data_7VV0 # _entry.id 7VV0 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.359 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7VV0 pdb_00007vv0 10.2210/pdb7vv0/pdb WWPDB D_1300025439 ? ? EMDB EMD-32133 ? ? # _pdbx_database_related.db_name EMDB _pdbx_database_related.details 'Cryo-EM structure of pseudoallergen receptor MRGPRX2 complex with PAMP-12, local' _pdbx_database_related.db_id EMD-32133 _pdbx_database_related.content_type 'associated EM volume' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7VV0 _pdbx_database_status.recvd_initial_deposition_date 2021-11-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Li, Y.' 1 ? 'Yang, F.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nature _citation.journal_id_ASTM NATUAS _citation.journal_id_CSD 0006 _citation.journal_id_ISSN 1476-4687 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 600 _citation.language ? _citation.page_first 164 _citation.page_last 169 _citation.title 'Structure, function and pharmacology of human itch receptor complexes.' _citation.year 2021 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41586-021-04077-y _citation.pdbx_database_id_PubMed 34789875 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yang, F.' 1 ? primary 'Guo, L.' 2 ? primary 'Li, Y.' 3 ? primary 'Wang, G.' 4 ? primary 'Wang, J.' 5 ? primary 'Zhang, C.' 6 ? primary 'Fang, G.X.' 7 ? primary 'Chen, X.' 8 ? primary 'Liu, L.' 9 ? primary 'Yan, X.' 10 ? primary 'Liu, Q.' 11 ? primary 'Qu, C.' 12 ? primary 'Xu, Y.' 13 0000-0002-0580-7116 primary 'Xiao, P.' 14 ? primary 'Zhu, Z.' 15 ? primary 'Li, Z.' 16 ? primary 'Zhou, J.' 17 ? primary 'Yu, X.' 18 ? primary 'Gao, N.' 19 0000-0003-3067-9993 primary 'Sun, J.P.' 20 0000-0003-3572-1580 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 7VV0 _cell.details ? _cell.formula_units_Z ? _cell.length_a 1.00 _cell.length_a_esd ? _cell.length_b 1.00 _cell.length_b_esd ? _cell.length_c 1.00 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB ? _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7VV0 _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn 'peptide from Pro-adrenomedullin' 1624.952 1 ? ? ? ? 2 polymer man 'Mas-related G-protein coupled receptor member X2' 37123.984 1 ? ? ? ? 3 non-polymer syn CHOLESTEROL 386.654 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name PAMP12 # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no FRKKWNKWALSR FRKKWNKWALSR L ? 2 'polypeptide(L)' no no ;MDPTTPAWGTESTTVNGNDQALLLLCGKETLIPVFLILFIALVGLVGNGFVLWLLGFRMRRNAFSVYVLSLAGADFLFLC FQIINCLVYLSNFFCSISINFPSFFTTVMTCAYLAGLSMLSTVSTERCLSVLWPIWYRCRRPRHLSAVVCVLLWALSLLL SILEGKFCGFLFSDGDSGWCQTFDFITAAWLIFLFMVLCGSSLALLVRILCGSRGLPLTRLYLTILLTVLVFLLCGLPFG IQWFLILWIWKDSDVLFCHIHPVSVVLSSLNSSANPIIYFFVGSFRKQWRLQQPILKLALQRALQDIAEVDHSEGCFRQG TPEMSRSSLV ; ;MDPTTPAWGTESTTVNGNDQALLLLCGKETLIPVFLILFIALVGLVGNGFVLWLLGFRMRRNAFSVYVLSLAGADFLFLC FQIINCLVYLSNFFCSISINFPSFFTTVMTCAYLAGLSMLSTVSTERCLSVLWPIWYRCRRPRHLSAVVCVLLWALSLLL SILEGKFCGFLFSDGDSGWCQTFDFITAAWLIFLFMVLCGSSLALLVRILCGSRGLPLTRLYLTILLTVLVFLLCGLPFG IQWFLILWIWKDSDVLFCHIHPVSVVLSSLNSSANPIIYFFVGSFRKQWRLQQPILKLALQRALQDIAEVDHSEGCFRQG TPEMSRSSLV ; R ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PHE n 1 2 ARG n 1 3 LYS n 1 4 LYS n 1 5 TRP n 1 6 ASN n 1 7 LYS n 1 8 TRP n 1 9 ALA n 1 10 LEU n 1 11 SER n 1 12 ARG n 2 1 MET n 2 2 ASP n 2 3 PRO n 2 4 THR n 2 5 THR n 2 6 PRO n 2 7 ALA n 2 8 TRP n 2 9 GLY n 2 10 THR n 2 11 GLU n 2 12 SER n 2 13 THR n 2 14 THR n 2 15 VAL n 2 16 ASN n 2 17 GLY n 2 18 ASN n 2 19 ASP n 2 20 GLN n 2 21 ALA n 2 22 LEU n 2 23 LEU n 2 24 LEU n 2 25 LEU n 2 26 CYS n 2 27 GLY n 2 28 LYS n 2 29 GLU n 2 30 THR n 2 31 LEU n 2 32 ILE n 2 33 PRO n 2 34 VAL n 2 35 PHE n 2 36 LEU n 2 37 ILE n 2 38 LEU n 2 39 PHE n 2 40 ILE n 2 41 ALA n 2 42 LEU n 2 43 VAL n 2 44 GLY n 2 45 LEU n 2 46 VAL n 2 47 GLY n 2 48 ASN n 2 49 GLY n 2 50 PHE n 2 51 VAL n 2 52 LEU n 2 53 TRP n 2 54 LEU n 2 55 LEU n 2 56 GLY n 2 57 PHE n 2 58 ARG n 2 59 MET n 2 60 ARG n 2 61 ARG n 2 62 ASN n 2 63 ALA n 2 64 PHE n 2 65 SER n 2 66 VAL n 2 67 TYR n 2 68 VAL n 2 69 LEU n 2 70 SER n 2 71 LEU n 2 72 ALA n 2 73 GLY n 2 74 ALA n 2 75 ASP n 2 76 PHE n 2 77 LEU n 2 78 PHE n 2 79 LEU n 2 80 CYS n 2 81 PHE n 2 82 GLN n 2 83 ILE n 2 84 ILE n 2 85 ASN n 2 86 CYS n 2 87 LEU n 2 88 VAL n 2 89 TYR n 2 90 LEU n 2 91 SER n 2 92 ASN n 2 93 PHE n 2 94 PHE n 2 95 CYS n 2 96 SER n 2 97 ILE n 2 98 SER n 2 99 ILE n 2 100 ASN n 2 101 PHE n 2 102 PRO n 2 103 SER n 2 104 PHE n 2 105 PHE n 2 106 THR n 2 107 THR n 2 108 VAL n 2 109 MET n 2 110 THR n 2 111 CYS n 2 112 ALA n 2 113 TYR n 2 114 LEU n 2 115 ALA n 2 116 GLY n 2 117 LEU n 2 118 SER n 2 119 MET n 2 120 LEU n 2 121 SER n 2 122 THR n 2 123 VAL n 2 124 SER n 2 125 THR n 2 126 GLU n 2 127 ARG n 2 128 CYS n 2 129 LEU n 2 130 SER n 2 131 VAL n 2 132 LEU n 2 133 TRP n 2 134 PRO n 2 135 ILE n 2 136 TRP n 2 137 TYR n 2 138 ARG n 2 139 CYS n 2 140 ARG n 2 141 ARG n 2 142 PRO n 2 143 ARG n 2 144 HIS n 2 145 LEU n 2 146 SER n 2 147 ALA n 2 148 VAL n 2 149 VAL n 2 150 CYS n 2 151 VAL n 2 152 LEU n 2 153 LEU n 2 154 TRP n 2 155 ALA n 2 156 LEU n 2 157 SER n 2 158 LEU n 2 159 LEU n 2 160 LEU n 2 161 SER n 2 162 ILE n 2 163 LEU n 2 164 GLU n 2 165 GLY n 2 166 LYS n 2 167 PHE n 2 168 CYS n 2 169 GLY n 2 170 PHE n 2 171 LEU n 2 172 PHE n 2 173 SER n 2 174 ASP n 2 175 GLY n 2 176 ASP n 2 177 SER n 2 178 GLY n 2 179 TRP n 2 180 CYS n 2 181 GLN n 2 182 THR n 2 183 PHE n 2 184 ASP n 2 185 PHE n 2 186 ILE n 2 187 THR n 2 188 ALA n 2 189 ALA n 2 190 TRP n 2 191 LEU n 2 192 ILE n 2 193 PHE n 2 194 LEU n 2 195 PHE n 2 196 MET n 2 197 VAL n 2 198 LEU n 2 199 CYS n 2 200 GLY n 2 201 SER n 2 202 SER n 2 203 LEU n 2 204 ALA n 2 205 LEU n 2 206 LEU n 2 207 VAL n 2 208 ARG n 2 209 ILE n 2 210 LEU n 2 211 CYS n 2 212 GLY n 2 213 SER n 2 214 ARG n 2 215 GLY n 2 216 LEU n 2 217 PRO n 2 218 LEU n 2 219 THR n 2 220 ARG n 2 221 LEU n 2 222 TYR n 2 223 LEU n 2 224 THR n 2 225 ILE n 2 226 LEU n 2 227 LEU n 2 228 THR n 2 229 VAL n 2 230 LEU n 2 231 VAL n 2 232 PHE n 2 233 LEU n 2 234 LEU n 2 235 CYS n 2 236 GLY n 2 237 LEU n 2 238 PRO n 2 239 PHE n 2 240 GLY n 2 241 ILE n 2 242 GLN n 2 243 TRP n 2 244 PHE n 2 245 LEU n 2 246 ILE n 2 247 LEU n 2 248 TRP n 2 249 ILE n 2 250 TRP n 2 251 LYS n 2 252 ASP n 2 253 SER n 2 254 ASP n 2 255 VAL n 2 256 LEU n 2 257 PHE n 2 258 CYS n 2 259 HIS n 2 260 ILE n 2 261 HIS n 2 262 PRO n 2 263 VAL n 2 264 SER n 2 265 VAL n 2 266 VAL n 2 267 LEU n 2 268 SER n 2 269 SER n 2 270 LEU n 2 271 ASN n 2 272 SER n 2 273 SER n 2 274 ALA n 2 275 ASN n 2 276 PRO n 2 277 ILE n 2 278 ILE n 2 279 TYR n 2 280 PHE n 2 281 PHE n 2 282 VAL n 2 283 GLY n 2 284 SER n 2 285 PHE n 2 286 ARG n 2 287 LYS n 2 288 GLN n 2 289 TRP n 2 290 ARG n 2 291 LEU n 2 292 GLN n 2 293 GLN n 2 294 PRO n 2 295 ILE n 2 296 LEU n 2 297 LYS n 2 298 LEU n 2 299 ALA n 2 300 LEU n 2 301 GLN n 2 302 ARG n 2 303 ALA n 2 304 LEU n 2 305 GLN n 2 306 ASP n 2 307 ILE n 2 308 ALA n 2 309 GLU n 2 310 VAL n 2 311 ASP n 2 312 HIS n 2 313 SER n 2 314 GLU n 2 315 GLY n 2 316 CYS n 2 317 PHE n 2 318 ARG n 2 319 GLN n 2 320 GLY n 2 321 THR n 2 322 PRO n 2 323 GLU n 2 324 MET n 2 325 SER n 2 326 ARG n 2 327 SER n 2 328 SER n 2 329 LEU n 2 330 VAL n # _entity_src_gen.entity_id 2 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 330 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MRGPRX2, MRGX2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 12 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP ADML_HUMAN P35318 ? 1 FRKKWNKWALSR 30 2 UNP MRGX2_HUMAN Q96LB1 ? 2 ;MDPTTPAWGTESTTVNGNDQALLLLCGKETLIPVFLILFIALVGLVGNGFVLWLLGFRMRRNAFSVYVLSLAGADFLFLC FQIINCLVYLSNFFCSISINFPSFFTTVMTCAYLAGLSMLSTVSTERCLSVLWPIWYRCRRPRHLSAVVCVLLWALSLLL SILEGKFCGFLFSDGDSGWCQTFDFITAAWLIFLFMVLCGSSLALLVRILCGSRGLPLTRLYLTILLTVLVFLLCGLPFG IQWFLILWIWKDSDVLFCHIHPVSVVLSSLNSSANPIIYFFVGSFRKQWRLQQPILKLALQRALQDIAEVDHSEGCFRQG TPEMSRSSLV ; 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7VV0 L 1 ? 12 ? P35318 30 ? 41 ? 9 20 2 2 7VV0 R 1 ? 330 ? Q96LB1 1 ? 330 ? 1 330 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CLR non-polymer . CHOLESTEROL ? 'C27 H46 O' 386.654 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7VV0 _exptl.crystals_number ? _exptl.details ? _exptl.method 'ELECTRON MICROSCOPY' _exptl.method_details ? # _struct.entry_id 7VV0 _struct.title 'Cryo-EM structure of pseudoallergen receptor MRGPRX2 complex with PAMP-12, local' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7VV0 _struct_keywords.text 'G Protein-Coupled Receptor, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR B 30 ? ARG B 58 ? THR R 30 ARG R 58 1 ? 29 HELX_P HELX_P2 AA2 ASN B 62 ? PHE B 94 ? ASN R 62 PHE R 94 1 ? 33 HELX_P HELX_P3 AA3 SER B 103 ? TRP B 133 ? SER R 103 TRP R 133 1 ? 31 HELX_P HELX_P4 AA4 TRP B 133 ? ARG B 140 ? TRP R 133 ARG R 140 1 ? 8 HELX_P HELX_P5 AA5 LEU B 145 ? LYS B 166 ? LEU R 145 LYS R 166 1 ? 22 HELX_P HELX_P6 AA6 ASP B 176 ? SER B 213 ? ASP R 176 SER R 213 1 ? 38 HELX_P HELX_P7 AA7 PRO B 217 ? CYS B 235 ? PRO R 217 CYS R 235 1 ? 19 HELX_P HELX_P8 AA8 GLY B 236 ? LEU B 245 ? GLY R 236 LEU R 245 1 ? 10 HELX_P HELX_P9 AA9 LEU B 245 ? TRP B 250 ? LEU R 245 TRP R 250 1 ? 6 HELX_P HELX_P10 AB1 LEU B 256 ? ALA B 274 ? LEU R 256 ALA R 274 1 ? 19 HELX_P HELX_P11 AB2 ALA B 274 ? PHE B 280 ? ALA R 274 PHE R 280 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? B CYS 26 SG ? ? ? 1_555 B CYS 258 SG ? ? R CYS 26 R CYS 258 1_555 ? ? ? ? ? ? ? 2.034 ? ? disulf2 disulf ? ? B CYS 168 SG ? ? ? 1_555 B CYS 180 SG ? ? R CYS 168 R CYS 180 1_555 ? ? ? ? ? ? ? 2.029 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 7VV0 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PHE 1 9 9 PHE PHE L . n A 1 2 ARG 2 10 10 ARG ARG L . n A 1 3 LYS 3 11 11 LYS LYS L . n A 1 4 LYS 4 12 12 LYS LYS L . n A 1 5 TRP 5 13 13 TRP TRP L . n A 1 6 ASN 6 14 ? ? ? L . n A 1 7 LYS 7 15 ? ? ? L . n A 1 8 TRP 8 16 ? ? ? L . n A 1 9 ALA 9 17 ? ? ? L . n A 1 10 LEU 10 18 ? ? ? L . n A 1 11 SER 11 19 ? ? ? L . n A 1 12 ARG 12 20 ? ? ? L . n B 2 1 MET 1 1 ? ? ? R . n B 2 2 ASP 2 2 ? ? ? R . n B 2 3 PRO 3 3 ? ? ? R . n B 2 4 THR 4 4 ? ? ? R . n B 2 5 THR 5 5 ? ? ? R . n B 2 6 PRO 6 6 ? ? ? R . n B 2 7 ALA 7 7 ? ? ? R . n B 2 8 TRP 8 8 ? ? ? R . n B 2 9 GLY 9 9 ? ? ? R . n B 2 10 THR 10 10 ? ? ? R . n B 2 11 GLU 11 11 ? ? ? R . n B 2 12 SER 12 12 ? ? ? R . n B 2 13 THR 13 13 ? ? ? R . n B 2 14 THR 14 14 ? ? ? R . n B 2 15 VAL 15 15 ? ? ? R . n B 2 16 ASN 16 16 ? ? ? R . n B 2 17 GLY 17 17 ? ? ? R . n B 2 18 ASN 18 18 ? ? ? R . n B 2 19 ASP 19 19 ? ? ? R . n B 2 20 GLN 20 20 ? ? ? R . n B 2 21 ALA 21 21 ? ? ? R . n B 2 22 LEU 22 22 ? ? ? R . n B 2 23 LEU 23 23 ? ? ? R . n B 2 24 LEU 24 24 ? ? ? R . n B 2 25 LEU 25 25 ? ? ? R . n B 2 26 CYS 26 26 26 CYS CYS R . n B 2 27 GLY 27 27 27 GLY GLY R . n B 2 28 LYS 28 28 28 LYS LYS R . n B 2 29 GLU 29 29 29 GLU GLU R . n B 2 30 THR 30 30 30 THR THR R . n B 2 31 LEU 31 31 31 LEU LEU R . n B 2 32 ILE 32 32 32 ILE ILE R . n B 2 33 PRO 33 33 33 PRO PRO R . n B 2 34 VAL 34 34 34 VAL VAL R . n B 2 35 PHE 35 35 35 PHE PHE R . n B 2 36 LEU 36 36 36 LEU LEU R . n B 2 37 ILE 37 37 37 ILE ILE R . n B 2 38 LEU 38 38 38 LEU LEU R . n B 2 39 PHE 39 39 39 PHE PHE R . n B 2 40 ILE 40 40 40 ILE ILE R . n B 2 41 ALA 41 41 41 ALA ALA R . n B 2 42 LEU 42 42 42 LEU LEU R . n B 2 43 VAL 43 43 43 VAL VAL R . n B 2 44 GLY 44 44 44 GLY GLY R . n B 2 45 LEU 45 45 45 LEU LEU R . n B 2 46 VAL 46 46 46 VAL VAL R . n B 2 47 GLY 47 47 47 GLY GLY R . n B 2 48 ASN 48 48 48 ASN ASN R . n B 2 49 GLY 49 49 49 GLY GLY R . n B 2 50 PHE 50 50 50 PHE PHE R . n B 2 51 VAL 51 51 51 VAL VAL R . n B 2 52 LEU 52 52 52 LEU LEU R . n B 2 53 TRP 53 53 53 TRP TRP R . n B 2 54 LEU 54 54 54 LEU LEU R . n B 2 55 LEU 55 55 55 LEU LEU R . n B 2 56 GLY 56 56 56 GLY GLY R . n B 2 57 PHE 57 57 57 PHE PHE R . n B 2 58 ARG 58 58 58 ARG ARG R . n B 2 59 MET 59 59 59 MET MET R . n B 2 60 ARG 60 60 60 ARG ARG R . n B 2 61 ARG 61 61 61 ARG ARG R . n B 2 62 ASN 62 62 62 ASN ASN R . n B 2 63 ALA 63 63 63 ALA ALA R . n B 2 64 PHE 64 64 64 PHE PHE R . n B 2 65 SER 65 65 65 SER SER R . n B 2 66 VAL 66 66 66 VAL VAL R . n B 2 67 TYR 67 67 67 TYR TYR R . n B 2 68 VAL 68 68 68 VAL VAL R . n B 2 69 LEU 69 69 69 LEU LEU R . n B 2 70 SER 70 70 70 SER SER R . n B 2 71 LEU 71 71 71 LEU LEU R . n B 2 72 ALA 72 72 72 ALA ALA R . n B 2 73 GLY 73 73 73 GLY GLY R . n B 2 74 ALA 74 74 74 ALA ALA R . n B 2 75 ASP 75 75 75 ASP ASP R . n B 2 76 PHE 76 76 76 PHE PHE R . n B 2 77 LEU 77 77 77 LEU LEU R . n B 2 78 PHE 78 78 78 PHE PHE R . n B 2 79 LEU 79 79 79 LEU LEU R . n B 2 80 CYS 80 80 80 CYS CYS R . n B 2 81 PHE 81 81 81 PHE PHE R . n B 2 82 GLN 82 82 82 GLN GLN R . n B 2 83 ILE 83 83 83 ILE ILE R . n B 2 84 ILE 84 84 84 ILE ILE R . n B 2 85 ASN 85 85 85 ASN ASN R . n B 2 86 CYS 86 86 86 CYS CYS R . n B 2 87 LEU 87 87 87 LEU LEU R . n B 2 88 VAL 88 88 88 VAL VAL R . n B 2 89 TYR 89 89 89 TYR TYR R . n B 2 90 LEU 90 90 90 LEU LEU R . n B 2 91 SER 91 91 91 SER SER R . n B 2 92 ASN 92 92 92 ASN ASN R . n B 2 93 PHE 93 93 93 PHE PHE R . n B 2 94 PHE 94 94 94 PHE PHE R . n B 2 95 CYS 95 95 95 CYS CYS R . n B 2 96 SER 96 96 96 SER SER R . n B 2 97 ILE 97 97 97 ILE ILE R . n B 2 98 SER 98 98 98 SER SER R . n B 2 99 ILE 99 99 99 ILE ILE R . n B 2 100 ASN 100 100 100 ASN ASN R . n B 2 101 PHE 101 101 101 PHE PHE R . n B 2 102 PRO 102 102 102 PRO PRO R . n B 2 103 SER 103 103 103 SER SER R . n B 2 104 PHE 104 104 104 PHE PHE R . n B 2 105 PHE 105 105 105 PHE PHE R . n B 2 106 THR 106 106 106 THR THR R . n B 2 107 THR 107 107 107 THR THR R . n B 2 108 VAL 108 108 108 VAL VAL R . n B 2 109 MET 109 109 109 MET MET R . n B 2 110 THR 110 110 110 THR THR R . n B 2 111 CYS 111 111 111 CYS CYS R . n B 2 112 ALA 112 112 112 ALA ALA R . n B 2 113 TYR 113 113 113 TYR TYR R . n B 2 114 LEU 114 114 114 LEU LEU R . n B 2 115 ALA 115 115 115 ALA ALA R . n B 2 116 GLY 116 116 116 GLY GLY R . n B 2 117 LEU 117 117 117 LEU LEU R . n B 2 118 SER 118 118 118 SER SER R . n B 2 119 MET 119 119 119 MET MET R . n B 2 120 LEU 120 120 120 LEU LEU R . n B 2 121 SER 121 121 121 SER SER R . n B 2 122 THR 122 122 122 THR THR R . n B 2 123 VAL 123 123 123 VAL VAL R . n B 2 124 SER 124 124 124 SER SER R . n B 2 125 THR 125 125 125 THR THR R . n B 2 126 GLU 126 126 126 GLU GLU R . n B 2 127 ARG 127 127 127 ARG ARG R . n B 2 128 CYS 128 128 128 CYS CYS R . n B 2 129 LEU 129 129 129 LEU LEU R . n B 2 130 SER 130 130 130 SER SER R . n B 2 131 VAL 131 131 131 VAL VAL R . n B 2 132 LEU 132 132 132 LEU LEU R . n B 2 133 TRP 133 133 133 TRP TRP R . n B 2 134 PRO 134 134 134 PRO PRO R . n B 2 135 ILE 135 135 135 ILE ILE R . n B 2 136 TRP 136 136 136 TRP TRP R . n B 2 137 TYR 137 137 137 TYR TYR R . n B 2 138 ARG 138 138 138 ARG ARG R . n B 2 139 CYS 139 139 139 CYS CYS R . n B 2 140 ARG 140 140 140 ARG ARG R . n B 2 141 ARG 141 141 141 ARG ARG R . n B 2 142 PRO 142 142 142 PRO PRO R . n B 2 143 ARG 143 143 143 ARG ARG R . n B 2 144 HIS 144 144 144 HIS HIS R . n B 2 145 LEU 145 145 145 LEU LEU R . n B 2 146 SER 146 146 146 SER SER R . n B 2 147 ALA 147 147 147 ALA ALA R . n B 2 148 VAL 148 148 148 VAL VAL R . n B 2 149 VAL 149 149 149 VAL VAL R . n B 2 150 CYS 150 150 150 CYS CYS R . n B 2 151 VAL 151 151 151 VAL VAL R . n B 2 152 LEU 152 152 152 LEU LEU R . n B 2 153 LEU 153 153 153 LEU LEU R . n B 2 154 TRP 154 154 154 TRP TRP R . n B 2 155 ALA 155 155 155 ALA ALA R . n B 2 156 LEU 156 156 156 LEU LEU R . n B 2 157 SER 157 157 157 SER SER R . n B 2 158 LEU 158 158 158 LEU LEU R . n B 2 159 LEU 159 159 159 LEU LEU R . n B 2 160 LEU 160 160 160 LEU LEU R . n B 2 161 SER 161 161 161 SER SER R . n B 2 162 ILE 162 162 162 ILE ILE R . n B 2 163 LEU 163 163 163 LEU LEU R . n B 2 164 GLU 164 164 164 GLU GLU R . n B 2 165 GLY 165 165 165 GLY GLY R . n B 2 166 LYS 166 166 166 LYS LYS R . n B 2 167 PHE 167 167 167 PHE PHE R . n B 2 168 CYS 168 168 168 CYS CYS R . n B 2 169 GLY 169 169 169 GLY GLY R . n B 2 170 PHE 170 170 170 PHE PHE R . n B 2 171 LEU 171 171 171 LEU LEU R . n B 2 172 PHE 172 172 172 PHE PHE R . n B 2 173 SER 173 173 173 SER SER R . n B 2 174 ASP 174 174 174 ASP ASP R . n B 2 175 GLY 175 175 175 GLY GLY R . n B 2 176 ASP 176 176 176 ASP ASP R . n B 2 177 SER 177 177 177 SER SER R . n B 2 178 GLY 178 178 178 GLY GLY R . n B 2 179 TRP 179 179 179 TRP TRP R . n B 2 180 CYS 180 180 180 CYS CYS R . n B 2 181 GLN 181 181 181 GLN GLN R . n B 2 182 THR 182 182 182 THR THR R . n B 2 183 PHE 183 183 183 PHE PHE R . n B 2 184 ASP 184 184 184 ASP ASP R . n B 2 185 PHE 185 185 185 PHE PHE R . n B 2 186 ILE 186 186 186 ILE ILE R . n B 2 187 THR 187 187 187 THR THR R . n B 2 188 ALA 188 188 188 ALA ALA R . n B 2 189 ALA 189 189 189 ALA ALA R . n B 2 190 TRP 190 190 190 TRP TRP R . n B 2 191 LEU 191 191 191 LEU LEU R . n B 2 192 ILE 192 192 192 ILE ILE R . n B 2 193 PHE 193 193 193 PHE PHE R . n B 2 194 LEU 194 194 194 LEU LEU R . n B 2 195 PHE 195 195 195 PHE PHE R . n B 2 196 MET 196 196 196 MET MET R . n B 2 197 VAL 197 197 197 VAL VAL R . n B 2 198 LEU 198 198 198 LEU LEU R . n B 2 199 CYS 199 199 199 CYS CYS R . n B 2 200 GLY 200 200 200 GLY GLY R . n B 2 201 SER 201 201 201 SER SER R . n B 2 202 SER 202 202 202 SER SER R . n B 2 203 LEU 203 203 203 LEU LEU R . n B 2 204 ALA 204 204 204 ALA ALA R . n B 2 205 LEU 205 205 205 LEU LEU R . n B 2 206 LEU 206 206 206 LEU LEU R . n B 2 207 VAL 207 207 207 VAL VAL R . n B 2 208 ARG 208 208 208 ARG ARG R . n B 2 209 ILE 209 209 209 ILE ILE R . n B 2 210 LEU 210 210 210 LEU LEU R . n B 2 211 CYS 211 211 211 CYS CYS R . n B 2 212 GLY 212 212 212 GLY GLY R . n B 2 213 SER 213 213 213 SER SER R . n B 2 214 ARG 214 214 214 ARG ARG R . n B 2 215 GLY 215 215 215 GLY GLY R . n B 2 216 LEU 216 216 216 LEU LEU R . n B 2 217 PRO 217 217 217 PRO PRO R . n B 2 218 LEU 218 218 218 LEU LEU R . n B 2 219 THR 219 219 219 THR THR R . n B 2 220 ARG 220 220 220 ARG ARG R . n B 2 221 LEU 221 221 221 LEU LEU R . n B 2 222 TYR 222 222 222 TYR TYR R . n B 2 223 LEU 223 223 223 LEU LEU R . n B 2 224 THR 224 224 224 THR THR R . n B 2 225 ILE 225 225 225 ILE ILE R . n B 2 226 LEU 226 226 226 LEU LEU R . n B 2 227 LEU 227 227 227 LEU LEU R . n B 2 228 THR 228 228 228 THR THR R . n B 2 229 VAL 229 229 229 VAL VAL R . n B 2 230 LEU 230 230 230 LEU LEU R . n B 2 231 VAL 231 231 231 VAL VAL R . n B 2 232 PHE 232 232 232 PHE PHE R . n B 2 233 LEU 233 233 233 LEU LEU R . n B 2 234 LEU 234 234 234 LEU LEU R . n B 2 235 CYS 235 235 235 CYS CYS R . n B 2 236 GLY 236 236 236 GLY GLY R . n B 2 237 LEU 237 237 237 LEU LEU R . n B 2 238 PRO 238 238 238 PRO PRO R . n B 2 239 PHE 239 239 239 PHE PHE R . n B 2 240 GLY 240 240 240 GLY GLY R . n B 2 241 ILE 241 241 241 ILE ILE R . n B 2 242 GLN 242 242 242 GLN GLN R . n B 2 243 TRP 243 243 243 TRP TRP R . n B 2 244 PHE 244 244 244 PHE PHE R . n B 2 245 LEU 245 245 245 LEU LEU R . n B 2 246 ILE 246 246 246 ILE ILE R . n B 2 247 LEU 247 247 247 LEU LEU R . n B 2 248 TRP 248 248 248 TRP TRP R . n B 2 249 ILE 249 249 249 ILE ILE R . n B 2 250 TRP 250 250 250 TRP TRP R . n B 2 251 LYS 251 251 251 LYS LYS R . n B 2 252 ASP 252 252 252 ASP ASP R . n B 2 253 SER 253 253 253 SER SER R . n B 2 254 ASP 254 254 254 ASP ASP R . n B 2 255 VAL 255 255 255 VAL VAL R . n B 2 256 LEU 256 256 256 LEU LEU R . n B 2 257 PHE 257 257 257 PHE PHE R . n B 2 258 CYS 258 258 258 CYS CYS R . n B 2 259 HIS 259 259 259 HIS HIS R . n B 2 260 ILE 260 260 260 ILE ILE R . n B 2 261 HIS 261 261 261 HIS HIS R . n B 2 262 PRO 262 262 262 PRO PRO R . n B 2 263 VAL 263 263 263 VAL VAL R . n B 2 264 SER 264 264 264 SER SER R . n B 2 265 VAL 265 265 265 VAL VAL R . n B 2 266 VAL 266 266 266 VAL VAL R . n B 2 267 LEU 267 267 267 LEU LEU R . n B 2 268 SER 268 268 268 SER SER R . n B 2 269 SER 269 269 269 SER SER R . n B 2 270 LEU 270 270 270 LEU LEU R . n B 2 271 ASN 271 271 271 ASN ASN R . n B 2 272 SER 272 272 272 SER SER R . n B 2 273 SER 273 273 273 SER SER R . n B 2 274 ALA 274 274 274 ALA ALA R . n B 2 275 ASN 275 275 275 ASN ASN R . n B 2 276 PRO 276 276 276 PRO PRO R . n B 2 277 ILE 277 277 277 ILE ILE R . n B 2 278 ILE 278 278 278 ILE ILE R . n B 2 279 TYR 279 279 279 TYR TYR R . n B 2 280 PHE 280 280 280 PHE PHE R . n B 2 281 PHE 281 281 281 PHE PHE R . n B 2 282 VAL 282 282 282 VAL VAL R . n B 2 283 GLY 283 283 283 GLY GLY R . n B 2 284 SER 284 284 284 SER SER R . n B 2 285 PHE 285 285 285 PHE PHE R . n B 2 286 ARG 286 286 286 ARG ARG R . n B 2 287 LYS 287 287 287 LYS LYS R . n B 2 288 GLN 288 288 288 GLN GLN R . n B 2 289 TRP 289 289 ? ? ? R . n B 2 290 ARG 290 290 ? ? ? R . n B 2 291 LEU 291 291 ? ? ? R . n B 2 292 GLN 292 292 ? ? ? R . n B 2 293 GLN 293 293 ? ? ? R . n B 2 294 PRO 294 294 ? ? ? R . n B 2 295 ILE 295 295 ? ? ? R . n B 2 296 LEU 296 296 ? ? ? R . n B 2 297 LYS 297 297 ? ? ? R . n B 2 298 LEU 298 298 ? ? ? R . n B 2 299 ALA 299 299 ? ? ? R . n B 2 300 LEU 300 300 ? ? ? R . n B 2 301 GLN 301 301 ? ? ? R . n B 2 302 ARG 302 302 ? ? ? R . n B 2 303 ALA 303 303 ? ? ? R . n B 2 304 LEU 304 304 ? ? ? R . n B 2 305 GLN 305 305 ? ? ? R . n B 2 306 ASP 306 306 ? ? ? R . n B 2 307 ILE 307 307 ? ? ? R . n B 2 308 ALA 308 308 ? ? ? R . n B 2 309 GLU 309 309 ? ? ? R . n B 2 310 VAL 310 310 ? ? ? R . n B 2 311 ASP 311 311 ? ? ? R . n B 2 312 HIS 312 312 ? ? ? R . n B 2 313 SER 313 313 ? ? ? R . n B 2 314 GLU 314 314 ? ? ? R . n B 2 315 GLY 315 315 ? ? ? R . n B 2 316 CYS 316 316 ? ? ? R . n B 2 317 PHE 317 317 ? ? ? R . n B 2 318 ARG 318 318 ? ? ? R . n B 2 319 GLN 319 319 ? ? ? R . n B 2 320 GLY 320 320 ? ? ? R . n B 2 321 THR 321 321 ? ? ? R . n B 2 322 PRO 322 322 ? ? ? R . n B 2 323 GLU 323 323 ? ? ? R . n B 2 324 MET 324 324 ? ? ? R . n B 2 325 SER 325 325 ? ? ? R . n B 2 326 ARG 326 326 ? ? ? R . n B 2 327 SER 327 327 ? ? ? R . n B 2 328 SER 328 328 ? ? ? R . n B 2 329 LEU 329 329 ? ? ? R . n B 2 330 VAL 330 330 ? ? ? R . n # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 3 sunjinpeng@sdu.edu.cn Jinpeng Sun ? 'principal investigator/group leader' 0000-0003-3572-1580 4 gaon@pku.edu.cn Ning Gao ? 'principal investigator/group leader' 0000-0003-3067-9993 # _pdbx_nonpoly_scheme.asym_id C _pdbx_nonpoly_scheme.entity_id 3 _pdbx_nonpoly_scheme.mon_id CLR _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 401 _pdbx_nonpoly_scheme.auth_seq_num 301 _pdbx_nonpoly_scheme.pdb_mon_id CLR _pdbx_nonpoly_scheme.auth_mon_id CLR _pdbx_nonpoly_scheme.pdb_strand_id R _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2021-12-01 2 'Structure model' 1 1 2022-07-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' audit_author 2 2 'Structure model' citation 3 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_audit_author.name' 2 2 'Structure model' '_citation.country' 3 2 'Structure model' '_citation.journal_abbrev' 4 2 'Structure model' '_citation.journal_id_ASTM' 5 2 'Structure model' '_citation.journal_id_CSD' 6 2 'Structure model' '_citation.journal_id_ISSN' 7 2 'Structure model' '_citation.journal_volume' 8 2 'Structure model' '_citation.page_first' 9 2 'Structure model' '_citation.page_last' 10 2 'Structure model' '_citation.pdbx_database_id_DOI' 11 2 'Structure model' '_citation.pdbx_database_id_PubMed' 12 2 'Structure model' '_citation.title' 13 2 'Structure model' '_citation.year' # _pdbx_entry_details.entry_id 7VV0 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N # _em_3d_fitting.entry_id 7VV0 _em_3d_fitting.id 1 _em_3d_fitting.details ? _em_3d_fitting.overall_b_value ? _em_3d_fitting.ref_protocol ? _em_3d_fitting.ref_space ? _em_3d_fitting.target_criteria ? _em_3d_fitting.method ? # _em_3d_reconstruction.entry_id 7VV0 _em_3d_reconstruction.id 1 _em_3d_reconstruction.algorithm ? _em_3d_reconstruction.details ? _em_3d_reconstruction.refinement_type ? _em_3d_reconstruction.image_processing_id 1 _em_3d_reconstruction.num_class_averages ? _em_3d_reconstruction.num_particles 978001 _em_3d_reconstruction.resolution 3.5 _em_3d_reconstruction.resolution_method 'FSC 0.143 CUT-OFF' _em_3d_reconstruction.symmetry_type POINT _em_3d_reconstruction.method ? _em_3d_reconstruction.nominal_pixel_size ? _em_3d_reconstruction.actual_pixel_size ? _em_3d_reconstruction.magnification_calibration ? # _em_buffer.id 1 _em_buffer.details ? _em_buffer.pH 7.5 _em_buffer.specimen_id 1 _em_buffer.name ? # _em_entity_assembly.id 1 _em_entity_assembly.parent_id 0 _em_entity_assembly.details ? _em_entity_assembly.name 'Cryo-EM structure of pseudoallergen receptor MRGPRX2 complex with PAMP-12, local' _em_entity_assembly.source 'MULTIPLE SOURCES' _em_entity_assembly.type COMPLEX _em_entity_assembly.entity_id_list '1, 2' _em_entity_assembly.synonym ? _em_entity_assembly.oligomeric_details ? # _em_imaging.id 1 _em_imaging.entry_id 7VV0 _em_imaging.accelerating_voltage 300 _em_imaging.alignment_procedure ? _em_imaging.c2_aperture_diameter ? _em_imaging.calibrated_defocus_max ? _em_imaging.calibrated_defocus_min ? _em_imaging.calibrated_magnification ? _em_imaging.cryogen ? _em_imaging.details ? _em_imaging.electron_source 'FIELD EMISSION GUN' _em_imaging.illumination_mode 'SPOT SCAN' _em_imaging.microscope_model 'FEI TITAN KRIOS' _em_imaging.mode 'BRIGHT FIELD' _em_imaging.nominal_cs ? _em_imaging.nominal_defocus_max ? _em_imaging.nominal_defocus_min ? _em_imaging.nominal_magnification ? _em_imaging.recording_temperature_maximum ? _em_imaging.recording_temperature_minimum ? _em_imaging.residual_tilt ? _em_imaging.specimen_holder_model ? _em_imaging.specimen_id 1 _em_imaging.citation_id ? _em_imaging.date ? _em_imaging.temperature ? _em_imaging.tilt_angle_min ? _em_imaging.tilt_angle_max ? _em_imaging.astigmatism ? _em_imaging.detector_distance ? _em_imaging.electron_beam_tilt_params ? _em_imaging.specimen_holder_type ? # _em_vitrification.id 1 _em_vitrification.specimen_id 1 _em_vitrification.chamber_temperature ? _em_vitrification.cryogen_name ETHANE _em_vitrification.details ? _em_vitrification.humidity ? _em_vitrification.instrument ? _em_vitrification.entry_id 7VV0 _em_vitrification.citation_id ? _em_vitrification.method ? _em_vitrification.temp ? _em_vitrification.time_resolved_state ? # _em_experiment.entry_id 7VV0 _em_experiment.id 1 _em_experiment.aggregation_state PARTICLE _em_experiment.reconstruction_method 'SINGLE PARTICLE' _em_experiment.entity_assembly_id 1 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 CD1 _pdbx_validate_close_contact.auth_asym_id_1 R _pdbx_validate_close_contact.auth_comp_id_1 LEU _pdbx_validate_close_contact.auth_seq_id_1 38 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 CD1 _pdbx_validate_close_contact.auth_asym_id_2 R _pdbx_validate_close_contact.auth_comp_id_2 ILE _pdbx_validate_close_contact.auth_seq_id_2 83 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.01 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA R LEU 45 ? ? CB R LEU 45 ? ? CG R LEU 45 ? ? 131.44 115.30 16.14 2.30 N 2 1 CB R LEU 45 ? ? CG R LEU 45 ? ? CD2 R LEU 45 ? ? 121.91 111.00 10.91 1.70 N 3 1 NE R ARG 140 ? ? CZ R ARG 140 ? ? NH2 R ARG 140 ? ? 123.75 120.30 3.45 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN R 62 ? ? -104.54 -167.59 2 1 SER R 173 ? ? 69.01 -9.47 3 1 VAL R 282 ? ? -126.85 -51.66 4 1 PHE R 285 ? ? -140.37 19.02 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 L ASN 14 ? A ASN 6 2 1 Y 1 L LYS 15 ? A LYS 7 3 1 Y 1 L TRP 16 ? A TRP 8 4 1 Y 1 L ALA 17 ? A ALA 9 5 1 Y 1 L LEU 18 ? A LEU 10 6 1 Y 1 L SER 19 ? A SER 11 7 1 Y 1 L ARG 20 ? A ARG 12 8 1 Y 1 R MET 1 ? B MET 1 9 1 Y 1 R ASP 2 ? B ASP 2 10 1 Y 1 R PRO 3 ? B PRO 3 11 1 Y 1 R THR 4 ? B THR 4 12 1 Y 1 R THR 5 ? B THR 5 13 1 Y 1 R PRO 6 ? B PRO 6 14 1 Y 1 R ALA 7 ? B ALA 7 15 1 Y 1 R TRP 8 ? B TRP 8 16 1 Y 1 R GLY 9 ? B GLY 9 17 1 Y 1 R THR 10 ? B THR 10 18 1 Y 1 R GLU 11 ? B GLU 11 19 1 Y 1 R SER 12 ? B SER 12 20 1 Y 1 R THR 13 ? B THR 13 21 1 Y 1 R THR 14 ? B THR 14 22 1 Y 1 R VAL 15 ? B VAL 15 23 1 Y 1 R ASN 16 ? B ASN 16 24 1 Y 1 R GLY 17 ? B GLY 17 25 1 Y 1 R ASN 18 ? B ASN 18 26 1 Y 1 R ASP 19 ? B ASP 19 27 1 Y 1 R GLN 20 ? B GLN 20 28 1 Y 1 R ALA 21 ? B ALA 21 29 1 Y 1 R LEU 22 ? B LEU 22 30 1 Y 1 R LEU 23 ? B LEU 23 31 1 Y 1 R LEU 24 ? B LEU 24 32 1 Y 1 R LEU 25 ? B LEU 25 33 1 Y 1 R TRP 289 ? B TRP 289 34 1 Y 1 R ARG 290 ? B ARG 290 35 1 Y 1 R LEU 291 ? B LEU 291 36 1 Y 1 R GLN 292 ? B GLN 292 37 1 Y 1 R GLN 293 ? B GLN 293 38 1 Y 1 R PRO 294 ? B PRO 294 39 1 Y 1 R ILE 295 ? B ILE 295 40 1 Y 1 R LEU 296 ? B LEU 296 41 1 Y 1 R LYS 297 ? B LYS 297 42 1 Y 1 R LEU 298 ? B LEU 298 43 1 Y 1 R ALA 299 ? B ALA 299 44 1 Y 1 R LEU 300 ? B LEU 300 45 1 Y 1 R GLN 301 ? B GLN 301 46 1 Y 1 R ARG 302 ? B ARG 302 47 1 Y 1 R ALA 303 ? B ALA 303 48 1 Y 1 R LEU 304 ? B LEU 304 49 1 Y 1 R GLN 305 ? B GLN 305 50 1 Y 1 R ASP 306 ? B ASP 306 51 1 Y 1 R ILE 307 ? B ILE 307 52 1 Y 1 R ALA 308 ? B ALA 308 53 1 Y 1 R GLU 309 ? B GLU 309 54 1 Y 1 R VAL 310 ? B VAL 310 55 1 Y 1 R ASP 311 ? B ASP 311 56 1 Y 1 R HIS 312 ? B HIS 312 57 1 Y 1 R SER 313 ? B SER 313 58 1 Y 1 R GLU 314 ? B GLU 314 59 1 Y 1 R GLY 315 ? B GLY 315 60 1 Y 1 R CYS 316 ? B CYS 316 61 1 Y 1 R PHE 317 ? B PHE 317 62 1 Y 1 R ARG 318 ? B ARG 318 63 1 Y 1 R GLN 319 ? B GLN 319 64 1 Y 1 R GLY 320 ? B GLY 320 65 1 Y 1 R THR 321 ? B THR 321 66 1 Y 1 R PRO 322 ? B PRO 322 67 1 Y 1 R GLU 323 ? B GLU 323 68 1 Y 1 R MET 324 ? B MET 324 69 1 Y 1 R SER 325 ? B SER 325 70 1 Y 1 R ARG 326 ? B ARG 326 71 1 Y 1 R SER 327 ? B SER 327 72 1 Y 1 R SER 328 ? B SER 328 73 1 Y 1 R LEU 329 ? B LEU 329 74 1 Y 1 R VAL 330 ? B VAL 330 # _em_ctf_correction.id 1 _em_ctf_correction.em_image_processing_id 1 _em_ctf_correction.type 'PHASE FLIPPING AND AMPLITUDE CORRECTION' _em_ctf_correction.details ? # _em_entity_assembly_naturalsource.id 1 _em_entity_assembly_naturalsource.entity_assembly_id 1 _em_entity_assembly_naturalsource.cell ? _em_entity_assembly_naturalsource.cellular_location ? _em_entity_assembly_naturalsource.ncbi_tax_id 9606 _em_entity_assembly_naturalsource.organ ? _em_entity_assembly_naturalsource.organelle ? _em_entity_assembly_naturalsource.organism 'Homo sapiens' _em_entity_assembly_naturalsource.strain ? _em_entity_assembly_naturalsource.tissue ? # _em_entity_assembly_recombinant.id 1 _em_entity_assembly_recombinant.entity_assembly_id 1 _em_entity_assembly_recombinant.cell ? _em_entity_assembly_recombinant.ncbi_tax_id 7108 _em_entity_assembly_recombinant.organism 'Spodoptera frugiperda' _em_entity_assembly_recombinant.plasmid ? _em_entity_assembly_recombinant.strain ? # _em_image_processing.id 1 _em_image_processing.image_recording_id 1 _em_image_processing.details ? # _em_image_recording.id 1 _em_image_recording.imaging_id 1 _em_image_recording.avg_electron_dose_per_image 58 _em_image_recording.average_exposure_time ? _em_image_recording.details ? _em_image_recording.detector_mode ? _em_image_recording.film_or_detector_model 'GATAN K2 SUMMIT (4k x 4k)' _em_image_recording.num_diffraction_images ? _em_image_recording.num_grids_imaged ? _em_image_recording.num_real_images ? _em_image_recording.avg_electron_dose_per_subtomogram ? # loop_ _em_software.id _em_software.category _em_software.details _em_software.name _em_software.version _em_software.image_processing_id _em_software.fitting_id _em_software.imaging_id 1 'CRYSTALLOGRAPHY MERGING' ? ? ? 1 1 1 2 'IMAGE ACQUISITION' ? ? ? ? ? 1 3 MASKING ? ? ? ? ? ? 4 'CTF CORRECTION' ? ? ? 1 ? ? 5 'LAYERLINE INDEXING' ? ? ? ? ? ? 6 'DIFFRACTION INDEXING' ? ? ? ? ? ? 7 'MODEL FITTING' ? ? ? ? ? ? 8 'MODEL REFINEMENT' ? ? ? ? ? ? 9 OTHER ? ? ? ? ? ? 10 'INITIAL EULER ASSIGNMENT' ? ? ? 1 ? ? 11 'FINAL EULER ASSIGNMENT' ? ? ? 1 ? ? 12 CLASSIFICATION ? ? ? 1 ? ? 13 RECONSTRUCTION ? ? ? 1 ? ? # _em_specimen.id 1 _em_specimen.experiment_id 1 _em_specimen.concentration ? _em_specimen.details ? _em_specimen.embedding_applied NO _em_specimen.shadowing_applied NO _em_specimen.staining_applied NO _em_specimen.vitrification_applied YES # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number '81773704, 92057121, 31900936, 31971195' _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name CHOLESTEROL _pdbx_entity_nonpoly.comp_id CLR # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #