data_7W6X # _entry.id 7W6X # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.360 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7W6X pdb_00007w6x 10.2210/pdb7w6x/pdb WWPDB D_1300026108 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7W6X _pdbx_database_status.recvd_initial_deposition_date 2021-12-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Takanuki, K.' 1 ? 'Imaizumi, Y.' 2 ? 'Nogi, T.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Adv' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2375-2548 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 8 _citation.language ? _citation.page_first eabp9011 _citation.page_last eabp9011 _citation.title 'Mechanistic insights into intramembrane proteolysis by E. coli site-2 protease homolog RseP.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1126/sciadv.abp9011 _citation.pdbx_database_id_PubMed 36001659 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Imaizumi, Y.' 1 0000-0002-4170-9177 primary 'Takanuki, K.' 2 0000-0002-7135-4813 primary 'Miyake, T.' 3 0000-0002-0752-4523 primary 'Takemoto, M.' 4 0000-0002-6339-6431 primary 'Hirata, K.' 5 0000-0002-1491-6509 primary 'Hirose, M.' 6 0000-0001-8991-587X primary 'Oi, R.' 7 ? primary 'Kobayashi, T.' 8 ? primary 'Miyoshi, K.' 9 ? primary 'Aruga, R.' 10 ? primary 'Yokoyama, T.' 11 ? primary 'Katagiri, S.' 12 ? primary 'Matsuura, H.' 13 0000-0002-8778-7955 primary 'Iwasaki, K.' 14 0000-0002-3808-8904 primary 'Kato, T.' 15 0000-0002-8879-6685 primary 'Kaneko, M.K.' 16 0000-0002-4158-9208 primary 'Kato, Y.' 17 0000-0001-5385-8201 primary 'Tajiri, M.' 18 ? primary 'Akashi, S.' 19 0000-0002-8978-6358 primary 'Nureki, O.' 20 0000-0003-1813-7008 primary 'Hizukuri, Y.' 21 0000-0003-0594-1160 primary 'Akiyama, Y.' 22 0000-0003-4483-5408 primary 'Nogi, T.' 23 0000-0001-8663-3519 # _cell.angle_alpha 68.167 _cell.angle_alpha_esd ? _cell.angle_beta 74.591 _cell.angle_beta_esd ? _cell.angle_gamma 69.346 _cell.angle_gamma_esd ? _cell.entry_id 7W6X _cell.details ? _cell.formula_units_Z ? _cell.length_a 47.340 _cell.length_a_esd ? _cell.length_b 56.120 _cell.length_b_esd ? _cell.length_c 69.670 _cell.length_c_esd ? _cell.volume 158834.199 _cell.volume_esd ? _cell.Z_PDB 1 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7W6X _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall 'P 1' _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Regulator of sigma-E protease RseP' 50103.047 1 3.4.24.- ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 3 non-polymer syn '4-(N-HYDROXYAMINO)-2R-ISOBUTYL-2S-(2-THIENYLTHIOMETHYL)SUCCINYL-L-PHENYLALANINE-N-METHYLAMIDE' 477.640 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'S2P endopeptidase,Site-2 protease RseP,S2P protease RseP,Site-2-type intramembrane protease' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(FME)LSFLWDLASFIVALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDKLGTEYVIALIPLGGYVKMLDER AEPVVPELRHHAFNNKSVGQRAAIIAAGPVANFIFAIFAYWLVFIIGVPGVRPVVGEIAANSIAAEAQIAPGTELKAVDG IETPDWDAVRLQLVDKIGDESTTITVAPFGSDQRRDVKLDLRHWAFEPDKEDPVSSLGIRPRGPQIEPVLENVQPNSAAS KAGLQAGDRIVKVDGQPLTQWVTFVMLVRDNPGKSLALEIERQGSPLSLTLIPESKPGNGKAIGFVGIEPKVIPLPDEYK VVRQYGPFNAIVEATDKTWQLMKLTVSMLGKLITGDVKLNNLSGPISIAKGAGMTAELGVVYYLPFLALISVNLGIINLF PLPVLDGGHLLFLAIEKIKGGPVSERVQDFCYRIGSILLVLLMGLALFNDFSRLGTENLYFQ ; _entity_poly.pdbx_seq_one_letter_code_can ;MLSFLWDLASFIVALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDKLGTEYVIALIPLGGYVKMLDERAEPV VPELRHHAFNNKSVGQRAAIIAAGPVANFIFAIFAYWLVFIIGVPGVRPVVGEIAANSIAAEAQIAPGTELKAVDGIETP DWDAVRLQLVDKIGDESTTITVAPFGSDQRRDVKLDLRHWAFEPDKEDPVSSLGIRPRGPQIEPVLENVQPNSAASKAGL QAGDRIVKVDGQPLTQWVTFVMLVRDNPGKSLALEIERQGSPLSLTLIPESKPGNGKAIGFVGIEPKVIPLPDEYKVVRQ YGPFNAIVEATDKTWQLMKLTVSMLGKLITGDVKLNNLSGPISIAKGAGMTAELGVVYYLPFLALISVNLGIINLFPLPV LDGGHLLFLAIEKIKGGPVSERVQDFCYRIGSILLVLLMGLALFNDFSRLGTENLYFQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 FME n 1 2 LEU n 1 3 SER n 1 4 PHE n 1 5 LEU n 1 6 TRP n 1 7 ASP n 1 8 LEU n 1 9 ALA n 1 10 SER n 1 11 PHE n 1 12 ILE n 1 13 VAL n 1 14 ALA n 1 15 LEU n 1 16 GLY n 1 17 VAL n 1 18 LEU n 1 19 ILE n 1 20 THR n 1 21 VAL n 1 22 HIS n 1 23 GLU n 1 24 PHE n 1 25 GLY n 1 26 HIS n 1 27 PHE n 1 28 TRP n 1 29 VAL n 1 30 ALA n 1 31 ARG n 1 32 ARG n 1 33 CYS n 1 34 GLY n 1 35 VAL n 1 36 ARG n 1 37 VAL n 1 38 GLU n 1 39 ARG n 1 40 PHE n 1 41 SER n 1 42 ILE n 1 43 GLY n 1 44 PHE n 1 45 GLY n 1 46 LYS n 1 47 ALA n 1 48 LEU n 1 49 TRP n 1 50 ARG n 1 51 ARG n 1 52 THR n 1 53 ASP n 1 54 LYS n 1 55 LEU n 1 56 GLY n 1 57 THR n 1 58 GLU n 1 59 TYR n 1 60 VAL n 1 61 ILE n 1 62 ALA n 1 63 LEU n 1 64 ILE n 1 65 PRO n 1 66 LEU n 1 67 GLY n 1 68 GLY n 1 69 TYR n 1 70 VAL n 1 71 LYS n 1 72 MET n 1 73 LEU n 1 74 ASP n 1 75 GLU n 1 76 ARG n 1 77 ALA n 1 78 GLU n 1 79 PRO n 1 80 VAL n 1 81 VAL n 1 82 PRO n 1 83 GLU n 1 84 LEU n 1 85 ARG n 1 86 HIS n 1 87 HIS n 1 88 ALA n 1 89 PHE n 1 90 ASN n 1 91 ASN n 1 92 LYS n 1 93 SER n 1 94 VAL n 1 95 GLY n 1 96 GLN n 1 97 ARG n 1 98 ALA n 1 99 ALA n 1 100 ILE n 1 101 ILE n 1 102 ALA n 1 103 ALA n 1 104 GLY n 1 105 PRO n 1 106 VAL n 1 107 ALA n 1 108 ASN n 1 109 PHE n 1 110 ILE n 1 111 PHE n 1 112 ALA n 1 113 ILE n 1 114 PHE n 1 115 ALA n 1 116 TYR n 1 117 TRP n 1 118 LEU n 1 119 VAL n 1 120 PHE n 1 121 ILE n 1 122 ILE n 1 123 GLY n 1 124 VAL n 1 125 PRO n 1 126 GLY n 1 127 VAL n 1 128 ARG n 1 129 PRO n 1 130 VAL n 1 131 VAL n 1 132 GLY n 1 133 GLU n 1 134 ILE n 1 135 ALA n 1 136 ALA n 1 137 ASN n 1 138 SER n 1 139 ILE n 1 140 ALA n 1 141 ALA n 1 142 GLU n 1 143 ALA n 1 144 GLN n 1 145 ILE n 1 146 ALA n 1 147 PRO n 1 148 GLY n 1 149 THR n 1 150 GLU n 1 151 LEU n 1 152 LYS n 1 153 ALA n 1 154 VAL n 1 155 ASP n 1 156 GLY n 1 157 ILE n 1 158 GLU n 1 159 THR n 1 160 PRO n 1 161 ASP n 1 162 TRP n 1 163 ASP n 1 164 ALA n 1 165 VAL n 1 166 ARG n 1 167 LEU n 1 168 GLN n 1 169 LEU n 1 170 VAL n 1 171 ASP n 1 172 LYS n 1 173 ILE n 1 174 GLY n 1 175 ASP n 1 176 GLU n 1 177 SER n 1 178 THR n 1 179 THR n 1 180 ILE n 1 181 THR n 1 182 VAL n 1 183 ALA n 1 184 PRO n 1 185 PHE n 1 186 GLY n 1 187 SER n 1 188 ASP n 1 189 GLN n 1 190 ARG n 1 191 ARG n 1 192 ASP n 1 193 VAL n 1 194 LYS n 1 195 LEU n 1 196 ASP n 1 197 LEU n 1 198 ARG n 1 199 HIS n 1 200 TRP n 1 201 ALA n 1 202 PHE n 1 203 GLU n 1 204 PRO n 1 205 ASP n 1 206 LYS n 1 207 GLU n 1 208 ASP n 1 209 PRO n 1 210 VAL n 1 211 SER n 1 212 SER n 1 213 LEU n 1 214 GLY n 1 215 ILE n 1 216 ARG n 1 217 PRO n 1 218 ARG n 1 219 GLY n 1 220 PRO n 1 221 GLN n 1 222 ILE n 1 223 GLU n 1 224 PRO n 1 225 VAL n 1 226 LEU n 1 227 GLU n 1 228 ASN n 1 229 VAL n 1 230 GLN n 1 231 PRO n 1 232 ASN n 1 233 SER n 1 234 ALA n 1 235 ALA n 1 236 SER n 1 237 LYS n 1 238 ALA n 1 239 GLY n 1 240 LEU n 1 241 GLN n 1 242 ALA n 1 243 GLY n 1 244 ASP n 1 245 ARG n 1 246 ILE n 1 247 VAL n 1 248 LYS n 1 249 VAL n 1 250 ASP n 1 251 GLY n 1 252 GLN n 1 253 PRO n 1 254 LEU n 1 255 THR n 1 256 GLN n 1 257 TRP n 1 258 VAL n 1 259 THR n 1 260 PHE n 1 261 VAL n 1 262 MET n 1 263 LEU n 1 264 VAL n 1 265 ARG n 1 266 ASP n 1 267 ASN n 1 268 PRO n 1 269 GLY n 1 270 LYS n 1 271 SER n 1 272 LEU n 1 273 ALA n 1 274 LEU n 1 275 GLU n 1 276 ILE n 1 277 GLU n 1 278 ARG n 1 279 GLN n 1 280 GLY n 1 281 SER n 1 282 PRO n 1 283 LEU n 1 284 SER n 1 285 LEU n 1 286 THR n 1 287 LEU n 1 288 ILE n 1 289 PRO n 1 290 GLU n 1 291 SER n 1 292 LYS n 1 293 PRO n 1 294 GLY n 1 295 ASN n 1 296 GLY n 1 297 LYS n 1 298 ALA n 1 299 ILE n 1 300 GLY n 1 301 PHE n 1 302 VAL n 1 303 GLY n 1 304 ILE n 1 305 GLU n 1 306 PRO n 1 307 LYS n 1 308 VAL n 1 309 ILE n 1 310 PRO n 1 311 LEU n 1 312 PRO n 1 313 ASP n 1 314 GLU n 1 315 TYR n 1 316 LYS n 1 317 VAL n 1 318 VAL n 1 319 ARG n 1 320 GLN n 1 321 TYR n 1 322 GLY n 1 323 PRO n 1 324 PHE n 1 325 ASN n 1 326 ALA n 1 327 ILE n 1 328 VAL n 1 329 GLU n 1 330 ALA n 1 331 THR n 1 332 ASP n 1 333 LYS n 1 334 THR n 1 335 TRP n 1 336 GLN n 1 337 LEU n 1 338 MET n 1 339 LYS n 1 340 LEU n 1 341 THR n 1 342 VAL n 1 343 SER n 1 344 MET n 1 345 LEU n 1 346 GLY n 1 347 LYS n 1 348 LEU n 1 349 ILE n 1 350 THR n 1 351 GLY n 1 352 ASP n 1 353 VAL n 1 354 LYS n 1 355 LEU n 1 356 ASN n 1 357 ASN n 1 358 LEU n 1 359 SER n 1 360 GLY n 1 361 PRO n 1 362 ILE n 1 363 SER n 1 364 ILE n 1 365 ALA n 1 366 LYS n 1 367 GLY n 1 368 ALA n 1 369 GLY n 1 370 MET n 1 371 THR n 1 372 ALA n 1 373 GLU n 1 374 LEU n 1 375 GLY n 1 376 VAL n 1 377 VAL n 1 378 TYR n 1 379 TYR n 1 380 LEU n 1 381 PRO n 1 382 PHE n 1 383 LEU n 1 384 ALA n 1 385 LEU n 1 386 ILE n 1 387 SER n 1 388 VAL n 1 389 ASN n 1 390 LEU n 1 391 GLY n 1 392 ILE n 1 393 ILE n 1 394 ASN n 1 395 LEU n 1 396 PHE n 1 397 PRO n 1 398 LEU n 1 399 PRO n 1 400 VAL n 1 401 LEU n 1 402 ASP n 1 403 GLY n 1 404 GLY n 1 405 HIS n 1 406 LEU n 1 407 LEU n 1 408 PHE n 1 409 LEU n 1 410 ALA n 1 411 ILE n 1 412 GLU n 1 413 LYS n 1 414 ILE n 1 415 LYS n 1 416 GLY n 1 417 GLY n 1 418 PRO n 1 419 VAL n 1 420 SER n 1 421 GLU n 1 422 ARG n 1 423 VAL n 1 424 GLN n 1 425 ASP n 1 426 PHE n 1 427 CYS n 1 428 TYR n 1 429 ARG n 1 430 ILE n 1 431 GLY n 1 432 SER n 1 433 ILE n 1 434 LEU n 1 435 LEU n 1 436 VAL n 1 437 LEU n 1 438 LEU n 1 439 MET n 1 440 GLY n 1 441 LEU n 1 442 ALA n 1 443 LEU n 1 444 PHE n 1 445 ASN n 1 446 ASP n 1 447 PHE n 1 448 SER n 1 449 ARG n 1 450 LEU n 1 451 GLY n 1 452 THR n 1 453 GLU n 1 454 ASN n 1 455 LEU n 1 456 TYR n 1 457 PHE n 1 458 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 458 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'rseP, ecfE, yaeL, b0176, JW0171' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain K12 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RSEP_ECOLI _struct_ref.pdbx_db_accession P0AEH1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MLSFLWDLASFIVALGVLITVHEFGHFWVARRCGVRVERFSIGFGKALWRRTDKLGTEYVIALIPLGGYVKMLDERAEPV VPELRHHAFNNKSVGQRAAIIAAGPVANFIFAIFAYWLVFIIGVPGVRPVVGEIAANSIAAEAQIAPGTELKAVDGIETP DWDAVRLQLVDKIGDESTTITVAPFGSDQRRDVKLDLRHWAFEPDKEDPVSSLGIRPRGPQIEPVLENVQPNSAASKAGL QAGDRIVKVDGQPLTQWVTFVMLVRDNPGKSLALEIERQGSPLSLTLIPESKPGNGKAIGFVGIEPKVIPLPDEYKVVRQ YGPFNAIVEATDKTWQLMKLTVSMLGKLITGDVKLNNLSGPISIAKGAGMTAELGVVYYLPFLALISVNLGIINLFPLPV LDGGHLLFLAIEKIKGGPVSERVQDFCYRIGSILLVLLMGLALFNDFSRL ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7W6X _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 450 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0AEH1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 450 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 450 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7W6X GLY A 451 ? UNP P0AEH1 ? ? 'expression tag' 451 1 1 7W6X THR A 452 ? UNP P0AEH1 ? ? 'expression tag' 452 2 1 7W6X GLU A 453 ? UNP P0AEH1 ? ? 'expression tag' 453 3 1 7W6X ASN A 454 ? UNP P0AEH1 ? ? 'expression tag' 454 4 1 7W6X LEU A 455 ? UNP P0AEH1 ? ? 'expression tag' 455 5 1 7W6X TYR A 456 ? UNP P0AEH1 ? ? 'expression tag' 456 6 1 7W6X PHE A 457 ? UNP P0AEH1 ? ? 'expression tag' 457 7 1 7W6X GLN A 458 ? UNP P0AEH1 ? ? 'expression tag' 458 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BAT non-polymer . '4-(N-HYDROXYAMINO)-2R-ISOBUTYL-2S-(2-THIENYLTHIOMETHYL)SUCCINYL-L-PHENYLALANINE-N-METHYLAMIDE' 'BATIMASTAT; BB94' 'C23 H31 N3 O4 S2' 477.640 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FME 'L-peptide linking' n N-FORMYLMETHIONINE ? 'C6 H11 N O3 S' 177.221 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7W6X _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.17 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 61.20 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'LIPIDIC CUBIC PHASE' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30% (vol./vol.) polyethylene glycol 500 dimethyl ether, 100 mM NaCl, 100 mM MgCl2, 100 mM HEPES-Na (pH 7.0)' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-12-14 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL32XU' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL32XU _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate 103.16 _reflns.entry_id 7W6X _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.20 _reflns.d_resolution_low 43.77 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10129 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.4 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.098 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 3.20 _reflns_shell.d_res_low 3.31 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.1 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1028 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all 1.347 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.417 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 94.52 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7W6X _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.20 _refine.ls_d_res_low 43.76 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10126 _refine.ls_number_reflns_R_free 471 _refine.ls_number_reflns_R_work 9655 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.69 _refine.ls_percent_reflns_R_free 4.65 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2486 _refine.ls_R_factor_R_free 0.3053 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2460 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.93 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 33.9463 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.5210 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.20 _refine_hist.d_res_low 43.76 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 3478 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 3444 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 34 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0019 ? 3557 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.4774 ? 4837 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0419 ? 555 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0041 ? 620 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 11.4913 ? 1289 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.20 3.66 . . 153 3237 99.94 . . . 0.3320 . 0.2952 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.66 4.61 . . 156 3198 99.32 . . . 0.3204 . 0.2686 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.61 43.76 . . 162 3220 99.82 . . . 0.2888 . 0.2200 . . . . . . . . . . . # _struct.entry_id 7W6X _struct.title 'Crystal structure of E. coli RseP in complex with batimastat' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7W6X _struct_keywords.text 'Intramembrane protease, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 FME A 1 ? GLY A 34 ? FME A 1 GLY A 34 1 ? 34 HELX_P HELX_P2 AA2 GLU A 83 ? ALA A 88 ? GLU A 83 ALA A 88 5 ? 6 HELX_P HELX_P3 AA3 SER A 93 ? GLY A 123 ? SER A 93 GLY A 123 1 ? 31 HELX_P HELX_P4 AA4 ALA A 140 ? GLN A 144 ? ALA A 140 GLN A 144 5 ? 5 HELX_P HELX_P5 AA5 ASP A 161 ? ASP A 171 ? ASP A 161 ASP A 171 1 ? 11 HELX_P HELX_P6 AA6 ASP A 208 ? LEU A 213 ? ASP A 208 LEU A 213 1 ? 6 HELX_P HELX_P7 AA7 SER A 233 ? ALA A 238 ? SER A 233 ALA A 238 1 ? 6 HELX_P HELX_P8 AA8 GLN A 256 ? ASN A 267 ? GLN A 256 ASN A 267 1 ? 12 HELX_P HELX_P9 AA9 PRO A 312 ? LYS A 316 ? PRO A 312 LYS A 316 5 ? 5 HELX_P HELX_P10 AB1 GLY A 322 ? GLY A 351 ? GLY A 322 GLY A 351 1 ? 30 HELX_P HELX_P11 AB2 LYS A 354 ? LEU A 358 ? LYS A 354 LEU A 358 5 ? 5 HELX_P HELX_P12 AB3 GLY A 360 ? GLY A 375 ? GLY A 360 GLY A 375 1 ? 16 HELX_P HELX_P13 AB4 GLY A 375 ? LEU A 395 ? GLY A 375 LEU A 395 1 ? 21 HELX_P HELX_P14 AB5 LEU A 401 ? GLY A 416 ? LEU A 401 GLY A 416 1 ? 16 HELX_P HELX_P15 AB6 GLN A 424 ? PHE A 447 ? GLN A 424 PHE A 447 1 ? 24 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A FME 1 C ? ? ? 1_555 A LEU 2 N ? ? A FME 1 A LEU 2 1_555 ? ? ? ? ? ? ? 1.330 ? ? metalc1 metalc ? ? A HIS 22 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 22 A ZN 501 1_555 ? ? ? ? ? ? ? 2.102 ? ? metalc2 metalc ? ? A HIS 26 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 26 A ZN 501 1_555 ? ? ? ? ? ? ? 2.058 ? ? metalc3 metalc ? ? A HIS 86 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 86 A ZN 503 1_555 ? ? ? ? ? ? ? 2.032 ? ? metalc4 metalc ? ? A HIS 87 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 87 A ZN 503 1_555 ? ? ? ? ? ? ? 2.045 ? ? metalc5 metalc ? ? A HIS 199 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 199 A ZN 503 1_556 ? ? ? ? ? ? ? 2.291 ? ? metalc6 metalc ? ? A ASP 402 OD1 ? ? ? 1_555 B ZN . ZN ? ? A ASP 402 A ZN 501 1_555 ? ? ? ? ? ? ? 2.061 ? ? metalc7 metalc ? ? A ASP 402 OD2 ? ? ? 1_555 B ZN . ZN ? ? A ASP 402 A ZN 501 1_555 ? ? ? ? ? ? ? 2.008 ? ? metalc8 metalc ? ? B ZN . ZN ? ? ? 1_555 C BAT . O2 ? ? A ZN 501 A BAT 502 1_555 ? ? ? ? ? ? ? 2.157 ? ? metalc9 metalc ? ? B ZN . ZN ? ? ? 1_555 C BAT . O1 ? ? A ZN 501 A BAT 502 1_555 ? ? ? ? ? ? ? 2.245 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? AA3 ? 4 ? AA4 ? 2 ? AA5 ? 4 ? AA6 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA4 1 2 ? anti-parallel AA5 1 2 ? anti-parallel AA5 2 3 ? anti-parallel AA5 3 4 ? anti-parallel AA6 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 37 ? THR A 52 ? VAL A 37 THR A 52 AA1 2 GLU A 58 ? MET A 72 ? GLU A 58 MET A 72 AA2 1 VAL A 131 ? ILE A 134 ? VAL A 131 ILE A 134 AA2 2 ILE A 215 ? PRO A 217 ? ILE A 215 PRO A 217 AA3 1 ILE A 157 ? GLU A 158 ? ILE A 157 GLU A 158 AA3 2 THR A 149 ? VAL A 154 ? THR A 149 VAL A 154 AA3 3 SER A 177 ? PRO A 184 ? SER A 177 PRO A 184 AA3 4 ARG A 191 ? ASP A 196 ? ARG A 191 ASP A 196 AA4 1 GLN A 221 ? VAL A 229 ? GLN A 221 VAL A 229 AA4 2 ILE A 304 ? ILE A 309 ? ILE A 304 ILE A 309 AA5 1 GLN A 252 ? PRO A 253 ? GLN A 252 PRO A 253 AA5 2 ARG A 245 ? VAL A 249 ? ARG A 245 VAL A 249 AA5 3 LEU A 272 ? ARG A 278 ? LEU A 272 ARG A 278 AA5 4 SER A 281 ? LEU A 287 ? SER A 281 LEU A 287 AA6 1 LYS A 292 ? PRO A 293 ? LYS A 292 PRO A 293 AA6 2 ALA A 298 ? ILE A 299 ? ALA A 298 ILE A 299 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLU A 38 ? N GLU A 38 O GLU A 58 ? O GLU A 58 AA2 1 2 N GLU A 133 ? N GLU A 133 O ARG A 216 ? O ARG A 216 AA3 1 2 O ILE A 157 ? O ILE A 157 N VAL A 154 ? N VAL A 154 AA3 2 3 N GLU A 150 ? N GLU A 150 O ALA A 183 ? O ALA A 183 AA3 3 4 N VAL A 182 ? N VAL A 182 O ARG A 191 ? O ARG A 191 AA4 1 2 N GLN A 221 ? N GLN A 221 O ILE A 309 ? O ILE A 309 AA5 1 2 O GLN A 252 ? O GLN A 252 N VAL A 249 ? N VAL A 249 AA5 2 3 N LYS A 248 ? N LYS A 248 O GLU A 275 ? O GLU A 275 AA5 3 4 N ARG A 278 ? N ARG A 278 O SER A 281 ? O SER A 281 AA6 1 2 N LYS A 292 ? N LYS A 292 O ILE A 299 ? O ILE A 299 # _atom_sites.entry_id 7W6X _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.021124 _atom_sites.fract_transf_matrix[1][2] -0.007963 _atom_sites.fract_transf_matrix[1][3] -0.003539 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019043 _atom_sites.fract_transf_matrix[2][3] -0.006173 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015651 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? ? ? 11.43723 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? ? ? 9.05267 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? ZN ? ? 29.81721 ? ? ? 5.87945 ? ? ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 FME 1 1 1 FME FME A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 TRP 6 6 6 TRP TRP A . n A 1 7 ASP 7 7 7 ASP ASP A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 PHE 11 11 11 PHE PHE A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 PHE 24 24 24 PHE PHE A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 HIS 26 26 26 HIS HIS A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 TRP 28 28 28 TRP TRP A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 GLY 43 43 43 GLY GLY A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 TRP 49 49 49 TRP TRP A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 THR 52 52 52 THR THR A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 TYR 69 69 69 TYR TYR A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 PRO 82 82 82 PRO PRO A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 PHE 89 89 89 PHE PHE A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 ASN 91 91 91 ASN ASN A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 ASN 108 108 108 ASN ASN A . n A 1 109 PHE 109 109 109 PHE PHE A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 ILE 113 113 113 ILE ILE A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 ALA 115 115 115 ALA ALA A . n A 1 116 TYR 116 116 116 TYR TYR A . n A 1 117 TRP 117 117 117 TRP TRP A . n A 1 118 LEU 118 118 118 LEU LEU A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 PHE 120 120 120 PHE PHE A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 PRO 125 125 125 PRO PRO A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 ARG 128 128 128 ARG ARG A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 ASN 137 137 137 ASN ASN A . n A 1 138 SER 138 138 138 SER SER A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 ALA 143 143 143 ALA ALA A . n A 1 144 GLN 144 144 144 GLN GLN A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 PRO 147 147 147 PRO PRO A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 LEU 151 151 151 LEU LEU A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 VAL 154 154 154 VAL VAL A . n A 1 155 ASP 155 155 155 ASP ASP A . n A 1 156 GLY 156 156 156 GLY GLY A . n A 1 157 ILE 157 157 157 ILE ILE A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 THR 159 159 159 THR THR A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 ASP 161 161 161 ASP ASP A . n A 1 162 TRP 162 162 162 TRP TRP A . n A 1 163 ASP 163 163 163 ASP ASP A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 VAL 165 165 165 VAL VAL A . n A 1 166 ARG 166 166 166 ARG ARG A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 GLN 168 168 168 GLN GLN A . n A 1 169 LEU 169 169 169 LEU LEU A . n A 1 170 VAL 170 170 170 VAL VAL A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 LYS 172 172 172 LYS LYS A . n A 1 173 ILE 173 173 173 ILE ILE A . n A 1 174 GLY 174 174 174 GLY GLY A . n A 1 175 ASP 175 175 175 ASP ASP A . n A 1 176 GLU 176 176 176 GLU GLU A . n A 1 177 SER 177 177 177 SER SER A . n A 1 178 THR 178 178 178 THR THR A . n A 1 179 THR 179 179 179 THR THR A . n A 1 180 ILE 180 180 180 ILE ILE A . n A 1 181 THR 181 181 181 THR THR A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 ALA 183 183 183 ALA ALA A . n A 1 184 PRO 184 184 184 PRO PRO A . n A 1 185 PHE 185 185 185 PHE PHE A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 SER 187 187 187 SER SER A . n A 1 188 ASP 188 188 188 ASP ASP A . n A 1 189 GLN 189 189 189 GLN GLN A . n A 1 190 ARG 190 190 190 ARG ARG A . n A 1 191 ARG 191 191 191 ARG ARG A . n A 1 192 ASP 192 192 192 ASP ASP A . n A 1 193 VAL 193 193 193 VAL VAL A . n A 1 194 LYS 194 194 194 LYS LYS A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 ASP 196 196 196 ASP ASP A . n A 1 197 LEU 197 197 197 LEU LEU A . n A 1 198 ARG 198 198 198 ARG ARG A . n A 1 199 HIS 199 199 199 HIS HIS A . n A 1 200 TRP 200 200 200 TRP TRP A . n A 1 201 ALA 201 201 201 ALA ALA A . n A 1 202 PHE 202 202 202 PHE PHE A . n A 1 203 GLU 203 203 203 GLU GLU A . n A 1 204 PRO 204 204 204 PRO PRO A . n A 1 205 ASP 205 205 205 ASP ASP A . n A 1 206 LYS 206 206 206 LYS LYS A . n A 1 207 GLU 207 207 207 GLU GLU A . n A 1 208 ASP 208 208 208 ASP ASP A . n A 1 209 PRO 209 209 209 PRO PRO A . n A 1 210 VAL 210 210 210 VAL VAL A . n A 1 211 SER 211 211 211 SER SER A . n A 1 212 SER 212 212 212 SER SER A . n A 1 213 LEU 213 213 213 LEU LEU A . n A 1 214 GLY 214 214 214 GLY GLY A . n A 1 215 ILE 215 215 215 ILE ILE A . n A 1 216 ARG 216 216 216 ARG ARG A . n A 1 217 PRO 217 217 217 PRO PRO A . n A 1 218 ARG 218 218 218 ARG ARG A . n A 1 219 GLY 219 219 219 GLY GLY A . n A 1 220 PRO 220 220 220 PRO PRO A . n A 1 221 GLN 221 221 221 GLN GLN A . n A 1 222 ILE 222 222 222 ILE ILE A . n A 1 223 GLU 223 223 223 GLU GLU A . n A 1 224 PRO 224 224 224 PRO PRO A . n A 1 225 VAL 225 225 225 VAL VAL A . n A 1 226 LEU 226 226 226 LEU LEU A . n A 1 227 GLU 227 227 227 GLU GLU A . n A 1 228 ASN 228 228 228 ASN ASN A . n A 1 229 VAL 229 229 229 VAL VAL A . n A 1 230 GLN 230 230 230 GLN GLN A . n A 1 231 PRO 231 231 231 PRO PRO A . n A 1 232 ASN 232 232 232 ASN ASN A . n A 1 233 SER 233 233 233 SER SER A . n A 1 234 ALA 234 234 234 ALA ALA A . n A 1 235 ALA 235 235 235 ALA ALA A . n A 1 236 SER 236 236 236 SER SER A . n A 1 237 LYS 237 237 237 LYS LYS A . n A 1 238 ALA 238 238 238 ALA ALA A . n A 1 239 GLY 239 239 239 GLY GLY A . n A 1 240 LEU 240 240 240 LEU LEU A . n A 1 241 GLN 241 241 241 GLN GLN A . n A 1 242 ALA 242 242 242 ALA ALA A . n A 1 243 GLY 243 243 243 GLY GLY A . n A 1 244 ASP 244 244 244 ASP ASP A . n A 1 245 ARG 245 245 245 ARG ARG A . n A 1 246 ILE 246 246 246 ILE ILE A . n A 1 247 VAL 247 247 247 VAL VAL A . n A 1 248 LYS 248 248 248 LYS LYS A . n A 1 249 VAL 249 249 249 VAL VAL A . n A 1 250 ASP 250 250 250 ASP ASP A . n A 1 251 GLY 251 251 251 GLY GLY A . n A 1 252 GLN 252 252 252 GLN GLN A . n A 1 253 PRO 253 253 253 PRO PRO A . n A 1 254 LEU 254 254 254 LEU LEU A . n A 1 255 THR 255 255 255 THR THR A . n A 1 256 GLN 256 256 256 GLN GLN A . n A 1 257 TRP 257 257 257 TRP TRP A . n A 1 258 VAL 258 258 258 VAL VAL A . n A 1 259 THR 259 259 259 THR THR A . n A 1 260 PHE 260 260 260 PHE PHE A . n A 1 261 VAL 261 261 261 VAL VAL A . n A 1 262 MET 262 262 262 MET MET A . n A 1 263 LEU 263 263 263 LEU LEU A . n A 1 264 VAL 264 264 264 VAL VAL A . n A 1 265 ARG 265 265 265 ARG ARG A . n A 1 266 ASP 266 266 266 ASP ASP A . n A 1 267 ASN 267 267 267 ASN ASN A . n A 1 268 PRO 268 268 268 PRO PRO A . n A 1 269 GLY 269 269 269 GLY GLY A . n A 1 270 LYS 270 270 270 LYS LYS A . n A 1 271 SER 271 271 271 SER SER A . n A 1 272 LEU 272 272 272 LEU LEU A . n A 1 273 ALA 273 273 273 ALA ALA A . n A 1 274 LEU 274 274 274 LEU LEU A . n A 1 275 GLU 275 275 275 GLU GLU A . n A 1 276 ILE 276 276 276 ILE ILE A . n A 1 277 GLU 277 277 277 GLU GLU A . n A 1 278 ARG 278 278 278 ARG ARG A . n A 1 279 GLN 279 279 279 GLN GLN A . n A 1 280 GLY 280 280 280 GLY GLY A . n A 1 281 SER 281 281 281 SER SER A . n A 1 282 PRO 282 282 282 PRO PRO A . n A 1 283 LEU 283 283 283 LEU LEU A . n A 1 284 SER 284 284 284 SER SER A . n A 1 285 LEU 285 285 285 LEU LEU A . n A 1 286 THR 286 286 286 THR THR A . n A 1 287 LEU 287 287 287 LEU LEU A . n A 1 288 ILE 288 288 288 ILE ILE A . n A 1 289 PRO 289 289 289 PRO PRO A . n A 1 290 GLU 290 290 290 GLU GLU A . n A 1 291 SER 291 291 291 SER SER A . n A 1 292 LYS 292 292 292 LYS LYS A . n A 1 293 PRO 293 293 293 PRO PRO A . n A 1 294 GLY 294 294 294 GLY GLY A . n A 1 295 ASN 295 295 295 ASN ASN A . n A 1 296 GLY 296 296 296 GLY GLY A . n A 1 297 LYS 297 297 297 LYS LYS A . n A 1 298 ALA 298 298 298 ALA ALA A . n A 1 299 ILE 299 299 299 ILE ILE A . n A 1 300 GLY 300 300 300 GLY GLY A . n A 1 301 PHE 301 301 301 PHE PHE A . n A 1 302 VAL 302 302 302 VAL VAL A . n A 1 303 GLY 303 303 303 GLY GLY A . n A 1 304 ILE 304 304 304 ILE ILE A . n A 1 305 GLU 305 305 305 GLU GLU A . n A 1 306 PRO 306 306 306 PRO PRO A . n A 1 307 LYS 307 307 307 LYS LYS A . n A 1 308 VAL 308 308 308 VAL VAL A . n A 1 309 ILE 309 309 309 ILE ILE A . n A 1 310 PRO 310 310 310 PRO PRO A . n A 1 311 LEU 311 311 311 LEU LEU A . n A 1 312 PRO 312 312 312 PRO PRO A . n A 1 313 ASP 313 313 313 ASP ASP A . n A 1 314 GLU 314 314 314 GLU GLU A . n A 1 315 TYR 315 315 315 TYR TYR A . n A 1 316 LYS 316 316 316 LYS LYS A . n A 1 317 VAL 317 317 317 VAL VAL A . n A 1 318 VAL 318 318 318 VAL VAL A . n A 1 319 ARG 319 319 319 ARG ARG A . n A 1 320 GLN 320 320 320 GLN GLN A . n A 1 321 TYR 321 321 321 TYR TYR A . n A 1 322 GLY 322 322 322 GLY GLY A . n A 1 323 PRO 323 323 323 PRO PRO A . n A 1 324 PHE 324 324 324 PHE PHE A . n A 1 325 ASN 325 325 325 ASN ASN A . n A 1 326 ALA 326 326 326 ALA ALA A . n A 1 327 ILE 327 327 327 ILE ILE A . n A 1 328 VAL 328 328 328 VAL VAL A . n A 1 329 GLU 329 329 329 GLU GLU A . n A 1 330 ALA 330 330 330 ALA ALA A . n A 1 331 THR 331 331 331 THR THR A . n A 1 332 ASP 332 332 332 ASP ASP A . n A 1 333 LYS 333 333 333 LYS LYS A . n A 1 334 THR 334 334 334 THR THR A . n A 1 335 TRP 335 335 335 TRP TRP A . n A 1 336 GLN 336 336 336 GLN GLN A . n A 1 337 LEU 337 337 337 LEU LEU A . n A 1 338 MET 338 338 338 MET MET A . n A 1 339 LYS 339 339 339 LYS LYS A . n A 1 340 LEU 340 340 340 LEU LEU A . n A 1 341 THR 341 341 341 THR THR A . n A 1 342 VAL 342 342 342 VAL VAL A . n A 1 343 SER 343 343 343 SER SER A . n A 1 344 MET 344 344 344 MET MET A . n A 1 345 LEU 345 345 345 LEU LEU A . n A 1 346 GLY 346 346 346 GLY GLY A . n A 1 347 LYS 347 347 347 LYS LYS A . n A 1 348 LEU 348 348 348 LEU LEU A . n A 1 349 ILE 349 349 349 ILE ILE A . n A 1 350 THR 350 350 350 THR THR A . n A 1 351 GLY 351 351 351 GLY GLY A . n A 1 352 ASP 352 352 352 ASP ASP A . n A 1 353 VAL 353 353 353 VAL VAL A . n A 1 354 LYS 354 354 354 LYS LYS A . n A 1 355 LEU 355 355 355 LEU LEU A . n A 1 356 ASN 356 356 356 ASN ASN A . n A 1 357 ASN 357 357 357 ASN ASN A . n A 1 358 LEU 358 358 358 LEU LEU A . n A 1 359 SER 359 359 359 SER SER A . n A 1 360 GLY 360 360 360 GLY GLY A . n A 1 361 PRO 361 361 361 PRO PRO A . n A 1 362 ILE 362 362 362 ILE ILE A . n A 1 363 SER 363 363 363 SER SER A . n A 1 364 ILE 364 364 364 ILE ILE A . n A 1 365 ALA 365 365 365 ALA ALA A . n A 1 366 LYS 366 366 366 LYS LYS A . n A 1 367 GLY 367 367 367 GLY GLY A . n A 1 368 ALA 368 368 368 ALA ALA A . n A 1 369 GLY 369 369 369 GLY GLY A . n A 1 370 MET 370 370 370 MET MET A . n A 1 371 THR 371 371 371 THR THR A . n A 1 372 ALA 372 372 372 ALA ALA A . n A 1 373 GLU 373 373 373 GLU GLU A . n A 1 374 LEU 374 374 374 LEU LEU A . n A 1 375 GLY 375 375 375 GLY GLY A . n A 1 376 VAL 376 376 376 VAL VAL A . n A 1 377 VAL 377 377 377 VAL VAL A . n A 1 378 TYR 378 378 378 TYR TYR A . n A 1 379 TYR 379 379 379 TYR TYR A . n A 1 380 LEU 380 380 380 LEU LEU A . n A 1 381 PRO 381 381 381 PRO PRO A . n A 1 382 PHE 382 382 382 PHE PHE A . n A 1 383 LEU 383 383 383 LEU LEU A . n A 1 384 ALA 384 384 384 ALA ALA A . n A 1 385 LEU 385 385 385 LEU LEU A . n A 1 386 ILE 386 386 386 ILE ILE A . n A 1 387 SER 387 387 387 SER SER A . n A 1 388 VAL 388 388 388 VAL VAL A . n A 1 389 ASN 389 389 389 ASN ASN A . n A 1 390 LEU 390 390 390 LEU LEU A . n A 1 391 GLY 391 391 391 GLY GLY A . n A 1 392 ILE 392 392 392 ILE ILE A . n A 1 393 ILE 393 393 393 ILE ILE A . n A 1 394 ASN 394 394 394 ASN ASN A . n A 1 395 LEU 395 395 395 LEU LEU A . n A 1 396 PHE 396 396 396 PHE PHE A . n A 1 397 PRO 397 397 397 PRO PRO A . n A 1 398 LEU 398 398 398 LEU LEU A . n A 1 399 PRO 399 399 399 PRO PRO A . n A 1 400 VAL 400 400 400 VAL VAL A . n A 1 401 LEU 401 401 401 LEU LEU A . n A 1 402 ASP 402 402 402 ASP ASP A . n A 1 403 GLY 403 403 403 GLY GLY A . n A 1 404 GLY 404 404 404 GLY GLY A . n A 1 405 HIS 405 405 405 HIS HIS A . n A 1 406 LEU 406 406 406 LEU LEU A . n A 1 407 LEU 407 407 407 LEU LEU A . n A 1 408 PHE 408 408 408 PHE PHE A . n A 1 409 LEU 409 409 409 LEU LEU A . n A 1 410 ALA 410 410 410 ALA ALA A . n A 1 411 ILE 411 411 411 ILE ILE A . n A 1 412 GLU 412 412 412 GLU GLU A . n A 1 413 LYS 413 413 413 LYS LYS A . n A 1 414 ILE 414 414 414 ILE ILE A . n A 1 415 LYS 415 415 415 LYS LYS A . n A 1 416 GLY 416 416 416 GLY GLY A . n A 1 417 GLY 417 417 417 GLY GLY A . n A 1 418 PRO 418 418 418 PRO PRO A . n A 1 419 VAL 419 419 419 VAL VAL A . n A 1 420 SER 420 420 420 SER SER A . n A 1 421 GLU 421 421 421 GLU GLU A . n A 1 422 ARG 422 422 422 ARG ARG A . n A 1 423 VAL 423 423 423 VAL VAL A . n A 1 424 GLN 424 424 424 GLN GLN A . n A 1 425 ASP 425 425 425 ASP ASP A . n A 1 426 PHE 426 426 426 PHE PHE A . n A 1 427 CYS 427 427 427 CYS CYS A . n A 1 428 TYR 428 428 428 TYR TYR A . n A 1 429 ARG 429 429 429 ARG ARG A . n A 1 430 ILE 430 430 430 ILE ILE A . n A 1 431 GLY 431 431 431 GLY GLY A . n A 1 432 SER 432 432 432 SER SER A . n A 1 433 ILE 433 433 433 ILE ILE A . n A 1 434 LEU 434 434 434 LEU LEU A . n A 1 435 LEU 435 435 435 LEU LEU A . n A 1 436 VAL 436 436 436 VAL VAL A . n A 1 437 LEU 437 437 437 LEU LEU A . n A 1 438 LEU 438 438 438 LEU LEU A . n A 1 439 MET 439 439 439 MET MET A . n A 1 440 GLY 440 440 440 GLY GLY A . n A 1 441 LEU 441 441 441 LEU LEU A . n A 1 442 ALA 442 442 442 ALA ALA A . n A 1 443 LEU 443 443 443 LEU LEU A . n A 1 444 PHE 444 444 444 PHE PHE A . n A 1 445 ASN 445 445 445 ASN ASN A . n A 1 446 ASP 446 446 446 ASP ASP A . n A 1 447 PHE 447 447 447 PHE PHE A . n A 1 448 SER 448 448 ? ? ? A . n A 1 449 ARG 449 449 ? ? ? A . n A 1 450 LEU 450 450 ? ? ? A . n A 1 451 GLY 451 451 ? ? ? A . n A 1 452 THR 452 452 ? ? ? A . n A 1 453 GLU 453 453 ? ? ? A . n A 1 454 ASN 454 454 ? ? ? A . n A 1 455 LEU 455 455 ? ? ? A . n A 1 456 TYR 456 456 ? ? ? A . n A 1 457 PHE 457 457 ? ? ? A . n A 1 458 GLN 458 458 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email nogi@yokohama-cu.ac.jp _pdbx_contact_author.name_first Terukazu _pdbx_contact_author.name_last Nogi _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-8663-3519 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 501 501 ZN ZN A . C 3 BAT 1 502 601 BAT BAT A . D 2 ZN 1 503 701 ZN ZN A . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id FME _pdbx_struct_mod_residue.label_seq_id 1 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id FME _pdbx_struct_mod_residue.auth_seq_id 1 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id MET _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1200 ? 1 MORE -63 ? 1 'SSA (A^2)' 24990 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 ZN ? B ZN . ? A ZN 501 ? 1_555 NE2 ? A HIS 26 ? A HIS 26 ? 1_555 82.1 ? 2 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 ZN ? B ZN . ? A ZN 501 ? 1_555 OD1 ? A ASP 402 ? A ASP 402 ? 1_555 163.6 ? 3 NE2 ? A HIS 26 ? A HIS 26 ? 1_555 ZN ? B ZN . ? A ZN 501 ? 1_555 OD1 ? A ASP 402 ? A ASP 402 ? 1_555 111.0 ? 4 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 ZN ? B ZN . ? A ZN 501 ? 1_555 OD2 ? A ASP 402 ? A ASP 402 ? 1_555 100.9 ? 5 NE2 ? A HIS 26 ? A HIS 26 ? 1_555 ZN ? B ZN . ? A ZN 501 ? 1_555 OD2 ? A ASP 402 ? A ASP 402 ? 1_555 116.9 ? 6 OD1 ? A ASP 402 ? A ASP 402 ? 1_555 ZN ? B ZN . ? A ZN 501 ? 1_555 OD2 ? A ASP 402 ? A ASP 402 ? 1_555 64.8 ? 7 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 ZN ? B ZN . ? A ZN 501 ? 1_555 O2 ? C BAT . ? A BAT 502 ? 1_555 73.1 ? 8 NE2 ? A HIS 26 ? A HIS 26 ? 1_555 ZN ? B ZN . ? A ZN 501 ? 1_555 O2 ? C BAT . ? A BAT 502 ? 1_555 75.4 ? 9 OD1 ? A ASP 402 ? A ASP 402 ? 1_555 ZN ? B ZN . ? A ZN 501 ? 1_555 O2 ? C BAT . ? A BAT 502 ? 1_555 118.8 ? 10 OD2 ? A ASP 402 ? A ASP 402 ? 1_555 ZN ? B ZN . ? A ZN 501 ? 1_555 O2 ? C BAT . ? A BAT 502 ? 1_555 166.0 ? 11 NE2 ? A HIS 22 ? A HIS 22 ? 1_555 ZN ? B ZN . ? A ZN 501 ? 1_555 O1 ? C BAT . ? A BAT 502 ? 1_555 88.0 ? 12 NE2 ? A HIS 26 ? A HIS 26 ? 1_555 ZN ? B ZN . ? A ZN 501 ? 1_555 O1 ? C BAT . ? A BAT 502 ? 1_555 151.7 ? 13 OD1 ? A ASP 402 ? A ASP 402 ? 1_555 ZN ? B ZN . ? A ZN 501 ? 1_555 O1 ? C BAT . ? A BAT 502 ? 1_555 84.4 ? 14 OD2 ? A ASP 402 ? A ASP 402 ? 1_555 ZN ? B ZN . ? A ZN 501 ? 1_555 O1 ? C BAT . ? A BAT 502 ? 1_555 90.9 ? 15 O2 ? C BAT . ? A BAT 502 ? 1_555 ZN ? B ZN . ? A ZN 501 ? 1_555 O1 ? C BAT . ? A BAT 502 ? 1_555 76.4 ? 16 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 ZN ? D ZN . ? A ZN 503 ? 1_555 NE2 ? A HIS 87 ? A HIS 87 ? 1_555 100.2 ? 17 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 ZN ? D ZN . ? A ZN 503 ? 1_555 NE2 ? A HIS 199 ? A HIS 199 ? 1_555 71.2 ? 18 NE2 ? A HIS 87 ? A HIS 87 ? 1_555 ZN ? D ZN . ? A ZN 503 ? 1_555 NE2 ? A HIS 199 ? A HIS 199 ? 1_555 40.1 ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2022-09-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _space_group_symop.id 1 _space_group_symop.operation_xyz x,y,z # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _pdbx_entry_details.entry_id 7W6X _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 38 ? ? -98.56 -63.71 2 1 PHE A 40 ? ? -115.34 75.62 3 1 LEU A 48 ? ? -130.99 -35.15 4 1 LEU A 66 ? ? -95.13 47.67 5 1 ASN A 91 ? ? -89.21 31.71 6 1 SER A 138 ? ? -117.37 -169.78 7 1 ASP A 188 ? ? -87.14 34.39 8 1 PRO A 224 ? ? -63.62 64.88 9 1 LYS A 297 ? ? -153.69 -158.57 10 1 ARG A 319 ? ? -108.31 45.35 11 1 ASP A 352 ? ? -141.59 12.73 12 1 PRO A 397 ? ? -62.46 87.67 13 1 GLU A 421 ? ? -73.41 -78.92 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 448 ? A SER 448 2 1 Y 1 A ARG 449 ? A ARG 449 3 1 Y 1 A LEU 450 ? A LEU 450 4 1 Y 1 A GLY 451 ? A GLY 451 5 1 Y 1 A THR 452 ? A THR 452 6 1 Y 1 A GLU 453 ? A GLU 453 7 1 Y 1 A ASN 454 ? A ASN 454 8 1 Y 1 A LEU 455 ? A LEU 455 9 1 Y 1 A TYR 456 ? A TYR 456 10 1 Y 1 A PHE 457 ? A PHE 457 11 1 Y 1 A GLN 458 ? A GLN 458 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Japan Society for the Promotion of Science (JSPS)' Japan 19H03170 1 'Japan Society for the Promotion of Science (JSPS)' Japan 26291016 2 'Japan Society for the Promotion of Science (JSPS)' Japan 22370039 3 'Japan Society for the Promotion of Science (JSPS)' Japan 19687004 4 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 BAT ? ? BAT ? ? 'SUBJECT OF INVESTIGATION' ? 2 FME ? ? FME ? ? 'SUBJECT OF INVESTIGATION' ? 3 ZN ? ? ZN ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 '4-(N-HYDROXYAMINO)-2R-ISOBUTYL-2S-(2-THIENYLTHIOMETHYL)SUCCINYL-L-PHENYLALANINE-N-METHYLAMIDE' BAT # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 1' _space_group.name_Hall 'P 1' _space_group.IT_number 1 _space_group.crystal_system triclinic _space_group.id 1 #