data_7W8Z # _entry.id 7W8Z # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.370 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7W8Z pdb_00007w8z 10.2210/pdb7w8z/pdb WWPDB D_1300026219 ? ? BMRB 36461 ? ? # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structures of a disulfide-rich peptide designed through sequence grafting' _pdbx_database_related.db_id 36461 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7W8Z _pdbx_database_status.recvd_initial_deposition_date 2021-12-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Fan, S.H.' 1 ? 'Wu, Y.P.' 2 ? 'Wu, C.L.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Chem Sci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2041-6520 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 13 _citation.language ? _citation.page_first 7780 _citation.page_last 7789 _citation.title 'Structure-guided design of CPPC-paired disulfide-rich peptide libraries for ligand and drug discovery.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1039/d2sc00924b _citation.pdbx_database_id_PubMed 35865895 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wu, Y.' 1 ? primary 'Fan, S.' 2 ? primary 'Dong, M.' 3 ? primary 'Li, J.' 4 ? primary 'Kong, C.' 5 ? primary 'Zhuang, J.' 6 ? primary 'Meng, X.' 7 ? primary 'Lu, S.' 8 ? primary 'Zhao, Y.' 9 ? primary 'Wu, C.' 10 0000-0003-2946-7299 # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description drp4 _entity.formula_weight 4122.790 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code SCPPCHGRPTCTKPGDNATPEKLAKYQACWELLTCPPC _entity_poly.pdbx_seq_one_letter_code_can SCPPCHGRPTCTKPGDNATPEKLAKYQACWELLTCPPC _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 CYS n 1 3 PRO n 1 4 PRO n 1 5 CYS n 1 6 HIS n 1 7 GLY n 1 8 ARG n 1 9 PRO n 1 10 THR n 1 11 CYS n 1 12 THR n 1 13 LYS n 1 14 PRO n 1 15 GLY n 1 16 ASP n 1 17 ASN n 1 18 ALA n 1 19 THR n 1 20 PRO n 1 21 GLU n 1 22 LYS n 1 23 LEU n 1 24 ALA n 1 25 LYS n 1 26 TYR n 1 27 GLN n 1 28 ALA n 1 29 CYS n 1 30 TRP n 1 31 GLU n 1 32 LEU n 1 33 LEU n 1 34 THR n 1 35 CYS n 1 36 PRO n 1 37 PRO n 1 38 CYS n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 38 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7W8Z _struct_ref.pdbx_db_accession 7W8Z _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7W8Z _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 38 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7W8Z _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 38 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 38 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-13C HSQC' 1 anisotropic 2 1 1 '2D 1H-15N HSQC' 1 anisotropic 3 1 1 '2D 1H-1H NOESY' 1 anisotropic 4 1 1 '2D 1H-1H TOCSY' 1 anisotropic 5 1 1 '2D 1H-1H COSY' 1 anisotropic # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label condition _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM drp4, 40% perdeuterated acetonitrile and 60% H2O' _pdbx_nmr_sample_details.solvent_system '40% perdeuterated acetonitrile and 60% H2O' _pdbx_nmr_sample_details.label drp4 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 850 _pdbx_nmr_spectrometer.details ? # _pdbx_nmr_refine.entry_id 7W8Z _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 7W8Z _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7W8Z _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS ? 'Brunger A. T. et.al.' 2 'structure calculation' ARIA ? ;Linge, O'Donoghue and Nilges ; 3 'chemical shift assignment' NMRFAM-SPARKY ? 'Lee W, Tonelli M, Markley JL' 4 processing NMRDraw ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 5 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7W8Z _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7W8Z _struct.title 'Solution structures of a disulfide-rich peptide designed through sequence grafting' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7W8Z _struct_keywords.text 'disulfide-rich peptide, alpha helix, PEPTIDE BINDING PROTEIN' _struct_keywords.pdbx_keywords 'PEPTIDE BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 20 ? LYS A 22 ? PRO A 20 LYS A 22 5 ? 3 HELX_P HELX_P2 AA2 LEU A 23 ? LEU A 32 ? LEU A 23 LEU A 32 1 ? 10 HELX_P HELX_P3 AA3 LEU A 33 ? CYS A 35 ? LEU A 33 CYS A 35 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 2 SG ? ? ? 1_555 A CYS 35 SG ? ? A CYS 2 A CYS 35 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf2 disulf ? ? A CYS 5 SG ? ? ? 1_555 A CYS 38 SG ? ? A CYS 5 A CYS 38 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf3 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 29 SG ? ? A CYS 11 A CYS 29 1_555 ? ? ? ? ? ? ? 2.030 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 7W8Z _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 CYS 2 2 2 CYS CYS A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 PRO 4 4 4 PRO PRO A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 HIS 6 6 6 HIS HIS A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 CYS 29 29 29 CYS CYS A . n A 1 30 TRP 30 30 30 TRP TRP A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 CYS 38 38 38 CYS CYS A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email chlwu@xmu.edu.cn _pdbx_contact_author.name_first chuanliu _pdbx_contact_author.name_last Wu _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2946-7299 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-06-08 2 'Structure model' 1 1 2022-08-03 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_id_ISSN' 2 2 'Structure model' '_citation.journal_volume' 3 2 'Structure model' '_citation.page_first' 4 2 'Structure model' '_citation.page_last' 5 2 'Structure model' '_citation.pdbx_database_id_PubMed' 6 2 'Structure model' '_citation.title' 7 2 'Structure model' '_citation_author.identifier_ORCID' 8 2 'Structure model' '_citation_author.name' 9 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component drp4 _pdbx_nmr_exptl_sample.concentration 1 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundance' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 5 ? ? -106.74 48.49 2 1 CYS A 11 ? ? 30.87 61.82 3 1 THR A 19 ? ? -135.03 -52.33 4 1 PRO A 20 ? ? -67.60 -172.73 5 1 GLU A 21 ? ? -47.48 -12.60 6 2 THR A 19 ? ? -128.22 -55.86 7 2 PRO A 20 ? ? -69.78 -174.51 8 2 GLU A 21 ? ? -49.54 -10.62 9 3 CYS A 11 ? ? -55.12 102.62 10 3 THR A 19 ? ? -139.61 -52.27 11 3 PRO A 20 ? ? -66.87 -173.88 12 4 CYS A 11 ? ? -63.69 84.61 13 4 THR A 19 ? ? -155.86 -55.27 14 4 PRO A 20 ? ? -61.02 -170.59 15 4 GLU A 21 ? ? -43.75 -12.75 16 5 THR A 19 ? ? -134.14 -53.08 17 5 GLU A 21 ? ? -47.53 -13.65 18 6 CYS A 11 ? ? -55.77 109.34 19 6 THR A 19 ? ? -127.76 -52.22 20 6 GLU A 21 ? ? -49.63 -11.59 21 7 CYS A 11 ? ? -50.03 100.44 22 7 THR A 19 ? ? -123.48 -53.55 23 7 GLU A 21 ? ? -48.92 -11.73 24 8 THR A 19 ? ? -152.22 -50.76 25 8 PRO A 20 ? ? -62.71 -168.85 26 8 GLU A 21 ? ? -42.82 -12.04 27 9 CYS A 11 ? ? -67.96 91.42 28 9 THR A 19 ? ? -127.89 -54.05 29 9 GLU A 21 ? ? -46.56 -12.71 30 10 HIS A 6 ? ? -93.92 37.41 31 10 CYS A 11 ? ? -44.45 104.23 32 10 THR A 19 ? ? -158.50 -52.74 33 10 PRO A 20 ? ? -54.84 -171.47 34 10 GLU A 21 ? ? -44.70 -12.80 35 11 HIS A 6 ? ? -94.54 56.64 36 11 CYS A 11 ? ? -81.45 38.92 37 11 THR A 19 ? ? -154.55 -53.00 38 11 PRO A 20 ? ? -66.15 -171.89 39 11 GLU A 21 ? ? -44.24 -13.21 40 12 HIS A 6 ? ? -99.25 55.90 41 12 THR A 19 ? ? -131.76 -35.15 42 12 GLU A 21 ? ? -43.83 -12.88 43 13 CYS A 11 ? ? -53.31 102.09 44 13 THR A 12 ? ? -142.94 -21.78 45 13 THR A 19 ? ? -141.96 -57.90 46 13 PRO A 20 ? ? -61.18 -167.75 47 13 GLU A 21 ? ? -42.27 -13.37 48 14 CYS A 11 ? ? 33.57 76.46 49 14 THR A 19 ? ? -138.00 -56.15 50 14 PRO A 20 ? ? -60.77 -171.93 51 14 GLU A 21 ? ? -44.74 -12.07 52 15 CYS A 11 ? ? -57.39 101.61 53 15 THR A 19 ? ? -135.70 -35.59 54 15 GLU A 21 ? ? -43.42 -14.14 # _pdbx_audit_support.funding_organization 'Other government' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 21822404 _pdbx_audit_support.ordinal 1 # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details ? #