 LYS 109 499 499 LYS LYS A . n A 1 110 ASN 110 500 500 ASN ASN A . n A 1 111 CYS 111 501 501 CYS CYS A . n A 1 112 PRO 112 502 502 PRO PRO A . n A 1 113 ASP 113 503 503 ASP ASP A . n A 1 114 GLN 114 504 504 GLN GLN A . n A 1 115 ASP 115 505 505 ASP ASP A . n A 1 116 LEU 116 506 506 LEU LEU A . n A 1 117 LYS 117 507 507 LYS LYS A . n A 1 118 ILE 118 508 508 ILE ILE A . n A 1 119 LYS 119 509 509 LYS LYS A . n A 1 120 LEU 120 510 510 LEU LEU A . n A 1 121 ALA 121 511 511 ALA ALA A . n A 1 122 VAL 122 512 512 VAL VAL A . n A 1 123 ARG 123 513 513 ARG ARG A . n A 1 124 MET 124 514 514 MET MET A . n A 1 125 ASP 125 515 515 ASP ASP A . n A 1 126 LYS 126 516 516 LYS LYS A . n A 1 127 PRO 127 517 517 PRO PRO A . n A 1 128 GLN 128 518 518 GLN GLN A . n A 1 129 ASN 129 519 519 ASN ASN A . n A 1 130 MET 130 520 520 MET MET A . n A 1 131 LYS 131 521 521 LYS LYS A . n A 1 132 HIS 132 522 522 HIS HIS A . n A 1 133 SER 133 523 523 SER SER A . n A 1 134 GLY 134 524 524 GLY GLY A . n A 1 135 TYR 135 525 525 TYR TYR A . n A 1 136 LEU 136 526 526 LEU LEU A . n A 1 137 TRP 137 527 527 TRP TRP A . n A 1 138 THR 138 528 528 THR THR A . n A 1 139 ILE 139 529 529 ILE ILE A . n A 1 140 GLY 140 530 530 GLY GLY A . n A 1 141 LYS 141 531 531 LYS LYS A . n A 1 142 ASN 142 532 532 ASN ASN A . n A 1 143 VAL 143 533 533 VAL VAL A . n A 1 144 TRP 144 534 534 TRP TRP A . n A 1 145 LYS 145 535 535 LYS LYS A . n A 1 146 ARG 146 536 536 ARG ARG A . n A 1 147 TRP 147 537 537 TRP TRP A . n A 1 148 LYS 148 538 538 LYS LYS A . n A 1 149 LYS 149 539 539 LYS LYS A . n A 1 150 ARG 150 540 540 ARG ARG A . n A 1 151 PHE 151 541 541 PHE PHE A . n A 1 152 PHE 152 542 542 PHE PHE A . n A 1 153 VAL 153 543 543 VAL VAL A . n A 1 154 LEU 154 544 544 LEU LEU A . n A 1 155 VAL 155 545 545 VAL VAL A . n A 1 156 GLN 156 546 546 GLN GLN A . n A 1 157 VAL 157 547 547 VAL VAL A . n A 1 158 SER 158 548 548 SER SER A . n A 1 159 GLN 159 549 549 GLN GLN A . n A 1 160 TYR 160 550 550 TYR TYR A . n A 1 161 THR 161 551 551 THR THR A . n A 1 162 PHE 162 552 552 PHE PHE A . n A 1 163 ALA 163 553 553 ALA ALA A . n A 1 164 MET 164 554 554 MET MET A . n A 1 165 CYS 165 555 555 CYS CYS A . n A 1 166 SER 166 556 556 SER SER A . n A 1 167 TYR 167 557 557 TYR TYR A . n A 1 168 ARG 168 558 558 ARG ARG A . n A 1 169 GLU 169 559 559 GLU GLU A . n A 1 170 LYS 170 560 560 LYS LYS A . n A 1 171 LYS 171 561 561 LYS LYS A . n A 1 172 ALA 172 562 562 ALA ALA A . n A 1 173 GLU 173 563 563 GLU GLU A . n A 1 174 PRO 174 564 564 PRO PRO A . n A 1 175 GLN 175 565 565 GLN GLN A . n A 1 176 GLU 176 566 566 GLU GLU A . n A 1 177 LEU 177 567 567 LEU LEU A . n A 1 178 LEU 178 568 568 LEU LEU A . n A 1 179 GLN 179 569 569 GLN GLN A . n A 1 180 LEU 180 570 570 LEU LEU A . n A 1 181 ASP 181 571 571 ASP ASP A . n A 1 182 GLY 182 572 572 GLY GLY A . n A 1 183 TYR 183 573 573 TYR TYR A . n A 1 184 THR 184 574 574 THR THR A . n A 1 185 VAL 185 575 575 VAL VAL A . n A 1 186 ASP 186 576 576 ASP ASP A . n A 1 187 TYR 187 577 577 TYR TYR A . n A 1 188 THR 188 578 578 THR THR A . n A 1 189 ASP 189 579 579 ASP ASP A . n A 1 190 PRO 190 580 580 PRO PRO A . n A 1 191 GLN 191 581 581 GLN GLN A . n A 1 192 PRO 192 582 582 PRO PRO A . n A 1 193 GLY 193 583 583 GLY GLY A . n A 1 194 LEU 194 584 584 LEU LEU A . n A 1 195 GLU 195 585 585 GLU GLU A . n A 1 196 GLY 196 586 586 GLY GLY A . n A 1 197 GLY 197 587 587 GLY GLY A . n A 1 198 ARG 198 588 588 ARG ARG A . n A 1 199 ALA 199 589 589 ALA ALA A . n A 1 200 PHE 200 590 590 PHE PHE A . n A 1 201 PHE 201 591 591 PHE PHE A . n A 1 202 ASN 202 592 592 ASN ASN A . n A 1 203 ALA 203 593 593 ALA ALA A . n A 1 204 VAL 204 594 594 VAL VAL A . n A 1 205 LYS 205 595 595 LYS LYS A . n A 1 206 GLU 206 596 596 GLU GLU A . n A 1 207 GLY 207 597 597 GLY GLY A . n A 1 208 ASP 208 598 598 ASP ASP A . n A 1 209 THR 209 599 599 THR THR A . n A 1 210 VAL 210 600 600 VAL VAL A . n A 1 211 ILE 211 601 601 ILE ILE A . n A 1 212 PHE 212 602 602 PHE PHE A . n A 1 213 ALA 213 603 603 ALA ALA A . n A 1 214 SER 214 604 604 SER SER A . n A 1 215 ASP 215 605 605 ASP ASP A . n A 1 216 ASP 216 606 606 ASP ASP A . n A 1 217 GLU 217 607 607 GLU GLU A . n A 1 218 GLN 218 608 608 GLN GLN A . n A 1 219 ASP 219 609 609 ASP ASP A . n A 1 220 ARG 220 610 610 ARG ARG A . n A 1 221 ILE 221 611 611 ILE ILE A . n A 1 222 LEU 222 612 612 LEU LEU A . n A 1 223 TRP 223 613 613 TRP TRP A . n A 1 224 VAL 224 614 614 VAL VAL A . n A 1 225 GLN 225 615 615 GLN GLN A . n A 1 226 ALA 226 616 616 ALA ALA A . n A 1 227 MET 227 617 617 MET MET A . n A 1 228 TYR 228 618 618 TYR TYR A . n A 1 229 ARG 229 619 619 ARG ARG A . n A 1 230 ALA 230 620 620 ALA ALA A . n A 1 231 THR 231 621 621 THR THR A . n A 1 232 GLY 232 622 622 GLY GLY A . n A 1 233 GLN 233 623 623 GLN GLN A . n A 1 234 SER 234 624 624 SER SER A . n A 1 235 HIS 235 625 625 HIS HIS A . n A 1 236 LYS 236 626 626 LYS LYS A . n A 1 237 PRO 237 627 627 PRO PRO A . n A 1 238 VAL 238 628 628 VAL VAL A . n A 1 239 PRO 239 629 629 PRO PRO A . n A 1 240 PRO 240 630 630 PRO PRO A . n A 1 241 THR 241 631 ? ? ? A . n A 1 242 GLN 242 632 ? ? ? A . n A 1 243 VAL 243 633 ? ? ? A . n A 1 244 GLN 244 634 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email cong.ma@hust.edu.cn _pdbx_contact_author.name_first Cong _pdbx_contact_author.name_last Ma _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7814-0500 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 701 701 SO4 SO4 A . C 2 SO4 1 702 702 SO4 SO4 A . D 2 SO4 1 703 703 SO4 SO4 A . E 3 HOH 1 801 22 HOH HOH A . E 3 HOH 2 802 6 HOH HOH A . E 3 HOH 3 803 10 HOH HOH A . E 3 HOH 4 804 14 HOH HOH A . E 3 HOH 5 805 21 HOH HOH A . E 3 HOH 6 806 20 HOH HOH A . E 3 HOH 7 807 3 HOH HOH A . E 3 HOH 8 808 8 HOH HOH A . E 3 HOH 9 809 17 HOH HOH A . E 3 HOH 10 810 5 HOH HOH A . E 3 HOH 11 811 15 HOH HOH A . E 3 HOH 12 812 18 HOH HOH A . E 3 HOH 13 813 13 HOH HOH A . E 3 HOH 14 814 2 HOH HOH A . E 3 HOH 15 815 12 HOH HOH A . E 3 HOH 16 816 4 HOH HOH A . E 3 HOH 17 817 1 HOH HOH A . E 3 HOH 18 818 19 HOH HOH A . E 3 HOH 19 819 7 HOH HOH A . E 3 HOH 20 820 16 HOH HOH A . E 3 HOH 21 821 9 HOH HOH A . E 3 HOH 22 822 11 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 240 ? 1 MORE -17 ? 1 'SSA (A^2)' 11840 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 802 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id E _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-02-15 2 'Structure model' 1 1 2023-04-05 3 'Structure model' 1 2 2023-04-26 4 'Structure model' 1 3 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 2 'Structure model' '_citation_author.name' 11 3 'Structure model' '_citation.journal_volume' 12 3 'Structure model' '_citation.page_first' # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1_2575 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24 5 # _pdbx_entry_details.entry_id 7VS3 _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 609 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 801 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.07 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 403 ? ? -92.34 -64.63 2 1 LEU A 408 ? ? -111.70 62.82 3 1 LEU A 453 ? ? -119.91 68.99 4 1 GLU A 471 ? ? 52.89 -144.30 5 1 SER A 498 ? ? -68.54 0.02 6 1 PRO A 502 ? ? -81.61 30.99 7 1 ASP A 503 ? ? -104.52 68.60 8 1 ASP A 505 ? ? -82.02 37.39 9 1 LYS A 535 ? ? -76.15 21.58 10 1 TRP A 537 ? ? -57.96 106.08 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP 391 ? CG ? A ASP 1 CG 2 1 Y 1 A ASP 391 ? OD1 ? A ASP 1 OD1 3 1 Y 1 A ASP 391 ? OD2 ? A ASP 1 OD2 4 1 Y 1 A SER 395 ? OG ? A SER 5 OG 5 1 Y 1 A LYS 409 ? CG ? A LYS 19 CG 6 1 Y 1 A LYS 409 ? CD ? A LYS 19 CD 7 1 Y 1 A LYS 409 ? CE ? A LYS 19 CE 8 1 Y 1 A LYS 409 ? NZ ? A LYS 19 NZ 9 1 Y 1 A GLU 471 ? CG ? A GLU 81 CG 10 1 Y 1 A GLU 471 ? CD ? A GLU 81 CD 11 1 Y 1 A GLU 471 ? OE1 ? A GLU 81 OE1 12 1 Y 1 A GLU 471 ? OE2 ? A GLU 81 OE2 13 1 Y 1 A LYS 473 ? CG ? A LYS 83 CG 14 1 Y 1 A LYS 473 ? CD ? A LYS 83 CD 15 1 Y 1 A LYS 473 ? CE ? A LYS 83 CE 16 1 Y 1 A LYS 473 ? NZ ? A LYS 83 NZ 17 1 Y 1 A THR 483 ? OG1 ? A THR 93 OG1 18 1 Y 1 A THR 483 ? CG2 ? A THR 93 CG2 19 1 Y 1 A LYS 499 ? CG ? A LYS 109 CG 20 1 Y 1 A LYS 499 ? CD ? A LYS 109 CD 21 1 Y 1 A LYS 499 ? CE ? A LYS 109 CE 22 1 Y 1 A LYS 499 ? NZ ? A LYS 109 NZ 23 1 Y 1 A ASN 500 ? CG ? A ASN 110 CG 24 1 Y 1 A ASN 500 ? OD1 ? A ASN 110 OD1 25 1 Y 1 A ASN 500 ? ND2 ? A ASN 110 ND2 26 1 Y 1 A CYS 501 ? SG ? A CYS 111 SG 27 1 Y 1 A ASP 505 ? CG ? A ASP 115 CG 28 1 Y 1 A ASP 505 ? OD1 ? A ASP 115 OD1 29 1 Y 1 A ASP 505 ? OD2 ? A ASP 115 OD2 30 1 Y 1 A LYS 531 ? CD ? A LYS 141 CD 31 1 Y 1 A LYS 531 ? CE ? A LYS 141 CE 32 1 Y 1 A LYS 531 ? NZ ? A LYS 141 NZ 33 1 Y 1 A ARG 536 ? CG ? A ARG 146 CG 34 1 Y 1 A ARG 536 ? CD ? A ARG 146 CD 35 1 Y 1 A ARG 536 ? NE ? A ARG 146 NE 36 1 Y 1 A ARG 536 ? CZ ? A ARG 146 CZ 37 1 Y 1 A ARG 536 ? NH1 ? A ARG 146 NH1 38 1 Y 1 A ARG 536 ? NH2 ? A ARG 146 NH2 39 1 Y 1 A GLN 549 ? CG ? A GLN 159 CG 40 1 Y 1 A GLN 549 ? CD ? A GLN 159 CD 41 1 Y 1 A GLN 549 ? OE1 ? A GLN 159 OE1 42 1 Y 1 A GLN 549 ? NE2 ? A GLN 159 NE2 43 1 Y 1 A LYS 561 ? CE ? A LYS 171 CE 44 1 Y 1 A LYS 561 ? NZ ? A LYS 171 NZ 45 1 Y 1 A GLN 569 ? CG ? A GLN 179 CG 46 1 Y 1 A GLN 569 ? CD ? A GLN 179 CD 47 1 Y 1 A GLN 569 ? OE1 ? A GLN 179 OE1 48 1 Y 1 A GLN 569 ? NE2 ? A GLN 179 NE2 49 1 Y 1 A ARG 588 ? NE ? A ARG 198 NE 50 1 Y 1 A ARG 588 ? CZ ? A ARG 198 CZ 51 1 Y 1 A ARG 588 ? NH1 ? A ARG 198 NH1 52 1 Y 1 A ARG 588 ? NH2 ? A ARG 198 NH2 53 1 Y 1 A GLN 608 ? CG ? A GLN 218 CG 54 1 Y 1 A GLN 608 ? CD ? A GLN 218 CD 55 1 Y 1 A GLN 608 ? OE1 ? A GLN 218 OE1 56 1 Y 1 A GLN 608 ? NE2 ? A GLN 218 NE2 57 1 Y 1 A LYS 626 ? CD ? A LYS 236 CD 58 1 Y 1 A LYS 626 ? CE ? A LYS 236 CE 59 1 Y 1 A LYS 626 ? NZ ? A LYS 236 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A THR 465 ? A THR 75 2 1 Y 1 A GLY 466 ? A GLY 76 3 1 Y 1 A VAL 467 ? A VAL 77 4 1 Y 1 A LEU 468 ? A LEU 78 5 1 Y 1 A ALA 469 ? A ALA 79 6 1 Y 1 A THR 631 ? A THR 241 7 1 Y 1 A GLN 632 ? A GLN 242 8 1 Y 1 A VAL 633 ? A VAL 243 9 1 Y 1 A GLN 634 ? A GLN 244 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 SO4 S S N N 304 SO4 O1 O N N 305 SO4 O2 O N N 306 SO4 O3 O N N 307 SO4 O4 O N N 308 THR N N N N 309 THR CA C N S 310 THR C C N N 311 THR O O N N 312 THR CB C N R 313 THR OG1 O N N 314 THR CG2 C N N 315 THR OXT O N N 316 THR H H N N 317 THR H2 H N N 318 THR HA H N N 319 THR HB H N N 320 THR HG1 H N N 321 THR HG21 H N N 322 THR HG22 H N N 323 THR HG23 H N N 324 THR HXT H N N 325 TRP N N N N 326 TRP CA C N S 327 TRP C C N N 328 TRP O O N N 329 TRP CB C N N 330 TRP CG C Y N 331 TRP CD1 C Y N 332 TRP CD2 C Y N 333 TRP NE1 N Y N 334 TRP CE2 C Y N 335 TRP CE3 C Y N 336 TRP CZ2 C Y N 337 TRP CZ3 C Y N 338 TRP CH2 C Y N 339 TRP OXT O N N 340 TRP H H N N 341 TRP H2 H N N 342 TRP HA H N N 343 TRP HB2 H N N 344 TRP HB3 H N N 345 TRP HD1 H N N 346 TRP HE1 H N N 347 TRP HE3 H N N 348 TRP HZ2 H N N 349 TRP HZ3 H N N 350 TRP HH2 H N N 351 TRP HXT H N N 352 TYR N N N N 353 TYR CA C N S 354 TYR C C N N 355 TYR O O N N 356 TYR CB C N N 357 TYR CG C Y N 358 TYR CD1 C Y N 359 TYR CD2 C Y N 360 TYR CE1 C Y N 361 TYR CE2 C Y N 362 TYR CZ C Y N 363 TYR OH O N N 364 TYR OXT O N N 365 TYR H H N N 366 TYR H2 H N N 367 TYR HA H N N 368 TYR HB2 H N N 369 TYR HB3 H N N 370 TYR HD1 H N N 371 TYR HD2 H N N 372 TYR HE1 H N N 373 TYR HE2 H N N 374 TYR HH H N N 375 TYR HXT H N N 376 VAL N N N N 377 VAL CA C N S 378 VAL C C N N 379 VAL O O N N 380 VAL CB C N N 381 VAL CG1 C N N 382 VAL CG2 C N N 383 VAL OXT O N N 384 VAL H H N N 385 VAL H2 H N N 386 VAL HA H N N 387 VAL HB H N N 388 VAL HG11 H N N 389 VAL HG12 H N N 390 VAL HG13 H N N 391 VAL HG21 H N N 392 VAL HG22 H N N 393 VAL HG23 H N N 394 VAL HXT H N N 395 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 SO4 S O1 doub N N 290 SO4 S O2 doub N N 291 SO4 S O3 sing N N 292 SO4 S O4 sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TRP N CA sing N N 310 TRP N H sing N N 311 TRP N H2 sing N N 312 TRP CA C sing N N 313 TRP CA CB sing N N 314 TRP CA HA sing N N 315 TRP C O doub N N 316 TRP C OXT sing N N 317 TRP CB CG sing N N 318 TRP CB HB2 sing N N 319 TRP CB HB3 sing N N 320 TRP CG CD1 doub Y N 321 TRP CG CD2 sing Y N 322 TRP CD1 NE1 sing Y N 323 TRP CD1 HD1 sing N N 324 TRP CD2 CE2 doub Y N 325 TRP CD2 CE3 sing Y N 326 TRP NE1 CE2 sing Y N 327 TRP NE1 HE1 sing N N 328 TRP CE2 CZ2 sing Y N 329 TRP CE3 CZ3 doub Y N 330 TRP CE3 HE3 sing N N 331 TRP CZ2 CH2 doub Y N 332 TRP CZ2 HZ2 sing N N 333 TRP CZ3 CH2 sing Y N 334 TRP CZ3 HZ3 sing N N 335 TRP CH2 HH2 sing N N 336 TRP OXT HXT sing N N 337 TYR N CA sing N N 338 TYR N H sing N N 339 TYR N H2 sing N N 340 TYR CA C sing N N 341 TYR CA CB sing N N 342 TYR CA HA sing N N 343 TYR C O doub N N 344 TYR C OXT sing N N 345 TYR CB CG sing N N 346 TYR CB HB2 sing N N 347 TYR CB HB3 sing N N 348 TYR CG CD1 doub Y N 349 TYR CG CD2 sing Y N 350 TYR CD1 CE1 sing Y N 351 TYR CD1 HD1 sing N N 352 TYR CD2 CE2 doub Y N 353 TYR CD2 HD2 sing N N 354 TYR CE1 CZ doub Y N 355 TYR CE1 HE1 sing N N 356 TYR CE2 CZ sing Y N 357 TYR CE2 HE2 sing N N 358 TYR CZ OH sing N N 359 TYR OH HH sing N N 360 TYR OXT HXT sing N N 361 VAL N CA sing N N 362 VAL N H sing N N 363 VAL N H2 sing N N 364 VAL CA C sing N N 365 VAL CA CB sing N N 366 VAL CA HA sing N N 367 VAL C O doub N N 368 VAL C OXT sing N N 369 VAL CB CG1 sing N N 370 VAL CB CG2 sing N N 371 VAL CB HB sing N N 372 VAL CG1 HG11 sing N N 373 VAL CG1 HG12 sing N N 374 VAL CG1 HG13 sing N N 375 VAL CG2 HG21 sing N N 376 VAL CG2 HG22 sing N N 377 VAL CG2 HG23 sing N N 378 VAL OXT HXT sing N N 379 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Natural Science Foundation of China (NSFC)' China 31670846 1 'National Natural Science Foundation of China (NSFC)' China 31721002 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH # loop_ _pdbx_initial_refinement_model.id _pdbx_initial_refinement_model.entity_id_list _pdbx_initial_refinement_model.type _pdbx_initial_refinement_model.source_name _pdbx_initial_refinement_model.accession_code _pdbx_initial_refinement_model.details 1 ? 'experimental model' PDB 1WI1 '1WI1, 3W56' 2 ? 'experimental model' PDB 3W56 '1WI1, 3W56' # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #