data_7WCG # _entry.id 7WCG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7WCG pdb_00007wcg 10.2210/pdb7wcg/pdb WWPDB D_1300026121 ? ? BMRB 50523 ? 10.13018/BMR50523 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-06-08 2 'Structure model' 1 1 2022-06-15 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' Other 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' pdbx_database_status 3 4 'Structure model' chem_comp_atom 4 4 'Structure model' chem_comp_bond 5 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7WCG _pdbx_database_status.recvd_initial_deposition_date 2021-12-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 50523 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email cjpark@gist.ac.kr _pdbx_contact_author.name_first Chin-Ju _pdbx_contact_author.name_last Park _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-7750-1554 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Yang, M.J.' 1 ? 'Park, C.' 2 0000-0002-7750-1554 'Lee, W.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Int J Mol Sci' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1422-0067 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 23 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'NMR Structure and Biophysical Characterization of Thermophilic Single-Stranded DNA Binding Protein from Sulfolobus Solfataricus .' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/ijms23063099 _citation.pdbx_database_id_PubMed 35328522 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yang, M.J.' 1 ? primary 'Kim, J.' 2 ? primary 'Lee, Y.' 3 ? primary 'Lee, W.' 4 ? primary 'Park, C.J.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Single-stranded DNA binding protein Ssb' _entity.formula_weight 14162.727 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name SSB # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEEKVGNLKPNMESVNVTVRVLEASEARQIQTKNGVRTISEAIVGDETGRVKLTLWGKHAGSIKEGQVVKIENAWTTAFK GQVQLNAGSKTKIAEASEDGFPESSQIPENTPTAENLYFQSGSHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MEEKVGNLKPNMESVNVTVRVLEASEARQIQTKNGVRTISEAIVGDETGRVKLTLWGKHAGSIKEGQVVKIENAWTTAFK GQVQLNAGSKTKIAEASEDGFPESSQIPENTPTAENLYFQSGSHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 GLU n 1 4 LYS n 1 5 VAL n 1 6 GLY n 1 7 ASN n 1 8 LEU n 1 9 LYS n 1 10 PRO n 1 11 ASN n 1 12 MET n 1 13 GLU n 1 14 SER n 1 15 VAL n 1 16 ASN n 1 17 VAL n 1 18 THR n 1 19 VAL n 1 20 ARG n 1 21 VAL n 1 22 LEU n 1 23 GLU n 1 24 ALA n 1 25 SER n 1 26 GLU n 1 27 ALA n 1 28 ARG n 1 29 GLN n 1 30 ILE n 1 31 GLN n 1 32 THR n 1 33 LYS n 1 34 ASN n 1 35 GLY n 1 36 VAL n 1 37 ARG n 1 38 THR n 1 39 ILE n 1 40 SER n 1 41 GLU n 1 42 ALA n 1 43 ILE n 1 44 VAL n 1 45 GLY n 1 46 ASP n 1 47 GLU n 1 48 THR n 1 49 GLY n 1 50 ARG n 1 51 VAL n 1 52 LYS n 1 53 LEU n 1 54 THR n 1 55 LEU n 1 56 TRP n 1 57 GLY n 1 58 LYS n 1 59 HIS n 1 60 ALA n 1 61 GLY n 1 62 SER n 1 63 ILE n 1 64 LYS n 1 65 GLU n 1 66 GLY n 1 67 GLN n 1 68 VAL n 1 69 VAL n 1 70 LYS n 1 71 ILE n 1 72 GLU n 1 73 ASN n 1 74 ALA n 1 75 TRP n 1 76 THR n 1 77 THR n 1 78 ALA n 1 79 PHE n 1 80 LYS n 1 81 GLY n 1 82 GLN n 1 83 VAL n 1 84 GLN n 1 85 LEU n 1 86 ASN n 1 87 ALA n 1 88 GLY n 1 89 SER n 1 90 LYS n 1 91 THR n 1 92 LYS n 1 93 ILE n 1 94 ALA n 1 95 GLU n 1 96 ALA n 1 97 SER n 1 98 GLU n 1 99 ASP n 1 100 GLY n 1 101 PHE n 1 102 PRO n 1 103 GLU n 1 104 SER n 1 105 SER n 1 106 GLN n 1 107 ILE n 1 108 PRO n 1 109 GLU n 1 110 ASN n 1 111 THR n 1 112 PRO n 1 113 THR n 1 114 ALA n 1 115 GLU n 1 116 ASN n 1 117 LEU n 1 118 TYR n 1 119 PHE n 1 120 GLN n 1 121 SER n 1 122 GLY n 1 123 SER n 1 124 HIS n 1 125 HIS n 1 126 HIS n 1 127 HIS n 1 128 HIS n 1 129 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 129 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ssb _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain P2 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Saccharolobus solfataricus P2' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 273057 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 PRO 10 10 10 PRO PRO A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 SER 14 14 14 SER SER A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 THR 38 38 38 THR THR A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 TRP 56 56 56 TRP TRP A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 TRP 75 75 75 TRP TRP A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 PHE 79 79 79 PHE PHE A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 ALA 94 94 94 ALA ALA A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 ASP 99 99 99 ASP ASP A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 PRO 102 102 102 PRO PRO A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 GLN 106 106 106 GLN GLN A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 PRO 112 112 112 PRO PRO A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 ASN 116 116 116 ASN ASN A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 TYR 118 118 118 TYR TYR A . n A 1 119 PHE 119 119 119 PHE PHE A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 HIS 124 124 124 HIS HIS A . n A 1 125 HIS 125 125 ? ? ? A . n A 1 126 HIS 126 126 ? ? ? A . n A 1 127 HIS 127 127 ? ? ? A . n A 1 128 HIS 128 128 ? ? ? A . n A 1 129 HIS 129 129 ? ? ? A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7WCG _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7WCG _struct.title 'Single-Stranded DNA binding protein of Sulfolobus Solfataricus structure at high-temperature' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7WCG _struct_keywords.text 'OB-fold, Hyperthermophilic, Structure at high-temperature, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SSB_SACS2 _struct_ref.pdbx_db_accession Q97W73 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEEKVGNLKPNMESVNVTVRVLEASEARQIQTKNGVRTISEAIVGDETGRVKLTLWGKHAGSIKEGQVVKIENAWTTAFK GQVQLNAGSKTKIAEASEDGFPESSQIPENTPTA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7WCG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 114 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q97W73 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 114 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 114 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7WCG GLU A 115 ? UNP Q97W73 ? ? 'expression tag' 115 1 1 7WCG ASN A 116 ? UNP Q97W73 ? ? 'expression tag' 116 2 1 7WCG LEU A 117 ? UNP Q97W73 ? ? 'expression tag' 117 3 1 7WCG TYR A 118 ? UNP Q97W73 ? ? 'expression tag' 118 4 1 7WCG PHE A 119 ? UNP Q97W73 ? ? 'expression tag' 119 5 1 7WCG GLN A 120 ? UNP Q97W73 ? ? 'expression tag' 120 6 1 7WCG SER A 121 ? UNP Q97W73 ? ? 'expression tag' 121 7 1 7WCG GLY A 122 ? UNP Q97W73 ? ? 'expression tag' 122 8 1 7WCG SER A 123 ? UNP Q97W73 ? ? 'expression tag' 123 9 1 7WCG HIS A 124 ? UNP Q97W73 ? ? 'expression tag' 124 10 1 7WCG HIS A 125 ? UNP Q97W73 ? ? 'expression tag' 125 11 1 7WCG HIS A 126 ? UNP Q97W73 ? ? 'expression tag' 126 12 1 7WCG HIS A 127 ? UNP Q97W73 ? ? 'expression tag' 127 13 1 7WCG HIS A 128 ? UNP Q97W73 ? ? 'expression tag' 128 14 1 7WCG HIS A 129 ? UNP Q97W73 ? ? 'expression tag' 129 15 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id GLY _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 57 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id SER _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 62 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLY _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 57 _struct_conf.end_auth_comp_id SER _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 62 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 28 ? THR A 32 ? ARG A 28 THR A 32 AA1 2 GLY A 35 ? GLY A 45 ? GLY A 35 GLY A 45 AA1 3 ARG A 50 ? TRP A 56 ? ARG A 50 TRP A 56 AA1 4 GLN A 82 ? ALA A 87 ? GLN A 82 ALA A 87 AA1 5 TRP A 75 ? PHE A 79 ? TRP A 75 PHE A 79 AA2 1 ARG A 28 ? THR A 32 ? ARG A 28 THR A 32 AA2 2 GLY A 35 ? GLY A 45 ? GLY A 35 GLY A 45 AA2 3 VAL A 17 ? ALA A 24 ? VAL A 17 ALA A 24 AA2 4 VAL A 68 ? GLU A 72 ? VAL A 68 GLU A 72 AA2 5 LYS A 92 ? ALA A 94 ? LYS A 92 ALA A 94 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ARG A 28 ? N ARG A 28 O ILE A 39 ? O ILE A 39 AA1 2 3 N ALA A 42 ? N ALA A 42 O LEU A 53 ? O LEU A 53 AA1 3 4 N THR A 54 ? N THR A 54 O LEU A 85 ? O LEU A 85 AA1 4 5 O ASN A 86 ? O ASN A 86 N TRP A 75 ? N TRP A 75 AA2 1 2 N ARG A 28 ? N ARG A 28 O ILE A 39 ? O ILE A 39 AA2 2 3 O ILE A 43 ? O ILE A 43 N GLU A 23 ? N GLU A 23 AA2 3 4 N VAL A 17 ? N VAL A 17 O ILE A 71 ? O ILE A 71 AA2 4 5 N LYS A 70 ? N LYS A 70 O ALA A 94 ? O ALA A 94 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 8 ? ? -47.78 169.54 2 1 ASP A 46 ? ? 179.99 -43.24 3 1 THR A 48 ? ? -147.53 -32.51 4 1 GLU A 103 ? ? 179.44 163.31 5 1 LEU A 117 ? ? 63.75 131.85 6 2 LEU A 8 ? ? -54.67 179.18 7 2 ASP A 46 ? ? 174.17 -39.84 8 2 THR A 48 ? ? -149.56 -46.25 9 2 LYS A 90 ? ? 56.05 13.56 10 2 GLU A 103 ? ? -156.24 -47.62 11 2 ASN A 110 ? ? -172.60 16.87 12 2 PHE A 119 ? ? -170.79 -66.97 13 3 LEU A 8 ? ? -53.29 170.52 14 3 ASP A 46 ? ? 177.91 -32.21 15 3 THR A 48 ? ? -144.20 -47.29 16 4 LEU A 8 ? ? -54.66 177.80 17 4 ASP A 46 ? ? 178.02 -46.01 18 4 THR A 48 ? ? -139.37 -46.06 19 4 PRO A 102 ? ? -91.70 50.69 20 4 LEU A 117 ? ? -167.53 24.32 21 5 GLU A 2 ? ? 54.90 81.50 22 5 LEU A 8 ? ? -49.52 172.60 23 5 ASP A 46 ? ? 179.62 -42.90 24 5 THR A 48 ? ? -145.47 -47.09 25 5 GLU A 103 ? ? -152.06 -37.80 26 5 ASN A 110 ? ? -106.56 -72.99 27 5 GLN A 120 ? ? 51.60 -177.40 28 5 SER A 123 ? ? 54.18 -177.01 29 6 LEU A 8 ? ? -51.89 177.70 30 6 ASP A 46 ? ? 175.22 -38.03 31 6 THR A 48 ? ? -150.16 -47.62 32 6 LYS A 90 ? ? -176.40 76.51 33 6 GLU A 103 ? ? -150.61 -37.12 34 6 ASN A 110 ? ? -163.44 10.98 35 6 GLU A 115 ? ? 54.04 98.03 36 6 GLN A 120 ? ? 61.55 149.10 37 7 ASP A 46 ? ? 179.45 -41.31 38 7 THR A 48 ? ? -144.44 -46.46 39 7 LYS A 90 ? ? -173.13 79.64 40 7 GLU A 103 ? ? -149.17 -26.26 41 7 ILE A 107 ? ? -54.40 109.23 42 7 ASN A 110 ? ? -98.68 -63.24 43 8 LEU A 8 ? ? -50.17 174.34 44 8 ASP A 46 ? ? -179.25 -43.34 45 8 THR A 48 ? ? -150.01 -47.71 46 8 GLU A 103 ? ? -172.75 -57.67 47 8 ASN A 110 ? ? -174.55 -53.00 48 8 GLU A 115 ? ? 64.02 132.81 49 8 LEU A 117 ? ? -174.46 126.25 50 8 TYR A 118 ? ? -153.73 -37.72 51 9 LEU A 8 ? ? -51.98 175.58 52 9 ASP A 46 ? ? 175.07 -43.93 53 9 THR A 48 ? ? -148.56 -46.57 54 9 GLU A 103 ? ? 172.74 -158.88 55 9 SER A 104 ? ? -58.36 -9.99 56 9 ASN A 110 ? ? -150.61 -67.43 57 9 TYR A 118 ? ? -126.04 -60.83 58 9 PHE A 119 ? ? 58.49 -88.17 59 10 GLU A 2 ? ? 55.57 100.38 60 10 LEU A 8 ? ? -52.06 174.26 61 10 ASP A 46 ? ? 178.36 -42.83 62 10 THR A 48 ? ? -146.98 -33.14 63 10 LYS A 90 ? ? -148.70 33.25 64 10 PRO A 102 ? ? -53.68 -73.38 65 10 GLN A 120 ? ? 50.56 -175.22 66 11 GLU A 2 ? ? 57.08 170.26 67 11 ASP A 46 ? ? -179.71 -38.16 68 11 THR A 48 ? ? -148.17 -45.44 69 11 LYS A 90 ? ? 58.34 14.32 70 11 GLU A 103 ? ? -122.98 -60.02 71 11 ILE A 107 ? ? -52.77 107.91 72 11 ASN A 110 ? ? -109.08 -79.87 73 11 GLU A 115 ? ? -172.67 95.29 74 11 TYR A 118 ? ? -176.62 -46.51 75 12 ASP A 46 ? ? -179.06 -46.27 76 12 THR A 48 ? ? -148.58 -33.65 77 12 GLN A 120 ? ? 60.57 112.79 78 13 ASP A 46 ? ? 179.97 -46.75 79 13 THR A 48 ? ? -148.16 -28.41 80 13 LYS A 90 ? ? -174.89 90.27 81 13 GLU A 103 ? ? 178.12 157.78 82 13 TYR A 118 ? ? 59.40 172.58 83 13 GLN A 120 ? ? 55.04 97.03 84 14 LEU A 8 ? ? -55.64 178.18 85 14 ASP A 46 ? ? 179.46 -47.37 86 14 THR A 48 ? ? -148.61 -48.46 87 14 GLU A 103 ? ? -123.88 -60.90 88 14 ASN A 110 ? ? -167.96 2.77 89 14 TYR A 118 ? ? 56.49 173.94 90 14 GLN A 120 ? ? 51.76 -176.26 91 15 ASP A 46 ? ? 179.04 -47.55 92 15 THR A 48 ? ? -144.42 -46.91 93 15 GLU A 103 ? ? 167.70 172.94 94 15 PHE A 119 ? ? -147.81 -61.02 95 16 ASP A 46 ? ? -179.97 -38.22 96 16 THR A 48 ? ? -151.67 -43.99 97 16 GLU A 103 ? ? -157.64 -54.74 98 16 ASN A 110 ? ? -170.62 -51.21 99 16 ASN A 116 ? ? -126.58 -65.42 100 16 TYR A 118 ? ? 53.18 178.17 101 16 SER A 121 ? ? 51.47 -176.15 102 17 GLU A 2 ? ? 55.04 99.85 103 17 LEU A 8 ? ? -54.29 172.57 104 17 ASP A 46 ? ? -179.00 -37.54 105 17 THR A 48 ? ? -149.58 -49.31 106 17 GLU A 103 ? ? -140.64 -57.88 107 17 ASN A 110 ? ? -177.08 -40.44 108 17 PHE A 119 ? ? 38.81 -94.03 109 18 ASP A 46 ? ? 177.55 -43.22 110 18 THR A 48 ? ? -146.57 -42.18 111 18 LYS A 90 ? ? -175.09 71.57 112 18 GLU A 103 ? ? 171.64 151.83 113 18 ASN A 116 ? ? -157.02 66.67 114 18 SER A 121 ? ? 54.02 -171.61 115 19 ASP A 46 ? ? 177.47 -49.13 116 19 THR A 48 ? ? -138.49 -46.18 117 19 LYS A 90 ? ? -176.33 71.55 118 19 GLU A 103 ? ? 166.60 172.78 119 19 ASN A 110 ? ? -98.50 -65.28 120 19 TYR A 118 ? ? 70.84 -65.74 121 20 LEU A 8 ? ? -56.25 178.71 122 20 ASP A 46 ? ? -178.94 -36.01 123 20 THR A 48 ? ? -149.34 -46.57 124 20 PRO A 102 ? ? -78.22 -81.37 125 20 GLU A 103 ? ? 63.46 -9.69 126 20 ASN A 110 ? ? -171.65 24.74 127 20 LEU A 117 ? ? 59.68 178.64 # _pdbx_nmr_ensemble.entry_id 7WCG _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7WCG _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '500 uM [U-15N] Single-stranded binding protein of Sulfolobus Solfataricus with C-term His-tag, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N_sample solution ? 2 '500 uM [U-13C; U-15N] Single-stranded binding protein of Sulfolobus Solfataricus with C-term His-tag, 90% H2O/10% D2O' '90% H2O/10% D2O' '15N, 13C_sample' solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 'Single-stranded binding protein of Sulfolobus Solfataricus with C-term His-tag' 500 ? uM '[U-15N]' 2 'Single-stranded binding protein of Sulfolobus Solfataricus with C-term His-tag' 500 ? uM '[U-13C; U-15N]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 323 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 70 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 8 1 2 '2D 1H-13C HSQC' 1 isotropic 2 1 2 '3D HNCO' 1 isotropic 3 1 2 '3D HN(CA)CO' 1 isotropic 4 1 2 '3D CBCA(CO)NH' 1 isotropic 6 1 2 '3D HNCACB' 1 isotropic 7 1 2 '3D C(CO)NH' 1 isotropic 10 1 2 '3D HBHA(CO)NH' 1 isotropic 9 1 2 '3D H(CCO)NH' 1 isotropic 5 1 1 '3D 1H-15N NOESY' 1 isotropic 11 1 2 '3D 1H-13C NOESY aliphatic' 2 isotropic 12 1 1 '3D 1H-15N TOCSY' 1 isotropic # _pdbx_nmr_refine.entry_id 7WCG _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 8 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 2 'structure calculation' PONDEROSA-C/S ? 'Lee, Stark, and Markley' 7 'structure calculation' AUDANA ? 'Lee, Petit, Cornilescu, Stark, and Markley' 3 'chemical shift assignment' NMRFAM-SPARKY ? 'Lee, Tonelli, and Markley' 5 'chemical shift assignment' PINE-SPARKY ? 'Lee, Westler, Bahrami, Eghbalnia, and Markley' 4 'peak picking' NMRFAM-SPARKY ? 'Lee, Tonelli, and Markley' 6 'peak picking' APES ? 'Shin, Lee, and Lee' 8 refinement PONDEROSA-C/S ? 'Lee, Stark, and Markley' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 125 ? A HIS 125 2 1 Y 1 A HIS 126 ? A HIS 126 3 1 Y 1 A HIS 127 ? A HIS 127 4 1 Y 1 A HIS 128 ? A HIS 128 5 1 Y 1 A HIS 129 ? A HIS 129 6 2 Y 1 A HIS 125 ? A HIS 125 7 2 Y 1 A HIS 126 ? A HIS 126 8 2 Y 1 A HIS 127 ? A HIS 127 9 2 Y 1 A HIS 128 ? A HIS 128 10 2 Y 1 A HIS 129 ? A HIS 129 11 3 Y 1 A HIS 125 ? A HIS 125 12 3 Y 1 A HIS 126 ? A HIS 126 13 3 Y 1 A HIS 127 ? A HIS 127 14 3 Y 1 A HIS 128 ? A HIS 128 15 3 Y 1 A HIS 129 ? A HIS 129 16 4 Y 1 A HIS 125 ? A HIS 125 17 4 Y 1 A HIS 126 ? A HIS 126 18 4 Y 1 A HIS 127 ? A HIS 127 19 4 Y 1 A HIS 128 ? A HIS 128 20 4 Y 1 A HIS 129 ? A HIS 129 21 5 Y 1 A HIS 125 ? A HIS 125 22 5 Y 1 A HIS 126 ? A HIS 126 23 5 Y 1 A HIS 127 ? A HIS 127 24 5 Y 1 A HIS 128 ? A HIS 128 25 5 Y 1 A HIS 129 ? A HIS 129 26 6 Y 1 A HIS 125 ? A HIS 125 27 6 Y 1 A HIS 126 ? A HIS 126 28 6 Y 1 A HIS 127 ? A HIS 127 29 6 Y 1 A HIS 128 ? A HIS 128 30 6 Y 1 A HIS 129 ? A HIS 129 31 7 Y 1 A HIS 125 ? A HIS 125 32 7 Y 1 A HIS 126 ? A HIS 126 33 7 Y 1 A HIS 127 ? A HIS 127 34 7 Y 1 A HIS 128 ? A HIS 128 35 7 Y 1 A HIS 129 ? A HIS 129 36 8 Y 1 A HIS 125 ? A HIS 125 37 8 Y 1 A HIS 126 ? A HIS 126 38 8 Y 1 A HIS 127 ? A HIS 127 39 8 Y 1 A HIS 128 ? A HIS 128 40 8 Y 1 A HIS 129 ? A HIS 129 41 9 Y 1 A HIS 125 ? A HIS 125 42 9 Y 1 A HIS 126 ? A HIS 126 43 9 Y 1 A HIS 127 ? A HIS 127 44 9 Y 1 A HIS 128 ? A HIS 128 45 9 Y 1 A HIS 129 ? A HIS 129 46 10 Y 1 A HIS 125 ? A HIS 125 47 10 Y 1 A HIS 126 ? A HIS 126 48 10 Y 1 A HIS 127 ? A HIS 127 49 10 Y 1 A HIS 128 ? A HIS 128 50 10 Y 1 A HIS 129 ? A HIS 129 51 11 Y 1 A HIS 125 ? A HIS 125 52 11 Y 1 A HIS 126 ? A HIS 126 53 11 Y 1 A HIS 127 ? A HIS 127 54 11 Y 1 A HIS 128 ? A HIS 128 55 11 Y 1 A HIS 129 ? A HIS 129 56 12 Y 1 A HIS 125 ? A HIS 125 57 12 Y 1 A HIS 126 ? A HIS 126 58 12 Y 1 A HIS 127 ? A HIS 127 59 12 Y 1 A HIS 128 ? A HIS 128 60 12 Y 1 A HIS 129 ? A HIS 129 61 13 Y 1 A HIS 125 ? A HIS 125 62 13 Y 1 A HIS 126 ? A HIS 126 63 13 Y 1 A HIS 127 ? A HIS 127 64 13 Y 1 A HIS 128 ? A HIS 128 65 13 Y 1 A HIS 129 ? A HIS 129 66 14 Y 1 A HIS 125 ? A HIS 125 67 14 Y 1 A HIS 126 ? A HIS 126 68 14 Y 1 A HIS 127 ? A HIS 127 69 14 Y 1 A HIS 128 ? A HIS 128 70 14 Y 1 A HIS 129 ? A HIS 129 71 15 Y 1 A HIS 125 ? A HIS 125 72 15 Y 1 A HIS 126 ? A HIS 126 73 15 Y 1 A HIS 127 ? A HIS 127 74 15 Y 1 A HIS 128 ? A HIS 128 75 15 Y 1 A HIS 129 ? A HIS 129 76 16 Y 1 A HIS 125 ? A HIS 125 77 16 Y 1 A HIS 126 ? A HIS 126 78 16 Y 1 A HIS 127 ? A HIS 127 79 16 Y 1 A HIS 128 ? A HIS 128 80 16 Y 1 A HIS 129 ? A HIS 129 81 17 Y 1 A HIS 125 ? A HIS 125 82 17 Y 1 A HIS 126 ? A HIS 126 83 17 Y 1 A HIS 127 ? A HIS 127 84 17 Y 1 A HIS 128 ? A HIS 128 85 17 Y 1 A HIS 129 ? A HIS 129 86 18 Y 1 A HIS 125 ? A HIS 125 87 18 Y 1 A HIS 126 ? A HIS 126 88 18 Y 1 A HIS 127 ? A HIS 127 89 18 Y 1 A HIS 128 ? A HIS 128 90 18 Y 1 A HIS 129 ? A HIS 129 91 19 Y 1 A HIS 125 ? A HIS 125 92 19 Y 1 A HIS 126 ? A HIS 126 93 19 Y 1 A HIS 127 ? A HIS 127 94 19 Y 1 A HIS 128 ? A HIS 128 95 19 Y 1 A HIS 129 ? A HIS 129 96 20 Y 1 A HIS 125 ? A HIS 125 97 20 Y 1 A HIS 126 ? A HIS 126 98 20 Y 1 A HIS 127 ? A HIS 127 99 20 Y 1 A HIS 128 ? A HIS 128 100 20 Y 1 A HIS 129 ? A HIS 129 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 ILE N N N N 144 ILE CA C N S 145 ILE C C N N 146 ILE O O N N 147 ILE CB C N S 148 ILE CG1 C N N 149 ILE CG2 C N N 150 ILE CD1 C N N 151 ILE OXT O N N 152 ILE H H N N 153 ILE H2 H N N 154 ILE HA H N N 155 ILE HB H N N 156 ILE HG12 H N N 157 ILE HG13 H N N 158 ILE HG21 H N N 159 ILE HG22 H N N 160 ILE HG23 H N N 161 ILE HD11 H N N 162 ILE HD12 H N N 163 ILE HD13 H N N 164 ILE HXT H N N 165 LEU N N N N 166 LEU CA C N S 167 LEU C C N N 168 LEU O O N N 169 LEU CB C N N 170 LEU CG C N N 171 LEU CD1 C N N 172 LEU CD2 C N N 173 LEU OXT O N N 174 LEU H H N N 175 LEU H2 H N N 176 LEU HA H N N 177 LEU HB2 H N N 178 LEU HB3 H N N 179 LEU HG H N N 180 LEU HD11 H N N 181 LEU HD12 H N N 182 LEU HD13 H N N 183 LEU HD21 H N N 184 LEU HD22 H N N 185 LEU HD23 H N N 186 LEU HXT H N N 187 LYS N N N N 188 LYS CA C N S 189 LYS C C N N 190 LYS O O N N 191 LYS CB C N N 192 LYS CG C N N 193 LYS CD C N N 194 LYS CE C N N 195 LYS NZ N N N 196 LYS OXT O N N 197 LYS H H N N 198 LYS H2 H N N 199 LYS HA H N N 200 LYS HB2 H N N 201 LYS HB3 H N N 202 LYS HG2 H N N 203 LYS HG3 H N N 204 LYS HD2 H N N 205 LYS HD3 H N N 206 LYS HE2 H N N 207 LYS HE3 H N N 208 LYS HZ1 H N N 209 LYS HZ2 H N N 210 LYS HZ3 H N N 211 LYS HXT H N N 212 MET N N N N 213 MET CA C N S 214 MET C C N N 215 MET O O N N 216 MET CB C N N 217 MET CG C N N 218 MET SD S N N 219 MET CE C N N 220 MET OXT O N N 221 MET H H N N 222 MET H2 H N N 223 MET HA H N N 224 MET HB2 H N N 225 MET HB3 H N N 226 MET HG2 H N N 227 MET HG3 H N N 228 MET HE1 H N N 229 MET HE2 H N N 230 MET HE3 H N N 231 MET HXT H N N 232 PHE N N N N 233 PHE CA C N S 234 PHE C C N N 235 PHE O O N N 236 PHE CB C N N 237 PHE CG C Y N 238 PHE CD1 C Y N 239 PHE CD2 C Y N 240 PHE CE1 C Y N 241 PHE CE2 C Y N 242 PHE CZ C Y N 243 PHE OXT O N N 244 PHE H H N N 245 PHE H2 H N N 246 PHE HA H N N 247 PHE HB2 H N N 248 PHE HB3 H N N 249 PHE HD1 H N N 250 PHE HD2 H N N 251 PHE HE1 H N N 252 PHE HE2 H N N 253 PHE HZ H N N 254 PHE HXT H N N 255 PRO N N N N 256 PRO CA C N S 257 PRO C C N N 258 PRO O O N N 259 PRO CB C N N 260 PRO CG C N N 261 PRO CD C N N 262 PRO OXT O N N 263 PRO H H N N 264 PRO HA H N N 265 PRO HB2 H N N 266 PRO HB3 H N N 267 PRO HG2 H N N 268 PRO HG3 H N N 269 PRO HD2 H N N 270 PRO HD3 H N N 271 PRO HXT H N N 272 SER N N N N 273 SER CA C N S 274 SER C C N N 275 SER O O N N 276 SER CB C N N 277 SER OG O N N 278 SER OXT O N N 279 SER H H N N 280 SER H2 H N N 281 SER HA H N N 282 SER HB2 H N N 283 SER HB3 H N N 284 SER HG H N N 285 SER HXT H N N 286 THR N N N N 287 THR CA C N S 288 THR C C N N 289 THR O O N N 290 THR CB C N R 291 THR OG1 O N N 292 THR CG2 C N N 293 THR OXT O N N 294 THR H H N N 295 THR H2 H N N 296 THR HA H N N 297 THR HB H N N 298 THR HG1 H N N 299 THR HG21 H N N 300 THR HG22 H N N 301 THR HG23 H N N 302 THR HXT H N N 303 TRP N N N N 304 TRP CA C N S 305 TRP C C N N 306 TRP O O N N 307 TRP CB C N N 308 TRP CG C Y N 309 TRP CD1 C Y N 310 TRP CD2 C Y N 311 TRP NE1 N Y N 312 TRP CE2 C Y N 313 TRP CE3 C Y N 314 TRP CZ2 C Y N 315 TRP CZ3 C Y N 316 TRP CH2 C Y N 317 TRP OXT O N N 318 TRP H H N N 319 TRP H2 H N N 320 TRP HA H N N 321 TRP HB2 H N N 322 TRP HB3 H N N 323 TRP HD1 H N N 324 TRP HE1 H N N 325 TRP HE3 H N N 326 TRP HZ2 H N N 327 TRP HZ3 H N N 328 TRP HH2 H N N 329 TRP HXT H N N 330 TYR N N N N 331 TYR CA C N S 332 TYR C C N N 333 TYR O O N N 334 TYR CB C N N 335 TYR CG C Y N 336 TYR CD1 C Y N 337 TYR CD2 C Y N 338 TYR CE1 C Y N 339 TYR CE2 C Y N 340 TYR CZ C Y N 341 TYR OH O N N 342 TYR OXT O N N 343 TYR H H N N 344 TYR H2 H N N 345 TYR HA H N N 346 TYR HB2 H N N 347 TYR HB3 H N N 348 TYR HD1 H N N 349 TYR HD2 H N N 350 TYR HE1 H N N 351 TYR HE2 H N N 352 TYR HH H N N 353 TYR HXT H N N 354 VAL N N N N 355 VAL CA C N S 356 VAL C C N N 357 VAL O O N N 358 VAL CB C N N 359 VAL CG1 C N N 360 VAL CG2 C N N 361 VAL OXT O N N 362 VAL H H N N 363 VAL H2 H N N 364 VAL HA H N N 365 VAL HB H N N 366 VAL HG11 H N N 367 VAL HG12 H N N 368 VAL HG13 H N N 369 VAL HG21 H N N 370 VAL HG22 H N N 371 VAL HG23 H N N 372 VAL HXT H N N 373 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # _pdbx_audit_support.funding_organization 'Other government' _pdbx_audit_support.country 'Korea, Republic Of' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 'AVANCE NEO' ? Bruker 600 ? 2 AVANCE ? Bruker 900 ? # _atom_sites.entry_id 7WCG _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_