data_7WCQ # _entry.id 7WCQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7WCQ pdb_00007wcq 10.2210/pdb7wcq/pdb WWPDB D_1300026417 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7WCQ _pdbx_database_status.recvd_initial_deposition_date 2021-12-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kojima, E.' 1 ? 'Iimuro, A.' 2 ? 'Nakajima, M.' 3 ? 'Kinuta, H.' 4 ? 'Asada, N.' 5 ? 'Sako, Y.' 6 ? 'Nakata, Z.' 7 ? 'Uemura, K.' 8 ? 'Arita, S.' 9 ? 'Miki, S.' 10 ? 'Wakasa-Morimoto, C.' 11 ? 'Tachibana, Y.' 12 ? 'Fumoto, M.' 13 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 65 _citation.language ? _citation.page_first 6157 _citation.page_last 6170 _citation.title ;Pocket-to-Lead: Structure-Based De Novo Design of Novel Non-peptidic HIV-1 Protease Inhibitors Using the Ligand Binding Pocket as a Template. ; _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.1c02217 _citation.pdbx_database_id_PubMed 35416651 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kojima, E.' 1 ? primary 'Iimuro, A.' 2 ? primary 'Nakajima, M.' 3 ? primary 'Kinuta, H.' 4 ? primary 'Asada, N.' 5 ? primary 'Sako, Y.' 6 ? primary 'Nakata, Z.' 7 ? primary 'Uemura, K.' 8 ? primary 'Arita, S.' 9 ? primary 'Miki, S.' 10 ? primary 'Wakasa-Morimoto, C.' 11 ? primary 'Tachibana, Y.' 12 0000-0001-6845-4453 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7WCQ _cell.details ? _cell.formula_units_Z ? _cell.length_a 62.702 _cell.length_a_esd ? _cell.length_b 62.702 _cell.length_b_esd ? _cell.length_c 81.750 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7WCQ _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Protease 10830.781 1 ? ? ? ? 2 non-polymer syn '(3R,4R)-3-[(4-fluorophenyl)methyl]-1-[(4-methoxyphenyl)methyl]-3-(4-methylsulfonylphenyl)-4-oxidanyl-pyrrolidin-2-one' 483.552 1 ? ? ? ? 3 water nat water 18.015 39 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Retropepsin # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPT PVNIIGRNLLTQIGCTLNF ; _entity_poly.pdbx_seq_one_letter_code_can ;PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPT PVNIIGRNLLTQIGCTLNF ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 GLN n 1 3 ILE n 1 4 THR n 1 5 LEU n 1 6 TRP n 1 7 GLN n 1 8 ARG n 1 9 PRO n 1 10 LEU n 1 11 VAL n 1 12 THR n 1 13 ILE n 1 14 LYS n 1 15 ILE n 1 16 GLY n 1 17 GLY n 1 18 GLN n 1 19 LEU n 1 20 LYS n 1 21 GLU n 1 22 ALA n 1 23 LEU n 1 24 LEU n 1 25 ASP n 1 26 THR n 1 27 GLY n 1 28 ALA n 1 29 ASP n 1 30 ASP n 1 31 THR n 1 32 VAL n 1 33 LEU n 1 34 GLU n 1 35 GLU n 1 36 MET n 1 37 ASN n 1 38 LEU n 1 39 PRO n 1 40 GLY n 1 41 ARG n 1 42 TRP n 1 43 LYS n 1 44 PRO n 1 45 LYS n 1 46 MET n 1 47 ILE n 1 48 GLY n 1 49 GLY n 1 50 ILE n 1 51 GLY n 1 52 GLY n 1 53 PHE n 1 54 ILE n 1 55 LYS n 1 56 VAL n 1 57 ARG n 1 58 GLN n 1 59 TYR n 1 60 ASP n 1 61 GLN n 1 62 ILE n 1 63 LEU n 1 64 ILE n 1 65 GLU n 1 66 ILE n 1 67 CYS n 1 68 GLY n 1 69 HIS n 1 70 LYS n 1 71 ALA n 1 72 ILE n 1 73 GLY n 1 74 THR n 1 75 VAL n 1 76 LEU n 1 77 VAL n 1 78 GLY n 1 79 PRO n 1 80 THR n 1 81 PRO n 1 82 VAL n 1 83 ASN n 1 84 ILE n 1 85 ILE n 1 86 GLY n 1 87 ARG n 1 88 ASN n 1 89 LEU n 1 90 LEU n 1 91 THR n 1 92 GLN n 1 93 ILE n 1 94 GLY n 1 95 CYS n 1 96 THR n 1 97 LEU n 1 98 ASN n 1 99 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 99 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human immunodeficiency virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 12721 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9WFL7_9HIV1 _struct_ref.pdbx_db_accession Q9WFL7 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPT PVNIIGRNLLTQIGCTLNF ; _struct_ref.pdbx_align_begin 7 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7WCQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 99 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9WFL7 _struct_ref_seq.db_align_beg 7 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 105 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 99 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 8OC non-polymer . '(3R,4R)-3-[(4-fluorophenyl)methyl]-1-[(4-methoxyphenyl)methyl]-3-(4-methylsulfonylphenyl)-4-oxidanyl-pyrrolidin-2-one' ? 'C26 H26 F N O5 S' 483.552 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7WCQ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.14 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 42.57 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M bis-Tris pH 6.5 and 0.5 M Magnesium formate dihydrate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU RAXIS IV++' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-05-27 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54178 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU MICROMAX-007 HF' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.54178 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 24.140 _reflns.entry_id 7WCQ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.010 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6745 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.400 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.400 _reflns.pdbx_Rmerge_I_obs 0.059 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.800 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.907 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.062 _reflns.pdbx_Rpim_I_all 0.019 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 69831 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.010 2.080 ? ? ? ? ? ? 652 100.000 ? ? ? ? 0.267 ? ? ? ? ? ? ? ? 10.300 ? 0.921 ? ? 0.281 0.086 ? 1 1 0.979 ? ? ? ? ? ? ? ? ? ? 2.080 2.170 ? ? ? ? ? ? 654 100.000 ? ? ? ? 0.200 ? ? ? ? ? ? ? ? 10.400 ? 0.919 ? ? 0.211 0.064 ? 2 1 0.984 ? ? ? ? ? ? ? ? ? ? 2.170 2.260 ? ? ? ? ? ? 658 100.000 ? ? ? ? 0.156 ? ? ? ? ? ? ? ? 10.400 ? 0.945 ? ? 0.164 0.050 ? 3 1 0.992 ? ? ? ? ? ? ? ? ? ? 2.260 2.380 ? ? ? ? ? ? 651 100.000 ? ? ? ? 0.139 ? ? ? ? ? ? ? ? 10.500 ? 0.912 ? ? 0.147 0.044 ? 4 1 0.992 ? ? ? ? ? ? ? ? ? ? 2.380 2.530 ? ? ? ? ? ? 670 100.000 ? ? ? ? 0.110 ? ? ? ? ? ? ? ? 10.500 ? 0.919 ? ? 0.115 0.035 ? 5 1 0.995 ? ? ? ? ? ? ? ? ? ? 2.530 2.730 ? ? ? ? ? ? 673 100.000 ? ? ? ? 0.090 ? ? ? ? ? ? ? ? 10.400 ? 0.956 ? ? 0.095 0.029 ? 6 1 0.996 ? ? ? ? ? ? ? ? ? ? 2.730 3.000 ? ? ? ? ? ? 665 99.800 ? ? ? ? 0.072 ? ? ? ? ? ? ? ? 10.600 ? 0.976 ? ? 0.076 0.023 ? 7 1 0.997 ? ? ? ? ? ? ? ? ? ? 3.000 3.440 ? ? ? ? ? ? 682 99.400 ? ? ? ? 0.056 ? ? ? ? ? ? ? ? 10.500 ? 0.912 ? ? 0.059 0.018 ? 8 1 0.998 ? ? ? ? ? ? ? ? ? ? 3.440 4.330 ? ? ? ? ? ? 688 98.900 ? ? ? ? 0.044 ? ? ? ? ? ? ? ? 10.400 ? 0.843 ? ? 0.046 0.014 ? 9 1 0.999 ? ? ? ? ? ? ? ? ? ? 4.330 50.000 ? ? ? ? ? ? 752 96.300 ? ? ? ? 0.038 ? ? ? ? ? ? ? ? 9.600 ? 0.773 ? ? 0.040 0.012 ? 10 1 0.999 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 57.510 _refine.B_iso_mean 25.1778 _refine.B_iso_min 10.070 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7WCQ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.0110 _refine.ls_d_res_low 32.6570 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6735 _refine.ls_number_reflns_R_free 345 _refine.ls_number_reflns_R_work 6390 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.7300 _refine.ls_percent_reflns_R_free 5.1200 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2206 _refine.ls_R_factor_R_free 0.2644 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2183 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.370 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4LL3 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 26.7200 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.0110 _refine_hist.d_res_low 32.6570 _refine_hist.number_atoms_solvent 39 _refine_hist.number_atoms_total 810 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 99 _refine_hist.pdbx_B_iso_mean_ligand 22.99 _refine_hist.pdbx_B_iso_mean_solvent 28.44 _refine_hist.pdbx_number_atoms_protein 737 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 34 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 786 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.953 ? 1074 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.072 ? 127 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 132 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 10.250 ? 454 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.0110 2.5335 . . 179 3099 100.0000 . . . 0.3195 0.0000 0.2475 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5335 32.6570 . . 166 3291 99.0000 . . . 0.2405 0.0000 0.2071 . . . . . . . . . . . # _struct.entry_id 7WCQ _struct.title 'Crystal structure of HIV-1 protease in complex with lactam derivative 1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7WCQ _struct_keywords.text 'HYDROLASE-Inhibitor complex' _struct_keywords.pdbx_keywords HYDROLASE/INHIBITOR # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 86 ? THR A 91 ? GLY A 86 THR A 91 1 ? 6 HELX_P HELX_P2 AA2 GLN A 92 ? GLY A 94 ? GLN A 92 GLY A 94 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel AA1 5 6 ? parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 43 ? GLY A 49 ? LYS A 43 GLY A 49 AA1 2 GLY A 52 ? ILE A 66 ? GLY A 52 ILE A 66 AA1 3 HIS A 69 ? VAL A 77 ? HIS A 69 VAL A 77 AA1 4 VAL A 32 ? LEU A 33 ? VAL A 32 LEU A 33 AA1 5 ILE A 84 ? ILE A 85 ? ILE A 84 ILE A 85 AA1 6 GLN A 18 ? LEU A 24 ? GLN A 18 LEU A 24 AA1 7 LEU A 10 ? ILE A 15 ? LEU A 10 ILE A 15 AA1 8 GLY A 52 ? ILE A 66 ? GLY A 52 ILE A 66 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LYS A 45 ? N LYS A 45 O VAL A 56 ? O VAL A 56 AA1 2 3 N ILE A 66 ? N ILE A 66 O HIS A 69 ? O HIS A 69 AA1 3 4 O LEU A 76 ? O LEU A 76 N LEU A 33 ? N LEU A 33 AA1 4 5 N VAL A 32 ? N VAL A 32 O ILE A 84 ? O ILE A 84 AA1 5 6 O ILE A 85 ? O ILE A 85 N LEU A 23 ? N LEU A 23 AA1 6 7 O LYS A 20 ? O LYS A 20 N ILE A 13 ? N ILE A 13 AA1 7 8 N LYS A 14 ? N LYS A 14 O GLU A 65 ? O GLU A 65 # _atom_sites.entry_id 7WCQ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.015948 _atom_sites.fract_transf_matrix[1][2] 0.009208 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018416 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012232 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C F N O S # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 1 1 PRO PRO A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 TRP 6 6 6 TRP TRP A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 MET 36 36 36 MET MET A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 TRP 42 42 42 TRP TRP A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 CYS 67 67 67 CYS CYS A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 CYS 95 95 95 CYS CYS A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 PHE 99 99 99 PHE PHE A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email yuuki.tachibana@shionogi.co.jp _pdbx_contact_author.name_first Yuki _pdbx_contact_author.name_last Tachibana _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-6845-4453 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 8OC 1 101 1 8OC MOL A . C 3 HOH 1 201 39 HOH HOH A . C 3 HOH 2 202 40 HOH HOH A . C 3 HOH 3 203 34 HOH HOH A . C 3 HOH 4 204 35 HOH HOH A . C 3 HOH 5 205 18 HOH HOH A . C 3 HOH 6 206 37 HOH HOH A . C 3 HOH 7 207 21 HOH HOH A . C 3 HOH 8 208 19 HOH HOH A . C 3 HOH 9 209 3 HOH HOH A . C 3 HOH 10 210 13 HOH HOH A . C 3 HOH 11 211 31 HOH HOH A . C 3 HOH 12 212 6 HOH HOH A . C 3 HOH 13 213 16 HOH HOH A . C 3 HOH 14 214 26 HOH HOH A . C 3 HOH 15 215 2 HOH HOH A . C 3 HOH 16 216 32 HOH HOH A . C 3 HOH 17 217 5 HOH HOH A . C 3 HOH 18 218 33 HOH HOH A . C 3 HOH 19 219 11 HOH HOH A . C 3 HOH 20 220 4 HOH HOH A . C 3 HOH 21 221 24 HOH HOH A . C 3 HOH 22 222 14 HOH HOH A . C 3 HOH 23 223 22 HOH HOH A . C 3 HOH 24 224 9 HOH HOH A . C 3 HOH 25 225 8 HOH HOH A . C 3 HOH 26 226 38 HOH HOH A . C 3 HOH 27 227 12 HOH HOH A . C 3 HOH 28 228 25 HOH HOH A . C 3 HOH 29 229 29 HOH HOH A . C 3 HOH 30 230 23 HOH HOH A . C 3 HOH 31 231 27 HOH HOH A . C 3 HOH 32 232 7 HOH HOH A . C 3 HOH 33 233 17 HOH HOH A . C 3 HOH 34 234 20 HOH HOH A . C 3 HOH 35 235 28 HOH HOH A . C 3 HOH 36 236 1 HOH HOH A . C 3 HOH 37 237 15 HOH HOH A . C 3 HOH 38 238 10 HOH HOH A . C 3 HOH 39 239 30 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4040 ? 1 MORE -21 ? 1 'SSA (A^2)' 8790 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z+1/3 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 27.2500000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-11-02 2 'Structure model' 1 1 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # _pdbx_phasing_MR.entry_id 7WCQ _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body 0.490 _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 32.660 _pdbx_phasing_MR.d_res_low_rotation 5.000 _pdbx_phasing_MR.d_res_high_translation ? _pdbx_phasing_MR.d_res_low_translation ? _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.11.1-2575-000 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 5 # _pdbx_entry_details.entry_id 7WCQ _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id GLU _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 34 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -48.09 _pdbx_validate_torsion.psi 158.69 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASN 37 ? CG ? A ASN 37 CG 2 1 Y 1 A ASN 37 ? OD1 ? A ASN 37 OD1 3 1 Y 1 A ASN 37 ? ND2 ? A ASN 37 ND2 4 1 Y 1 A ARG 41 ? CG ? A ARG 41 CG 5 1 Y 1 A ARG 41 ? CD ? A ARG 41 CD 6 1 Y 1 A ARG 41 ? NE ? A ARG 41 NE 7 1 Y 1 A ARG 41 ? CZ ? A ARG 41 CZ 8 1 Y 1 A ARG 41 ? NH1 ? A ARG 41 NH1 9 1 Y 1 A ARG 41 ? NH2 ? A ARG 41 NH2 10 1 Y 1 A PHE 53 ? CG ? A PHE 53 CG 11 1 Y 1 A PHE 53 ? CD1 ? A PHE 53 CD1 12 1 Y 1 A PHE 53 ? CD2 ? A PHE 53 CD2 13 1 Y 1 A PHE 53 ? CE1 ? A PHE 53 CE1 14 1 Y 1 A PHE 53 ? CE2 ? A PHE 53 CE2 15 1 Y 1 A PHE 53 ? CZ ? A PHE 53 CZ 16 1 Y 1 A LYS 55 ? CG ? A LYS 55 CG 17 1 Y 1 A LYS 55 ? CD ? A LYS 55 CD 18 1 Y 1 A LYS 55 ? CE ? A LYS 55 CE 19 1 Y 1 A LYS 55 ? NZ ? A LYS 55 NZ 20 1 Y 1 A GLN 61 ? CG ? A GLN 61 CG 21 1 Y 1 A GLN 61 ? CD ? A GLN 61 CD 22 1 Y 1 A GLN 61 ? OE1 ? A GLN 61 OE1 23 1 Y 1 A GLN 61 ? NE2 ? A GLN 61 NE2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 8OC C10 C N R 1 8OC C12 C N R 2 8OC C13 C N N 3 8OC C14 C Y N 4 8OC C15 C Y N 5 8OC C01 C N N 6 8OC C03 C Y N 7 8OC C04 C Y N 8 8OC C05 C Y N 9 8OC C06 C Y N 10 8OC C07 C N N 11 8OC C09 C N N 12 8OC C16 C Y N 13 8OC C17 C Y N 14 8OC C19 C Y N 15 8OC C20 C Y N 16 8OC C21 C N N 17 8OC C23 C Y N 18 8OC C24 C Y N 19 8OC C25 C Y N 20 8OC C26 C Y N 21 8OC C27 C Y N 22 8OC C28 C Y N 23 8OC C30 C N N 24 8OC C33 C Y N 25 8OC C34 C Y N 26 8OC F18 F N N 27 8OC N08 N N N 28 8OC O02 O N N 29 8OC O11 O N N 30 8OC O22 O N N 31 8OC O31 O N N 32 8OC O32 O N N 33 8OC S29 S N N 34 8OC H1 H N N 35 8OC H3 H N N 36 8OC H4 H N N 37 8OC H5 H N N 38 8OC H6 H N N 39 8OC H7 H N N 40 8OC H8 H N N 41 8OC H9 H N N 42 8OC H10 H N N 43 8OC H11 H N N 44 8OC H12 H N N 45 8OC H14 H N N 46 8OC H15 H N N 47 8OC H16 H N N 48 8OC H17 H N N 49 8OC H18 H N N 50 8OC H19 H N N 51 8OC H20 H N N 52 8OC H21 H N N 53 8OC H22 H N N 54 8OC H23 H N N 55 8OC H24 H N N 56 8OC H25 H N N 57 8OC H26 H N N 58 8OC H27 H N N 59 8OC H28 H N N 60 ALA N N N N 61 ALA CA C N S 62 ALA C C N N 63 ALA O O N N 64 ALA CB C N N 65 ALA OXT O N N 66 ALA H H N N 67 ALA H2 H N N 68 ALA HA H N N 69 ALA HB1 H N N 70 ALA HB2 H N N 71 ALA HB3 H N N 72 ALA HXT H N N 73 ARG N N N N 74 ARG CA C N S 75 ARG C C N N 76 ARG O O N N 77 ARG CB C N N 78 ARG CG C N N 79 ARG CD C N N 80 ARG NE N N N 81 ARG CZ C N N 82 ARG NH1 N N N 83 ARG NH2 N N N 84 ARG OXT O N N 85 ARG H H N N 86 ARG H2 H N N 87 ARG HA H N N 88 ARG HB2 H N N 89 ARG HB3 H N N 90 ARG HG2 H N N 91 ARG HG3 H N N 92 ARG HD2 H N N 93 ARG HD3 H N N 94 ARG HE H N N 95 ARG HH11 H N N 96 ARG HH12 H N N 97 ARG HH21 H N N 98 ARG HH22 H N N 99 ARG HXT H N N 100 ASN N N N N 101 ASN CA C N S 102 ASN C C N N 103 ASN O O N N 104 ASN CB C N N 105 ASN CG C N N 106 ASN OD1 O N N 107 ASN ND2 N N N 108 ASN OXT O N N 109 ASN H H N N 110 ASN H2 H N N 111 ASN HA H N N 112 ASN HB2 H N N 113 ASN HB3 H N N 114 ASN HD21 H N N 115 ASN HD22 H N N 116 ASN HXT H N N 117 ASP N N N N 118 ASP CA C N S 119 ASP C C N N 120 ASP O O N N 121 ASP CB C N N 122 ASP CG C N N 123 ASP OD1 O N N 124 ASP OD2 O N N 125 ASP OXT O N N 126 ASP H H N N 127 ASP H2 H N N 128 ASP HA H N N 129 ASP HB2 H N N 130 ASP HB3 H N N 131 ASP HD2 H N N 132 ASP HXT H N N 133 CYS N N N N 134 CYS CA C N R 135 CYS C C N N 136 CYS O O N N 137 CYS CB C N N 138 CYS SG S N N 139 CYS OXT O N N 140 CYS H H N N 141 CYS H2 H N N 142 CYS HA H N N 143 CYS HB2 H N N 144 CYS HB3 H N N 145 CYS HG H N N 146 CYS HXT H N N 147 GLN N N N N 148 GLN CA C N S 149 GLN C C N N 150 GLN O O N N 151 GLN CB C N N 152 GLN CG C N N 153 GLN CD C N N 154 GLN OE1 O N N 155 GLN NE2 N N N 156 GLN OXT O N N 157 GLN H H N N 158 GLN H2 H N N 159 GLN HA H N N 160 GLN HB2 H N N 161 GLN HB3 H N N 162 GLN HG2 H N N 163 GLN HG3 H N N 164 GLN HE21 H N N 165 GLN HE22 H N N 166 GLN HXT H N N 167 GLU N N N N 168 GLU CA C N S 169 GLU C C N N 170 GLU O O N N 171 GLU CB C N N 172 GLU CG C N N 173 GLU CD C N N 174 GLU OE1 O N N 175 GLU OE2 O N N 176 GLU OXT O N N 177 GLU H H N N 178 GLU H2 H N N 179 GLU HA H N N 180 GLU HB2 H N N 181 GLU HB3 H N N 182 GLU HG2 H N N 183 GLU HG3 H N N 184 GLU HE2 H N N 185 GLU HXT H N N 186 GLY N N N N 187 GLY CA C N N 188 GLY C C N N 189 GLY O O N N 190 GLY OXT O N N 191 GLY H H N N 192 GLY H2 H N N 193 GLY HA2 H N N 194 GLY HA3 H N N 195 GLY HXT H N N 196 HIS N N N N 197 HIS CA C N S 198 HIS C C N N 199 HIS O O N N 200 HIS CB C N N 201 HIS CG C Y N 202 HIS ND1 N Y N 203 HIS CD2 C Y N 204 HIS CE1 C Y N 205 HIS NE2 N Y N 206 HIS OXT O N N 207 HIS H H N N 208 HIS H2 H N N 209 HIS HA H N N 210 HIS HB2 H N N 211 HIS HB3 H N N 212 HIS HD1 H N N 213 HIS HD2 H N N 214 HIS HE1 H N N 215 HIS HE2 H N N 216 HIS HXT H N N 217 HOH O O N N 218 HOH H1 H N N 219 HOH H2 H N N 220 ILE N N N N 221 ILE CA C N S 222 ILE C C N N 223 ILE O O N N 224 ILE CB C N S 225 ILE CG1 C N N 226 ILE CG2 C N N 227 ILE CD1 C N N 228 ILE OXT O N N 229 ILE H H N N 230 ILE H2 H N N 231 ILE HA H N N 232 ILE HB H N N 233 ILE HG12 H N N 234 ILE HG13 H N N 235 ILE HG21 H N N 236 ILE HG22 H N N 237 ILE HG23 H N N 238 ILE HD11 H N N 239 ILE HD12 H N N 240 ILE HD13 H N N 241 ILE HXT H N N 242 LEU N N N N 243 LEU CA C N S 244 LEU C C N N 245 LEU O O N N 246 LEU CB C N N 247 LEU CG C N N 248 LEU CD1 C N N 249 LEU CD2 C N N 250 LEU OXT O N N 251 LEU H H N N 252 LEU H2 H N N 253 LEU HA H N N 254 LEU HB2 H N N 255 LEU HB3 H N N 256 LEU HG H N N 257 LEU HD11 H N N 258 LEU HD12 H N N 259 LEU HD13 H N N 260 LEU HD21 H N N 261 LEU HD22 H N N 262 LEU HD23 H N N 263 LEU HXT H N N 264 LYS N N N N 265 LYS CA C N S 266 LYS C C N N 267 LYS O O N N 268 LYS CB C N N 269 LYS CG C N N 270 LYS CD C N N 271 LYS CE C N N 272 LYS NZ N N N 273 LYS OXT O N N 274 LYS H H N N 275 LYS H2 H N N 276 LYS HA H N N 277 LYS HB2 H N N 278 LYS HB3 H N N 279 LYS HG2 H N N 280 LYS HG3 H N N 281 LYS HD2 H N N 282 LYS HD3 H N N 283 LYS HE2 H N N 284 LYS HE3 H N N 285 LYS HZ1 H N N 286 LYS HZ2 H N N 287 LYS HZ3 H N N 288 LYS HXT H N N 289 MET N N N N 290 MET CA C N S 291 MET C C N N 292 MET O O N N 293 MET CB C N N 294 MET CG C N N 295 MET SD S N N 296 MET CE C N N 297 MET OXT O N N 298 MET H H N N 299 MET H2 H N N 300 MET HA H N N 301 MET HB2 H N N 302 MET HB3 H N N 303 MET HG2 H N N 304 MET HG3 H N N 305 MET HE1 H N N 306 MET HE2 H N N 307 MET HE3 H N N 308 MET HXT H N N 309 PHE N N N N 310 PHE CA C N S 311 PHE C C N N 312 PHE O O N N 313 PHE CB C N N 314 PHE CG C Y N 315 PHE CD1 C Y N 316 PHE CD2 C Y N 317 PHE CE1 C Y N 318 PHE CE2 C Y N 319 PHE CZ C Y N 320 PHE OXT O N N 321 PHE H H N N 322 PHE H2 H N N 323 PHE HA H N N 324 PHE HB2 H N N 325 PHE HB3 H N N 326 PHE HD1 H N N 327 PHE HD2 H N N 328 PHE HE1 H N N 329 PHE HE2 H N N 330 PHE HZ H N N 331 PHE HXT H N N 332 PRO N N N N 333 PRO CA C N S 334 PRO C C N N 335 PRO O O N N 336 PRO CB C N N 337 PRO CG C N N 338 PRO CD C N N 339 PRO OXT O N N 340 PRO H H N N 341 PRO HA H N N 342 PRO HB2 H N N 343 PRO HB3 H N N 344 PRO HG2 H N N 345 PRO HG3 H N N 346 PRO HD2 H N N 347 PRO HD3 H N N 348 PRO HXT H N N 349 THR N N N N 350 THR CA C N S 351 THR C C N N 352 THR O O N N 353 THR CB C N R 354 THR OG1 O N N 355 THR CG2 C N N 356 THR OXT O N N 357 THR H H N N 358 THR H2 H N N 359 THR HA H N N 360 THR HB H N N 361 THR HG1 H N N 362 THR HG21 H N N 363 THR HG22 H N N 364 THR HG23 H N N 365 THR HXT H N N 366 TRP N N N N 367 TRP CA C N S 368 TRP C C N N 369 TRP O O N N 370 TRP CB C N N 371 TRP CG C Y N 372 TRP CD1 C Y N 373 TRP CD2 C Y N 374 TRP NE1 N Y N 375 TRP CE2 C Y N 376 TRP CE3 C Y N 377 TRP CZ2 C Y N 378 TRP CZ3 C Y N 379 TRP CH2 C Y N 380 TRP OXT O N N 381 TRP H H N N 382 TRP H2 H N N 383 TRP HA H N N 384 TRP HB2 H N N 385 TRP HB3 H N N 386 TRP HD1 H N N 387 TRP HE1 H N N 388 TRP HE3 H N N 389 TRP HZ2 H N N 390 TRP HZ3 H N N 391 TRP HH2 H N N 392 TRP HXT H N N 393 TYR N N N N 394 TYR CA C N S 395 TYR C C N N 396 TYR O O N N 397 TYR CB C N N 398 TYR CG C Y N 399 TYR CD1 C Y N 400 TYR CD2 C Y N 401 TYR CE1 C Y N 402 TYR CE2 C Y N 403 TYR CZ C Y N 404 TYR OH O N N 405 TYR OXT O N N 406 TYR H H N N 407 TYR H2 H N N 408 TYR HA H N N 409 TYR HB2 H N N 410 TYR HB3 H N N 411 TYR HD1 H N N 412 TYR HD2 H N N 413 TYR HE1 H N N 414 TYR HE2 H N N 415 TYR HH H N N 416 TYR HXT H N N 417 VAL N N N N 418 VAL CA C N S 419 VAL C C N N 420 VAL O O N N 421 VAL CB C N N 422 VAL CG1 C N N 423 VAL CG2 C N N 424 VAL OXT O N N 425 VAL H H N N 426 VAL H2 H N N 427 VAL HA H N N 428 VAL HB H N N 429 VAL HG11 H N N 430 VAL HG12 H N N 431 VAL HG13 H N N 432 VAL HG21 H N N 433 VAL HG22 H N N 434 VAL HG23 H N N 435 VAL HXT H N N 436 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 8OC C10 C12 sing N N 1 8OC C10 O11 sing N N 2 8OC C12 C13 sing N N 3 8OC C12 C21 sing N N 4 8OC C12 C23 sing N N 5 8OC C13 C14 sing N N 6 8OC C14 C15 doub Y N 7 8OC C14 C20 sing Y N 8 8OC C15 C16 sing Y N 9 8OC C01 O02 sing N N 10 8OC C03 C04 doub Y N 11 8OC C03 C34 sing Y N 12 8OC C03 O02 sing N N 13 8OC C04 C05 sing Y N 14 8OC C05 C06 doub Y N 15 8OC C06 C07 sing N N 16 8OC C06 C33 sing Y N 17 8OC C07 N08 sing N N 18 8OC C09 N08 sing N N 19 8OC C16 C17 doub Y N 20 8OC C17 C19 sing Y N 21 8OC C17 F18 sing N N 22 8OC C19 C20 doub Y N 23 8OC C21 N08 sing N N 24 8OC C21 O22 doub N N 25 8OC C23 C24 doub Y N 26 8OC C23 C28 sing Y N 27 8OC C24 C25 sing Y N 28 8OC C25 C26 doub Y N 29 8OC C26 C27 sing Y N 30 8OC C26 S29 sing N N 31 8OC C27 C28 doub Y N 32 8OC C30 S29 sing N N 33 8OC C33 C34 doub Y N 34 8OC O31 S29 doub N N 35 8OC O32 S29 doub N N 36 8OC C10 H1 sing N N 37 8OC C13 H3 sing N N 38 8OC C13 H4 sing N N 39 8OC C15 H5 sing N N 40 8OC C01 H6 sing N N 41 8OC C01 H7 sing N N 42 8OC C01 H8 sing N N 43 8OC C04 H9 sing N N 44 8OC C05 H10 sing N N 45 8OC C07 H11 sing N N 46 8OC C07 H12 sing N N 47 8OC C09 H14 sing N N 48 8OC C09 H15 sing N N 49 8OC C16 H16 sing N N 50 8OC C19 H17 sing N N 51 8OC C20 H18 sing N N 52 8OC C24 H19 sing N N 53 8OC C25 H20 sing N N 54 8OC C27 H21 sing N N 55 8OC C28 H22 sing N N 56 8OC C30 H23 sing N N 57 8OC C30 H24 sing N N 58 8OC C30 H25 sing N N 59 8OC C33 H26 sing N N 60 8OC C34 H27 sing N N 61 8OC O11 H28 sing N N 62 8OC C10 C09 sing N N 63 ALA N CA sing N N 64 ALA N H sing N N 65 ALA N H2 sing N N 66 ALA CA C sing N N 67 ALA CA CB sing N N 68 ALA CA HA sing N N 69 ALA C O doub N N 70 ALA C OXT sing N N 71 ALA CB HB1 sing N N 72 ALA CB HB2 sing N N 73 ALA CB HB3 sing N N 74 ALA OXT HXT sing N N 75 ARG N CA sing N N 76 ARG N H sing N N 77 ARG N H2 sing N N 78 ARG CA C sing N N 79 ARG CA CB sing N N 80 ARG CA HA sing N N 81 ARG C O doub N N 82 ARG C OXT sing N N 83 ARG CB CG sing N N 84 ARG CB HB2 sing N N 85 ARG CB HB3 sing N N 86 ARG CG CD sing N N 87 ARG CG HG2 sing N N 88 ARG CG HG3 sing N N 89 ARG CD NE sing N N 90 ARG CD HD2 sing N N 91 ARG CD HD3 sing N N 92 ARG NE CZ sing N N 93 ARG NE HE sing N N 94 ARG CZ NH1 sing N N 95 ARG CZ NH2 doub N N 96 ARG NH1 HH11 sing N N 97 ARG NH1 HH12 sing N N 98 ARG NH2 HH21 sing N N 99 ARG NH2 HH22 sing N N 100 ARG OXT HXT sing N N 101 ASN N CA sing N N 102 ASN N H sing N N 103 ASN N H2 sing N N 104 ASN CA C sing N N 105 ASN CA CB sing N N 106 ASN CA HA sing N N 107 ASN C O doub N N 108 ASN C OXT sing N N 109 ASN CB CG sing N N 110 ASN CB HB2 sing N N 111 ASN CB HB3 sing N N 112 ASN CG OD1 doub N N 113 ASN CG ND2 sing N N 114 ASN ND2 HD21 sing N N 115 ASN ND2 HD22 sing N N 116 ASN OXT HXT sing N N 117 ASP N CA sing N N 118 ASP N H sing N N 119 ASP N H2 sing N N 120 ASP CA C sing N N 121 ASP CA CB sing N N 122 ASP CA HA sing N N 123 ASP C O doub N N 124 ASP C OXT sing N N 125 ASP CB CG sing N N 126 ASP CB HB2 sing N N 127 ASP CB HB3 sing N N 128 ASP CG OD1 doub N N 129 ASP CG OD2 sing N N 130 ASP OD2 HD2 sing N N 131 ASP OXT HXT sing N N 132 CYS N CA sing N N 133 CYS N H sing N N 134 CYS N H2 sing N N 135 CYS CA C sing N N 136 CYS CA CB sing N N 137 CYS CA HA sing N N 138 CYS C O doub N N 139 CYS C OXT sing N N 140 CYS CB SG sing N N 141 CYS CB HB2 sing N N 142 CYS CB HB3 sing N N 143 CYS SG HG sing N N 144 CYS OXT HXT sing N N 145 GLN N CA sing N N 146 GLN N H sing N N 147 GLN N H2 sing N N 148 GLN CA C sing N N 149 GLN CA CB sing N N 150 GLN CA HA sing N N 151 GLN C O doub N N 152 GLN C OXT sing N N 153 GLN CB CG sing N N 154 GLN CB HB2 sing N N 155 GLN CB HB3 sing N N 156 GLN CG CD sing N N 157 GLN CG HG2 sing N N 158 GLN CG HG3 sing N N 159 GLN CD OE1 doub N N 160 GLN CD NE2 sing N N 161 GLN NE2 HE21 sing N N 162 GLN NE2 HE22 sing N N 163 GLN OXT HXT sing N N 164 GLU N CA sing N N 165 GLU N H sing N N 166 GLU N H2 sing N N 167 GLU CA C sing N N 168 GLU CA CB sing N N 169 GLU CA HA sing N N 170 GLU C O doub N N 171 GLU C OXT sing N N 172 GLU CB CG sing N N 173 GLU CB HB2 sing N N 174 GLU CB HB3 sing N N 175 GLU CG CD sing N N 176 GLU CG HG2 sing N N 177 GLU CG HG3 sing N N 178 GLU CD OE1 doub N N 179 GLU CD OE2 sing N N 180 GLU OE2 HE2 sing N N 181 GLU OXT HXT sing N N 182 GLY N CA sing N N 183 GLY N H sing N N 184 GLY N H2 sing N N 185 GLY CA C sing N N 186 GLY CA HA2 sing N N 187 GLY CA HA3 sing N N 188 GLY C O doub N N 189 GLY C OXT sing N N 190 GLY OXT HXT sing N N 191 HIS N CA sing N N 192 HIS N H sing N N 193 HIS N H2 sing N N 194 HIS CA C sing N N 195 HIS CA CB sing N N 196 HIS CA HA sing N N 197 HIS C O doub N N 198 HIS C OXT sing N N 199 HIS CB CG sing N N 200 HIS CB HB2 sing N N 201 HIS CB HB3 sing N N 202 HIS CG ND1 sing Y N 203 HIS CG CD2 doub Y N 204 HIS ND1 CE1 doub Y N 205 HIS ND1 HD1 sing N N 206 HIS CD2 NE2 sing Y N 207 HIS CD2 HD2 sing N N 208 HIS CE1 NE2 sing Y N 209 HIS CE1 HE1 sing N N 210 HIS NE2 HE2 sing N N 211 HIS OXT HXT sing N N 212 HOH O H1 sing N N 213 HOH O H2 sing N N 214 ILE N CA sing N N 215 ILE N H sing N N 216 ILE N H2 sing N N 217 ILE CA C sing N N 218 ILE CA CB sing N N 219 ILE CA HA sing N N 220 ILE C O doub N N 221 ILE C OXT sing N N 222 ILE CB CG1 sing N N 223 ILE CB CG2 sing N N 224 ILE CB HB sing N N 225 ILE CG1 CD1 sing N N 226 ILE CG1 HG12 sing N N 227 ILE CG1 HG13 sing N N 228 ILE CG2 HG21 sing N N 229 ILE CG2 HG22 sing N N 230 ILE CG2 HG23 sing N N 231 ILE CD1 HD11 sing N N 232 ILE CD1 HD12 sing N N 233 ILE CD1 HD13 sing N N 234 ILE OXT HXT sing N N 235 LEU N CA sing N N 236 LEU N H sing N N 237 LEU N H2 sing N N 238 LEU CA C sing N N 239 LEU CA CB sing N N 240 LEU CA HA sing N N 241 LEU C O doub N N 242 LEU C OXT sing N N 243 LEU CB CG sing N N 244 LEU CB HB2 sing N N 245 LEU CB HB3 sing N N 246 LEU CG CD1 sing N N 247 LEU CG CD2 sing N N 248 LEU CG HG sing N N 249 LEU CD1 HD11 sing N N 250 LEU CD1 HD12 sing N N 251 LEU CD1 HD13 sing N N 252 LEU CD2 HD21 sing N N 253 LEU CD2 HD22 sing N N 254 LEU CD2 HD23 sing N N 255 LEU OXT HXT sing N N 256 LYS N CA sing N N 257 LYS N H sing N N 258 LYS N H2 sing N N 259 LYS CA C sing N N 260 LYS CA CB sing N N 261 LYS CA HA sing N N 262 LYS C O doub N N 263 LYS C OXT sing N N 264 LYS CB CG sing N N 265 LYS CB HB2 sing N N 266 LYS CB HB3 sing N N 267 LYS CG CD sing N N 268 LYS CG HG2 sing N N 269 LYS CG HG3 sing N N 270 LYS CD CE sing N N 271 LYS CD HD2 sing N N 272 LYS CD HD3 sing N N 273 LYS CE NZ sing N N 274 LYS CE HE2 sing N N 275 LYS CE HE3 sing N N 276 LYS NZ HZ1 sing N N 277 LYS NZ HZ2 sing N N 278 LYS NZ HZ3 sing N N 279 LYS OXT HXT sing N N 280 MET N CA sing N N 281 MET N H sing N N 282 MET N H2 sing N N 283 MET CA C sing N N 284 MET CA CB sing N N 285 MET CA HA sing N N 286 MET C O doub N N 287 MET C OXT sing N N 288 MET CB CG sing N N 289 MET CB HB2 sing N N 290 MET CB HB3 sing N N 291 MET CG SD sing N N 292 MET CG HG2 sing N N 293 MET CG HG3 sing N N 294 MET SD CE sing N N 295 MET CE HE1 sing N N 296 MET CE HE2 sing N N 297 MET CE HE3 sing N N 298 MET OXT HXT sing N N 299 PHE N CA sing N N 300 PHE N H sing N N 301 PHE N H2 sing N N 302 PHE CA C sing N N 303 PHE CA CB sing N N 304 PHE CA HA sing N N 305 PHE C O doub N N 306 PHE C OXT sing N N 307 PHE CB CG sing N N 308 PHE CB HB2 sing N N 309 PHE CB HB3 sing N N 310 PHE CG CD1 doub Y N 311 PHE CG CD2 sing Y N 312 PHE CD1 CE1 sing Y N 313 PHE CD1 HD1 sing N N 314 PHE CD2 CE2 doub Y N 315 PHE CD2 HD2 sing N N 316 PHE CE1 CZ doub Y N 317 PHE CE1 HE1 sing N N 318 PHE CE2 CZ sing Y N 319 PHE CE2 HE2 sing N N 320 PHE CZ HZ sing N N 321 PHE OXT HXT sing N N 322 PRO N CA sing N N 323 PRO N CD sing N N 324 PRO N H sing N N 325 PRO CA C sing N N 326 PRO CA CB sing N N 327 PRO CA HA sing N N 328 PRO C O doub N N 329 PRO C OXT sing N N 330 PRO CB CG sing N N 331 PRO CB HB2 sing N N 332 PRO CB HB3 sing N N 333 PRO CG CD sing N N 334 PRO CG HG2 sing N N 335 PRO CG HG3 sing N N 336 PRO CD HD2 sing N N 337 PRO CD HD3 sing N N 338 PRO OXT HXT sing N N 339 THR N CA sing N N 340 THR N H sing N N 341 THR N H2 sing N N 342 THR CA C sing N N 343 THR CA CB sing N N 344 THR CA HA sing N N 345 THR C O doub N N 346 THR C OXT sing N N 347 THR CB OG1 sing N N 348 THR CB CG2 sing N N 349 THR CB HB sing N N 350 THR OG1 HG1 sing N N 351 THR CG2 HG21 sing N N 352 THR CG2 HG22 sing N N 353 THR CG2 HG23 sing N N 354 THR OXT HXT sing N N 355 TRP N CA sing N N 356 TRP N H sing N N 357 TRP N H2 sing N N 358 TRP CA C sing N N 359 TRP CA CB sing N N 360 TRP CA HA sing N N 361 TRP C O doub N N 362 TRP C OXT sing N N 363 TRP CB CG sing N N 364 TRP CB HB2 sing N N 365 TRP CB HB3 sing N N 366 TRP CG CD1 doub Y N 367 TRP CG CD2 sing Y N 368 TRP CD1 NE1 sing Y N 369 TRP CD1 HD1 sing N N 370 TRP CD2 CE2 doub Y N 371 TRP CD2 CE3 sing Y N 372 TRP NE1 CE2 sing Y N 373 TRP NE1 HE1 sing N N 374 TRP CE2 CZ2 sing Y N 375 TRP CE3 CZ3 doub Y N 376 TRP CE3 HE3 sing N N 377 TRP CZ2 CH2 doub Y N 378 TRP CZ2 HZ2 sing N N 379 TRP CZ3 CH2 sing Y N 380 TRP CZ3 HZ3 sing N N 381 TRP CH2 HH2 sing N N 382 TRP OXT HXT sing N N 383 TYR N CA sing N N 384 TYR N H sing N N 385 TYR N H2 sing N N 386 TYR CA C sing N N 387 TYR CA CB sing N N 388 TYR CA HA sing N N 389 TYR C O doub N N 390 TYR C OXT sing N N 391 TYR CB CG sing N N 392 TYR CB HB2 sing N N 393 TYR CB HB3 sing N N 394 TYR CG CD1 doub Y N 395 TYR CG CD2 sing Y N 396 TYR CD1 CE1 sing Y N 397 TYR CD1 HD1 sing N N 398 TYR CD2 CE2 doub Y N 399 TYR CD2 HD2 sing N N 400 TYR CE1 CZ doub Y N 401 TYR CE1 HE1 sing N N 402 TYR CE2 CZ sing Y N 403 TYR CE2 HE2 sing N N 404 TYR CZ OH sing N N 405 TYR OH HH sing N N 406 TYR OXT HXT sing N N 407 VAL N CA sing N N 408 VAL N H sing N N 409 VAL N H2 sing N N 410 VAL CA C sing N N 411 VAL CA CB sing N N 412 VAL CA HA sing N N 413 VAL C O doub N N 414 VAL C OXT sing N N 415 VAL CB CG1 sing N N 416 VAL CB CG2 sing N N 417 VAL CB HB sing N N 418 VAL CG1 HG11 sing N N 419 VAL CG1 HG12 sing N N 420 VAL CG1 HG13 sing N N 421 VAL CG2 HG21 sing N N 422 VAL CG2 HG22 sing N N 423 VAL CG2 HG23 sing N N 424 VAL OXT HXT sing N N 425 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(3R,4R)-3-[(4-fluorophenyl)methyl]-1-[(4-methoxyphenyl)methyl]-3-(4-methylsulfonylphenyl)-4-oxidanyl-pyrrolidin-2-one' 8OC 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4LL3 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #