data_7W8I # _entry.id 7W8I # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7W8I pdb_00007w8i 10.2210/pdb7w8i/pdb WWPDB D_1300026197 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7W8I _pdbx_database_status.recvd_initial_deposition_date 2021-12-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Momin, A.A.' 1 0000-0002-5058-9445 'Sandholu, A.S.' 2 0000-0001-7514-1607 'Arold, S.T.' 3 0000-0001-5278-0668 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of Zn bound human Focal Adhesion Targeting (FAT) domain of the Focal Adhesion Kinase' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Momin, A.A.' 1 0000-0002-5058-9445 primary 'Sandholu, A.S.' 2 0000-0001-7514-1607 primary 'Arold, S.T.' 3 0000-0001-5278-0668 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7W8I _cell.details ? _cell.formula_units_Z ? _cell.length_a 48.906 _cell.length_a_esd ? _cell.length_b 53.099 _cell.length_b_esd ? _cell.length_c 54.085 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7W8I _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Isoform 5 of Focal adhesion kinase 1' 18277.059 1 2.7.10.2 ? 'Focal Adhesion Targeting domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 3 water nat water 18.015 25 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;FADK 1,Focal adhesion kinase-related nonkinase,FRNK,Protein phosphatase 1 regulatory subunit 71,PPP1R71,Protein-tyrosine kinase 2,p125FAK,pp125FAK ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SSPADSYNEGVKPWRLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATV DETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQ TRPH ; _entity_poly.pdbx_seq_one_letter_code_can ;SSPADSYNEGVKPWRLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATV DETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQ TRPH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 SER n 1 3 PRO n 1 4 ALA n 1 5 ASP n 1 6 SER n 1 7 TYR n 1 8 ASN n 1 9 GLU n 1 10 GLY n 1 11 VAL n 1 12 LYS n 1 13 PRO n 1 14 TRP n 1 15 ARG n 1 16 LEU n 1 17 GLN n 1 18 PRO n 1 19 GLN n 1 20 GLU n 1 21 ILE n 1 22 SER n 1 23 PRO n 1 24 PRO n 1 25 PRO n 1 26 THR n 1 27 ALA n 1 28 ASN n 1 29 LEU n 1 30 ASP n 1 31 ARG n 1 32 SER n 1 33 ASN n 1 34 ASP n 1 35 LYS n 1 36 VAL n 1 37 TYR n 1 38 GLU n 1 39 ASN n 1 40 VAL n 1 41 THR n 1 42 GLY n 1 43 LEU n 1 44 VAL n 1 45 LYS n 1 46 ALA n 1 47 VAL n 1 48 ILE n 1 49 GLU n 1 50 MET n 1 51 SER n 1 52 SER n 1 53 LYS n 1 54 ILE n 1 55 GLN n 1 56 PRO n 1 57 ALA n 1 58 PRO n 1 59 PRO n 1 60 GLU n 1 61 GLU n 1 62 TYR n 1 63 VAL n 1 64 PRO n 1 65 MET n 1 66 VAL n 1 67 LYS n 1 68 GLU n 1 69 VAL n 1 70 GLY n 1 71 LEU n 1 72 ALA n 1 73 LEU n 1 74 ARG n 1 75 THR n 1 76 LEU n 1 77 LEU n 1 78 ALA n 1 79 THR n 1 80 VAL n 1 81 ASP n 1 82 GLU n 1 83 THR n 1 84 ILE n 1 85 PRO n 1 86 LEU n 1 87 LEU n 1 88 PRO n 1 89 ALA n 1 90 SER n 1 91 THR n 1 92 HIS n 1 93 ARG n 1 94 GLU n 1 95 ILE n 1 96 GLU n 1 97 MET n 1 98 ALA n 1 99 GLN n 1 100 LYS n 1 101 LEU n 1 102 LEU n 1 103 ASN n 1 104 SER n 1 105 ASP n 1 106 LEU n 1 107 GLY n 1 108 GLU n 1 109 LEU n 1 110 ILE n 1 111 ASN n 1 112 LYS n 1 113 MET n 1 114 LYS n 1 115 LEU n 1 116 ALA n 1 117 GLN n 1 118 GLN n 1 119 TYR n 1 120 VAL n 1 121 MET n 1 122 THR n 1 123 SER n 1 124 LEU n 1 125 GLN n 1 126 GLN n 1 127 GLU n 1 128 TYR n 1 129 LYS n 1 130 LYS n 1 131 GLN n 1 132 MET n 1 133 LEU n 1 134 THR n 1 135 ALA n 1 136 ALA n 1 137 HIS n 1 138 ALA n 1 139 LEU n 1 140 ALA n 1 141 VAL n 1 142 ASP n 1 143 ALA n 1 144 LYS n 1 145 ASN n 1 146 LEU n 1 147 LEU n 1 148 ASP n 1 149 VAL n 1 150 ILE n 1 151 ASP n 1 152 GLN n 1 153 ALA n 1 154 ARG n 1 155 LEU n 1 156 LYS n 1 157 MET n 1 158 LEU n 1 159 GLY n 1 160 GLN n 1 161 THR n 1 162 ARG n 1 163 PRO n 1 164 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 164 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PTK2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FAK1_HUMAN _struct_ref.pdbx_db_accession Q05397 _struct_ref.pdbx_db_isoform Q05397-5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SSPADSYNEGVKPWRLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATV DETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQ TRPH ; _struct_ref.pdbx_align_begin 902 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7W8I _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 164 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q05397 _struct_ref_seq.db_align_beg 902 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1065 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 892 _struct_ref_seq.pdbx_auth_seq_align_end 1055 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7W8I _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.93 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 36.22 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.05 M Zinc acetate dihydrate, 20% w/v Polyethylene glycol 3,350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-11-14 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.98011 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SOLEIL BEAMLINE PROXIMA 2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.98011 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'PROXIMA 2' _diffrn_source.pdbx_synchrotron_site SOLEIL # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7W8I _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.94 _reflns.d_resolution_low 48.91 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10806 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.4 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.8 _reflns.pdbx_Rmerge_I_obs 0.138 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 12.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.94 _reflns_shell.d_res_low 1.99 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 646 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 4.59 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.325 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] -0.700 _refine.aniso_B[1][2] -0.000 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][2] -2.019 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] 2.720 _refine.B_iso_max ? _refine.B_iso_mean 52.812 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.960 _refine.correlation_coeff_Fo_to_Fc_free 0.943 _refine.details 'Hydrogens have been used if present in the input file' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7W8I _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.943 _refine.ls_d_res_low 37.893 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10610 _refine.ls_number_reflns_R_free 529 _refine.ls_number_reflns_R_work 10081 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.815 _refine.ls_percent_reflns_R_free 4.986 _refine.ls_R_factor_all 0.228 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2625 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2261 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free 0.261 _refine.ls_wR_factor_R_work 0.223 _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1ow6 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.191 _refine.pdbx_overall_ESU_R_Free 0.169 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 6.032 _refine.overall_SU_ML 0.160 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work 0.8555 _refine.pdbx_average_fsc_free 0.8398 # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.943 _refine_hist.d_res_low 37.893 _refine_hist.number_atoms_solvent 25 _refine_hist.number_atoms_total 1056 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1029 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 0.012 1042 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 1.585 1.639 1410 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 5.259 5.000 131 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 41.508 24.889 45 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 17.642 15.000 207 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 17.347 15.000 4 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.121 0.200 142 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 742 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.226 0.200 524 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.312 0.200 726 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.165 0.200 29 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.023 0.200 2 ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? 0.321 0.200 27 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.260 0.200 3 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.113 0.200 1 ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? 4.453 4.782 527 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 6.553 7.138 657 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 6.604 5.715 515 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 9.965 8.228 753 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 12.903 90.634 4496 ? r_lrange_it ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.943 1.994 777 . 35 673 91.1197 . 0.326 . 0.390 . 0.323 . . . . . 0.314 . 20 . 0.735 0.679 'X-RAY DIFFRACTION' 1.994 2.048 780 . 39 741 100.0000 . 0.295 . 0.273 . 0.296 . . . . . 0.285 . 20 . 0.775 0.774 'X-RAY DIFFRACTION' 2.048 2.107 724 . 36 688 100.0000 . 0.286 . 0.361 . 0.282 . . . . . 0.264 . 20 . 0.797 0.772 'X-RAY DIFFRACTION' 2.107 2.172 726 . 36 690 100.0000 . 0.314 . 0.385 . 0.311 . . . . . 0.291 . 20 . 0.761 0.704 'X-RAY DIFFRACTION' 2.172 2.243 701 . 29 588 88.0171 . 0.428 . 0.439 . 0.428 . . . . . 0.406 . 20 . 0.683 0.769 'X-RAY DIFFRACTION' 2.243 2.321 686 . 32 584 89.7959 . 0.467 . 0.445 . 0.468 . . . . . 0.446 . 20 . 0.722 0.735 'X-RAY DIFFRACTION' 2.321 2.409 649 . 32 616 99.8459 . 0.234 . 0.227 . 0.235 . . . . . 0.208 . 20 . 0.887 0.905 'X-RAY DIFFRACTION' 2.409 2.507 637 . 32 605 100.0000 . 0.218 . 0.262 . 0.215 . . . . . 0.196 . 20 . 0.920 0.881 'X-RAY DIFFRACTION' 2.507 2.618 611 . 30 581 100.0000 . 0.245 . 0.279 . 0.243 . . . . . 0.220 . 20 . 0.902 0.907 'X-RAY DIFFRACTION' 2.618 2.745 587 . 30 557 100.0000 . 0.253 . 0.361 . 0.247 . . . . . 0.224 . 20 . 0.900 0.840 'X-RAY DIFFRACTION' 2.745 2.892 561 . 28 533 100.0000 . 0.243 . 0.301 . 0.239 . . . . . 0.218 . 20 . 0.906 0.901 'X-RAY DIFFRACTION' 2.892 3.067 526 . 26 500 100.0000 . 0.222 . 0.237 . 0.221 . . . . . 0.210 . 20 . 0.912 0.909 'X-RAY DIFFRACTION' 3.067 3.277 505 . 25 479 99.8020 . 0.249 . 0.412 . 0.242 . . . . . 0.234 . 20 . 0.915 0.806 'X-RAY DIFFRACTION' 3.277 3.537 466 . 24 442 100.0000 . 0.236 . 0.274 . 0.233 . . . . . 0.230 . 20 . 0.927 0.901 'X-RAY DIFFRACTION' 3.537 3.871 438 . 21 410 98.4018 . 0.207 . 0.238 . 0.206 . . . . . 0.210 . 20 . 0.954 0.952 'X-RAY DIFFRACTION' 3.871 4.323 398 . 20 378 100.0000 . 0.171 . 0.164 . 0.171 . . . . . 0.183 . 20 . 0.969 0.966 'X-RAY DIFFRACTION' 4.323 4.981 356 . 18 338 100.0000 . 0.147 . 0.168 . 0.146 . . . . . 0.160 . 20 . 0.976 0.972 'X-RAY DIFFRACTION' 4.981 6.074 309 . 15 294 100.0000 . 0.208 . 0.258 . 0.205 . . . . . 0.233 . 20 . 0.958 0.943 'X-RAY DIFFRACTION' 6.074 8.482 244 . 13 231 100.0000 . 0.165 . 0.218 . 0.162 . . . . . 0.206 . 20 . 0.977 0.950 'X-RAY DIFFRACTION' 8.482 37.893 161 . 8 153 100.0000 . 0.180 . 0.177 . 0.180 . . . . . 0.249 . 20 . 0.977 0.985 # _struct.entry_id 7W8I _struct.title 'Crystal structure of Zn bound human Focal Adhesion Targeting (FAT) domain of the Focal Adhesion Kinase' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7W8I _struct_keywords.text 'Focal adhesion kinase, Protein tyrosine kinase 2, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 34 ? SER A 52 ? ASP A 925 SER A 943 1 ? 19 HELX_P HELX_P2 AA2 PRO A 58 ? ILE A 84 ? PRO A 949 ILE A 975 1 ? 27 HELX_P HELX_P3 AA3 PRO A 85 ? LEU A 87 ? PRO A 976 LEU A 978 5 ? 3 HELX_P HELX_P4 AA4 PRO A 88 ? SER A 90 ? PRO A 979 SER A 981 5 ? 3 HELX_P HELX_P5 AA5 THR A 91 ? TYR A 119 ? THR A 982 TYR A 1010 1 ? 29 HELX_P HELX_P6 AA6 LEU A 124 ? GLY A 159 ? LEU A 1015 GLY A 1050 1 ? 36 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 49 OE1 ? ? ? 1_555 B ZN . ZN ? ? A GLU 940 A ZN 1101 3_555 ? ? ? ? ? ? ? 2.122 ? ? metalc2 metalc ? ? A GLU 68 OE2 ? ? ? 1_555 B ZN . ZN ? ? A GLU 959 A ZN 1101 3_555 ? ? ? ? ? ? ? 1.907 ? ? metalc3 metalc ? ? A HIS 92 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 983 A ZN 1101 1_555 ? ? ? ? ? ? ? 2.027 ? ? metalc4 metalc ? ? A HIS 137 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 1028 A ZN 1102 1_555 ? ? ? ? ? ? ? 2.102 ? ? metalc5 metalc ? ? A ASP 151 OD2 ? ? ? 1_555 C ZN . ZN ? ? A ASP 1042 A ZN 1102 4_455 ? ? ? ? ? ? ? 2.082 ? ? metalc6 metalc ? ? A HIS 164 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 1055 A ZN 1102 1_455 ? ? ? ? ? ? ? 2.186 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 7W8I _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.020447 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018833 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018489 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.050 ZN ? ? ? ? ? ? ? ? ? ? ? ZN+2 30 28 11.972 2.995 7.386 0.203 6.467 7.083 1.394 18.099 0.465 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 892 ? ? ? A . n A 1 2 SER 2 893 ? ? ? A . n A 1 3 PRO 3 894 ? ? ? A . n A 1 4 ALA 4 895 ? ? ? A . n A 1 5 ASP 5 896 ? ? ? A . n A 1 6 SER 6 897 ? ? ? A . n A 1 7 TYR 7 898 ? ? ? A . n A 1 8 ASN 8 899 ? ? ? A . n A 1 9 GLU 9 900 ? ? ? A . n A 1 10 GLY 10 901 ? ? ? A . n A 1 11 VAL 11 902 ? ? ? A . n A 1 12 LYS 12 903 ? ? ? A . n A 1 13 PRO 13 904 ? ? ? A . n A 1 14 TRP 14 905 ? ? ? A . n A 1 15 ARG 15 906 ? ? ? A . n A 1 16 LEU 16 907 ? ? ? A . n A 1 17 GLN 17 908 ? ? ? A . n A 1 18 PRO 18 909 ? ? ? A . n A 1 19 GLN 19 910 ? ? ? A . n A 1 20 GLU 20 911 ? ? ? A . n A 1 21 ILE 21 912 ? ? ? A . n A 1 22 SER 22 913 ? ? ? A . n A 1 23 PRO 23 914 ? ? ? A . n A 1 24 PRO 24 915 ? ? ? A . n A 1 25 PRO 25 916 ? ? ? A . n A 1 26 THR 26 917 ? ? ? A . n A 1 27 ALA 27 918 ? ? ? A . n A 1 28 ASN 28 919 ? ? ? A . n A 1 29 LEU 29 920 ? ? ? A . n A 1 30 ASP 30 921 ? ? ? A . n A 1 31 ARG 31 922 ? ? ? A . n A 1 32 SER 32 923 ? ? ? A . n A 1 33 ASN 33 924 924 ASN ASN A . n A 1 34 ASP 34 925 925 ASP ASP A . n A 1 35 LYS 35 926 926 LYS LYS A . n A 1 36 VAL 36 927 927 VAL VAL A . n A 1 37 TYR 37 928 928 TYR TYR A . n A 1 38 GLU 38 929 929 GLU GLU A . n A 1 39 ASN 39 930 930 ASN ASN A . n A 1 40 VAL 40 931 931 VAL VAL A . n A 1 41 THR 41 932 932 THR THR A . n A 1 42 GLY 42 933 933 GLY GLY A . n A 1 43 LEU 43 934 934 LEU LEU A . n A 1 44 VAL 44 935 935 VAL VAL A . n A 1 45 LYS 45 936 936 LYS LYS A . n A 1 46 ALA 46 937 937 ALA ALA A . n A 1 47 VAL 47 938 938 VAL VAL A . n A 1 48 ILE 48 939 939 ILE ILE A . n A 1 49 GLU 49 940 940 GLU GLU A . n A 1 50 MET 50 941 941 MET MET A . n A 1 51 SER 51 942 942 SER SER A . n A 1 52 SER 52 943 943 SER SER A . n A 1 53 LYS 53 944 944 LYS LYS A . n A 1 54 ILE 54 945 945 ILE ILE A . n A 1 55 GLN 55 946 946 GLN GLN A . n A 1 56 PRO 56 947 947 PRO PRO A . n A 1 57 ALA 57 948 948 ALA ALA A . n A 1 58 PRO 58 949 949 PRO PRO A . n A 1 59 PRO 59 950 950 PRO PRO A . n A 1 60 GLU 60 951 951 GLU GLU A . n A 1 61 GLU 61 952 952 GLU GLU A . n A 1 62 TYR 62 953 953 TYR TYR A . n A 1 63 VAL 63 954 954 VAL VAL A . n A 1 64 PRO 64 955 955 PRO PRO A . n A 1 65 MET 65 956 956 MET MET A . n A 1 66 VAL 66 957 957 VAL VAL A . n A 1 67 LYS 67 958 958 LYS LYS A . n A 1 68 GLU 68 959 959 GLU GLU A . n A 1 69 VAL 69 960 960 VAL VAL A . n A 1 70 GLY 70 961 961 GLY GLY A . n A 1 71 LEU 71 962 962 LEU LEU A . n A 1 72 ALA 72 963 963 ALA ALA A . n A 1 73 LEU 73 964 964 LEU LEU A . n A 1 74 ARG 74 965 965 ARG ARG A . n A 1 75 THR 75 966 966 THR THR A . n A 1 76 LEU 76 967 967 LEU LEU A . n A 1 77 LEU 77 968 968 LEU LEU A . n A 1 78 ALA 78 969 969 ALA ALA A . n A 1 79 THR 79 970 970 THR THR A . n A 1 80 VAL 80 971 971 VAL VAL A . n A 1 81 ASP 81 972 972 ASP ASP A . n A 1 82 GLU 82 973 973 GLU GLU A . n A 1 83 THR 83 974 974 THR THR A . n A 1 84 ILE 84 975 975 ILE ILE A . n A 1 85 PRO 85 976 976 PRO PRO A . n A 1 86 LEU 86 977 977 LEU LEU A . n A 1 87 LEU 87 978 978 LEU LEU A . n A 1 88 PRO 88 979 979 PRO PRO A . n A 1 89 ALA 89 980 980 ALA ALA A . n A 1 90 SER 90 981 981 SER SER A . n A 1 91 THR 91 982 982 THR THR A . n A 1 92 HIS 92 983 983 HIS HIS A . n A 1 93 ARG 93 984 984 ARG ARG A . n A 1 94 GLU 94 985 985 GLU GLU A . n A 1 95 ILE 95 986 986 ILE ILE A . n A 1 96 GLU 96 987 987 GLU GLU A . n A 1 97 MET 97 988 988 MET MET A . n A 1 98 ALA 98 989 989 ALA ALA A . n A 1 99 GLN 99 990 990 GLN GLN A . n A 1 100 LYS 100 991 991 LYS LYS A . n A 1 101 LEU 101 992 992 LEU LEU A . n A 1 102 LEU 102 993 993 LEU LEU A . n A 1 103 ASN 103 994 994 ASN ASN A . n A 1 104 SER 104 995 995 SER SER A . n A 1 105 ASP 105 996 996 ASP ASP A . n A 1 106 LEU 106 997 997 LEU LEU A . n A 1 107 GLY 107 998 998 GLY GLY A . n A 1 108 GLU 108 999 999 GLU GLU A . n A 1 109 LEU 109 1000 1000 LEU LEU A . n A 1 110 ILE 110 1001 1001 ILE ILE A . n A 1 111 ASN 111 1002 1002 ASN ASN A . n A 1 112 LYS 112 1003 1003 LYS LYS A . n A 1 113 MET 113 1004 1004 MET MET A . n A 1 114 LYS 114 1005 1005 LYS LYS A . n A 1 115 LEU 115 1006 1006 LEU LEU A . n A 1 116 ALA 116 1007 1007 ALA ALA A . n A 1 117 GLN 117 1008 1008 GLN GLN A . n A 1 118 GLN 118 1009 1009 GLN GLN A . n A 1 119 TYR 119 1010 1010 TYR TYR A . n A 1 120 VAL 120 1011 1011 VAL VAL A . n A 1 121 MET 121 1012 1012 MET MET A . n A 1 122 THR 122 1013 1013 THR THR A . n A 1 123 SER 123 1014 1014 SER SER A . n A 1 124 LEU 124 1015 1015 LEU LEU A . n A 1 125 GLN 125 1016 1016 GLN GLN A . n A 1 126 GLN 126 1017 1017 GLN GLN A . n A 1 127 GLU 127 1018 1018 GLU GLU A . n A 1 128 TYR 128 1019 1019 TYR TYR A . n A 1 129 LYS 129 1020 1020 LYS LYS A . n A 1 130 LYS 130 1021 1021 LYS LYS A . n A 1 131 GLN 131 1022 1022 GLN GLN A . n A 1 132 MET 132 1023 1023 MET MET A . n A 1 133 LEU 133 1024 1024 LEU LEU A . n A 1 134 THR 134 1025 1025 THR THR A . n A 1 135 ALA 135 1026 1026 ALA ALA A . n A 1 136 ALA 136 1027 1027 ALA ALA A . n A 1 137 HIS 137 1028 1028 HIS HIS A . n A 1 138 ALA 138 1029 1029 ALA ALA A . n A 1 139 LEU 139 1030 1030 LEU LEU A . n A 1 140 ALA 140 1031 1031 ALA ALA A . n A 1 141 VAL 141 1032 1032 VAL VAL A . n A 1 142 ASP 142 1033 1033 ASP ASP A . n A 1 143 ALA 143 1034 1034 ALA ALA A . n A 1 144 LYS 144 1035 1035 LYS LYS A . n A 1 145 ASN 145 1036 1036 ASN ASN A . n A 1 146 LEU 146 1037 1037 LEU LEU A . n A 1 147 LEU 147 1038 1038 LEU LEU A . n A 1 148 ASP 148 1039 1039 ASP ASP A . n A 1 149 VAL 149 1040 1040 VAL VAL A . n A 1 150 ILE 150 1041 1041 ILE ILE A . n A 1 151 ASP 151 1042 1042 ASP ASP A . n A 1 152 GLN 152 1043 1043 GLN GLN A . n A 1 153 ALA 153 1044 1044 ALA ALA A . n A 1 154 ARG 154 1045 1045 ARG ARG A . n A 1 155 LEU 155 1046 1046 LEU LEU A . n A 1 156 LYS 156 1047 1047 LYS LYS A . n A 1 157 MET 157 1048 1048 MET MET A . n A 1 158 LEU 158 1049 1049 LEU LEU A . n A 1 159 GLY 159 1050 1050 GLY GLY A . n A 1 160 GLN 160 1051 1051 GLN GLN A . n A 1 161 THR 161 1052 1052 THR THR A . n A 1 162 ARG 162 1053 1053 ARG ARG A . n A 1 163 PRO 163 1054 1054 PRO PRO A . n A 1 164 HIS 164 1055 1055 HIS HIS A . n # _pdbx_contact_author.id 3 _pdbx_contact_author.email stefan.arold@kaust.edu.sa _pdbx_contact_author.name_first Stefan _pdbx_contact_author.name_last Arold _pdbx_contact_author.name_mi T _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-5278-0668 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 1101 1056 ZN ZN A . C 2 ZN 1 1102 1057 ZN ZN A . D 3 HOH 1 1201 1071 HOH HOH A . D 3 HOH 2 1202 1109 HOH HOH A . D 3 HOH 3 1203 1068 HOH HOH A . D 3 HOH 4 1204 1066 HOH HOH A . D 3 HOH 5 1205 1086 HOH HOH A . D 3 HOH 6 1206 1059 HOH HOH A . D 3 HOH 7 1207 1070 HOH HOH A . D 3 HOH 8 1208 1076 HOH HOH A . D 3 HOH 9 1209 1100 HOH HOH A . D 3 HOH 10 1210 1060 HOH HOH A . D 3 HOH 11 1211 1074 HOH HOH A . D 3 HOH 12 1212 1061 HOH HOH A . D 3 HOH 13 1213 1072 HOH HOH A . D 3 HOH 14 1214 1062 HOH HOH A . D 3 HOH 15 1215 1063 HOH HOH A . D 3 HOH 16 1216 1114 HOH HOH A . D 3 HOH 17 1217 1098 HOH HOH A . D 3 HOH 18 1218 1064 HOH HOH A . D 3 HOH 19 1219 1113 HOH HOH A . D 3 HOH 20 1220 1115 HOH HOH A . D 3 HOH 21 1221 1082 HOH HOH A . D 3 HOH 22 1222 1104 HOH HOH A . D 3 HOH 23 1223 1091 HOH HOH A . D 3 HOH 24 1224 1081 HOH HOH A . D 3 HOH 25 1225 1096 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 80 ? 1 MORE -22 ? 1 'SSA (A^2)' 8120 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLU 49 ? A GLU 940 ? 1_555 ZN ? B ZN . ? A ZN 1101 ? 3_555 OE2 ? A GLU 68 ? A GLU 959 ? 1_555 124.4 ? 2 OE1 ? A GLU 49 ? A GLU 940 ? 1_555 ZN ? B ZN . ? A ZN 1101 ? 3_555 ND1 ? A HIS 92 ? A HIS 983 ? 1_555 102.9 ? 3 OE2 ? A GLU 68 ? A GLU 959 ? 1_555 ZN ? B ZN . ? A ZN 1101 ? 3_555 ND1 ? A HIS 92 ? A HIS 983 ? 1_555 42.1 ? 4 ND1 ? A HIS 137 ? A HIS 1028 ? 1_555 ZN ? C ZN . ? A ZN 1102 ? 1_555 OD2 ? A ASP 151 ? A ASP 1042 ? 1_555 7.6 ? 5 ND1 ? A HIS 137 ? A HIS 1028 ? 1_555 ZN ? C ZN . ? A ZN 1102 ? 1_555 NE2 ? A HIS 164 ? A HIS 1055 ? 1_555 9.8 ? 6 OD2 ? A ASP 151 ? A ASP 1042 ? 1_555 ZN ? C ZN . ? A ZN 1102 ? 1_555 NE2 ? A HIS 164 ? A HIS 1055 ? 1_555 12.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-12-21 2 'Structure model' 1 1 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 'Version Jan 31, 2020' 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.4 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MoRDa ? ? ? 1.4.01 4 # _pdbx_entry_details.entry_id 7W8I _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 947 ? ? -90.99 48.01 2 1 THR A 1013 ? ? -118.24 -167.92 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 892 ? A SER 1 2 1 Y 1 A SER 893 ? A SER 2 3 1 Y 1 A PRO 894 ? A PRO 3 4 1 Y 1 A ALA 895 ? A ALA 4 5 1 Y 1 A ASP 896 ? A ASP 5 6 1 Y 1 A SER 897 ? A SER 6 7 1 Y 1 A TYR 898 ? A TYR 7 8 1 Y 1 A ASN 899 ? A ASN 8 9 1 Y 1 A GLU 900 ? A GLU 9 10 1 Y 1 A GLY 901 ? A GLY 10 11 1 Y 1 A VAL 902 ? A VAL 11 12 1 Y 1 A LYS 903 ? A LYS 12 13 1 Y 1 A PRO 904 ? A PRO 13 14 1 Y 1 A TRP 905 ? A TRP 14 15 1 Y 1 A ARG 906 ? A ARG 15 16 1 Y 1 A LEU 907 ? A LEU 16 17 1 Y 1 A GLN 908 ? A GLN 17 18 1 Y 1 A PRO 909 ? A PRO 18 19 1 Y 1 A GLN 910 ? A GLN 19 20 1 Y 1 A GLU 911 ? A GLU 20 21 1 Y 1 A ILE 912 ? A ILE 21 22 1 Y 1 A SER 913 ? A SER 22 23 1 Y 1 A PRO 914 ? A PRO 23 24 1 Y 1 A PRO 915 ? A PRO 24 25 1 Y 1 A PRO 916 ? A PRO 25 26 1 Y 1 A THR 917 ? A THR 26 27 1 Y 1 A ALA 918 ? A ALA 27 28 1 Y 1 A ASN 919 ? A ASN 28 29 1 Y 1 A LEU 920 ? A LEU 29 30 1 Y 1 A ASP 921 ? A ASP 30 31 1 Y 1 A ARG 922 ? A ARG 31 32 1 Y 1 A SER 923 ? A SER 32 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PRO N N N N 236 PRO CA C N S 237 PRO C C N N 238 PRO O O N N 239 PRO CB C N N 240 PRO CG C N N 241 PRO CD C N N 242 PRO OXT O N N 243 PRO H H N N 244 PRO HA H N N 245 PRO HB2 H N N 246 PRO HB3 H N N 247 PRO HG2 H N N 248 PRO HG3 H N N 249 PRO HD2 H N N 250 PRO HD3 H N N 251 PRO HXT H N N 252 SER N N N N 253 SER CA C N S 254 SER C C N N 255 SER O O N N 256 SER CB C N N 257 SER OG O N N 258 SER OXT O N N 259 SER H H N N 260 SER H2 H N N 261 SER HA H N N 262 SER HB2 H N N 263 SER HB3 H N N 264 SER HG H N N 265 SER HXT H N N 266 THR N N N N 267 THR CA C N S 268 THR C C N N 269 THR O O N N 270 THR CB C N R 271 THR OG1 O N N 272 THR CG2 C N N 273 THR OXT O N N 274 THR H H N N 275 THR H2 H N N 276 THR HA H N N 277 THR HB H N N 278 THR HG1 H N N 279 THR HG21 H N N 280 THR HG22 H N N 281 THR HG23 H N N 282 THR HXT H N N 283 TRP N N N N 284 TRP CA C N S 285 TRP C C N N 286 TRP O O N N 287 TRP CB C N N 288 TRP CG C Y N 289 TRP CD1 C Y N 290 TRP CD2 C Y N 291 TRP NE1 N Y N 292 TRP CE2 C Y N 293 TRP CE3 C Y N 294 TRP CZ2 C Y N 295 TRP CZ3 C Y N 296 TRP CH2 C Y N 297 TRP OXT O N N 298 TRP H H N N 299 TRP H2 H N N 300 TRP HA H N N 301 TRP HB2 H N N 302 TRP HB3 H N N 303 TRP HD1 H N N 304 TRP HE1 H N N 305 TRP HE3 H N N 306 TRP HZ2 H N N 307 TRP HZ3 H N N 308 TRP HH2 H N N 309 TRP HXT H N N 310 TYR N N N N 311 TYR CA C N S 312 TYR C C N N 313 TYR O O N N 314 TYR CB C N N 315 TYR CG C Y N 316 TYR CD1 C Y N 317 TYR CD2 C Y N 318 TYR CE1 C Y N 319 TYR CE2 C Y N 320 TYR CZ C Y N 321 TYR OH O N N 322 TYR OXT O N N 323 TYR H H N N 324 TYR H2 H N N 325 TYR HA H N N 326 TYR HB2 H N N 327 TYR HB3 H N N 328 TYR HD1 H N N 329 TYR HD2 H N N 330 TYR HE1 H N N 331 TYR HE2 H N N 332 TYR HH H N N 333 TYR HXT H N N 334 VAL N N N N 335 VAL CA C N S 336 VAL C C N N 337 VAL O O N N 338 VAL CB C N N 339 VAL CG1 C N N 340 VAL CG2 C N N 341 VAL OXT O N N 342 VAL H H N N 343 VAL H2 H N N 344 VAL HA H N N 345 VAL HB H N N 346 VAL HG11 H N N 347 VAL HG12 H N N 348 VAL HG13 H N N 349 VAL HG21 H N N 350 VAL HG22 H N N 351 VAL HG23 H N N 352 VAL HXT H N N 353 ZN ZN ZN N N 354 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PRO N CA sing N N 224 PRO N CD sing N N 225 PRO N H sing N N 226 PRO CA C sing N N 227 PRO CA CB sing N N 228 PRO CA HA sing N N 229 PRO C O doub N N 230 PRO C OXT sing N N 231 PRO CB CG sing N N 232 PRO CB HB2 sing N N 233 PRO CB HB3 sing N N 234 PRO CG CD sing N N 235 PRO CG HG2 sing N N 236 PRO CG HG3 sing N N 237 PRO CD HD2 sing N N 238 PRO CD HD3 sing N N 239 PRO OXT HXT sing N N 240 SER N CA sing N N 241 SER N H sing N N 242 SER N H2 sing N N 243 SER CA C sing N N 244 SER CA CB sing N N 245 SER CA HA sing N N 246 SER C O doub N N 247 SER C OXT sing N N 248 SER CB OG sing N N 249 SER CB HB2 sing N N 250 SER CB HB3 sing N N 251 SER OG HG sing N N 252 SER OXT HXT sing N N 253 THR N CA sing N N 254 THR N H sing N N 255 THR N H2 sing N N 256 THR CA C sing N N 257 THR CA CB sing N N 258 THR CA HA sing N N 259 THR C O doub N N 260 THR C OXT sing N N 261 THR CB OG1 sing N N 262 THR CB CG2 sing N N 263 THR CB HB sing N N 264 THR OG1 HG1 sing N N 265 THR CG2 HG21 sing N N 266 THR CG2 HG22 sing N N 267 THR CG2 HG23 sing N N 268 THR OXT HXT sing N N 269 TRP N CA sing N N 270 TRP N H sing N N 271 TRP N H2 sing N N 272 TRP CA C sing N N 273 TRP CA CB sing N N 274 TRP CA HA sing N N 275 TRP C O doub N N 276 TRP C OXT sing N N 277 TRP CB CG sing N N 278 TRP CB HB2 sing N N 279 TRP CB HB3 sing N N 280 TRP CG CD1 doub Y N 281 TRP CG CD2 sing Y N 282 TRP CD1 NE1 sing Y N 283 TRP CD1 HD1 sing N N 284 TRP CD2 CE2 doub Y N 285 TRP CD2 CE3 sing Y N 286 TRP NE1 CE2 sing Y N 287 TRP NE1 HE1 sing N N 288 TRP CE2 CZ2 sing Y N 289 TRP CE3 CZ3 doub Y N 290 TRP CE3 HE3 sing N N 291 TRP CZ2 CH2 doub Y N 292 TRP CZ2 HZ2 sing N N 293 TRP CZ3 CH2 sing Y N 294 TRP CZ3 HZ3 sing N N 295 TRP CH2 HH2 sing N N 296 TRP OXT HXT sing N N 297 TYR N CA sing N N 298 TYR N H sing N N 299 TYR N H2 sing N N 300 TYR CA C sing N N 301 TYR CA CB sing N N 302 TYR CA HA sing N N 303 TYR C O doub N N 304 TYR C OXT sing N N 305 TYR CB CG sing N N 306 TYR CB HB2 sing N N 307 TYR CB HB3 sing N N 308 TYR CG CD1 doub Y N 309 TYR CG CD2 sing Y N 310 TYR CD1 CE1 sing Y N 311 TYR CD1 HD1 sing N N 312 TYR CD2 CE2 doub Y N 313 TYR CD2 HD2 sing N N 314 TYR CE1 CZ doub Y N 315 TYR CE1 HE1 sing N N 316 TYR CE2 CZ sing Y N 317 TYR CE2 HE2 sing N N 318 TYR CZ OH sing N N 319 TYR OH HH sing N N 320 TYR OXT HXT sing N N 321 VAL N CA sing N N 322 VAL N H sing N N 323 VAL N H2 sing N N 324 VAL CA C sing N N 325 VAL CA CB sing N N 326 VAL CA HA sing N N 327 VAL C O doub N N 328 VAL C OXT sing N N 329 VAL CB CG1 sing N N 330 VAL CB CG2 sing N N 331 VAL CB HB sing N N 332 VAL CG1 HG11 sing N N 333 VAL CG1 HG12 sing N N 334 VAL CG1 HG13 sing N N 335 VAL CG2 HG21 sing N N 336 VAL CG2 HG22 sing N N 337 VAL CG2 HG23 sing N N 338 VAL OXT HXT sing N N 339 # _pdbx_audit_support.funding_organization 'King Abdullah University of Science and Technology' _pdbx_audit_support.country 'Saudi Arabia' _pdbx_audit_support.grant_number URF/1/2602-01-01 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ZN _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ZN _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1OW6 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #