data_7WFY # _entry.id 7WFY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7WFY pdb_00007wfy 10.2210/pdb7wfy/pdb WWPDB D_1300024682 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-12-07 2 'Structure model' 1 1 2023-11-29 3 'Structure model' 1 2 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' 3 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model 4 3 'Structure model' pdbx_entry_details 5 3 'Structure model' pdbx_modification_feature # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 3 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7WFY _pdbx_database_status.recvd_initial_deposition_date 2021-12-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email wubo@hmfl.ac.cn _pdbx_contact_author.name_first Bo _pdbx_contact_author.name_last Wu _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-4556-0477 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhang, Y.J.' 1 0000-0002-3592-1454 'Liu, Y.R.' 2 0000-0001-8526-5566 'Wu, B.' 3 0000-0003-4556-0477 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first 12752 _citation.page_last 12752 _citation.title 'Vav2 is a novel APP-interacting protein that regulates APP protein level.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41598-022-16883-z _citation.pdbx_database_id_PubMed 35882892 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, Y.' 1 ? primary 'Yang, X.' 2 ? primary 'Liu, Y.' 3 ? primary 'Ge, L.' 4 ? primary 'Wang, J.' 5 ? primary 'Sun, X.' 6 ? primary 'Wu, B.' 7 ? primary 'Wang, J.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Guanine nucleotide exchange factor VAV2' 13893.665 1 ? ? ? ? 2 polymer syn 'Amyloid beta A4 protein-binding family B member 1 (protein)' 1001.887 1 ? ? ? ? 3 water nat water 18.015 8 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name VAV-2 # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GSHMSRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDNWIHITEA KKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRE ; ;GSHMSRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDNWIHITEA KKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRE ; C ? 2 'polypeptide(L)' no yes 'QNG(PTR)ENPT' QNGYENPT A ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 SER n 1 6 ARG n 1 7 PRO n 1 8 PRO n 1 9 SER n 1 10 ARG n 1 11 GLU n 1 12 ILE n 1 13 ASP n 1 14 TYR n 1 15 THR n 1 16 ALA n 1 17 TYR n 1 18 PRO n 1 19 TRP n 1 20 PHE n 1 21 ALA n 1 22 GLY n 1 23 ASN n 1 24 MET n 1 25 GLU n 1 26 ARG n 1 27 GLN n 1 28 GLN n 1 29 THR n 1 30 ASP n 1 31 ASN n 1 32 LEU n 1 33 LEU n 1 34 LYS n 1 35 SER n 1 36 HIS n 1 37 ALA n 1 38 SER n 1 39 GLY n 1 40 THR n 1 41 TYR n 1 42 LEU n 1 43 ILE n 1 44 ARG n 1 45 GLU n 1 46 ARG n 1 47 PRO n 1 48 ALA n 1 49 GLU n 1 50 ALA n 1 51 GLU n 1 52 ARG n 1 53 PHE n 1 54 ALA n 1 55 ILE n 1 56 SER n 1 57 ILE n 1 58 LYS n 1 59 PHE n 1 60 ASN n 1 61 ASP n 1 62 GLU n 1 63 VAL n 1 64 LYS n 1 65 HIS n 1 66 ILE n 1 67 LYS n 1 68 VAL n 1 69 VAL n 1 70 GLU n 1 71 LYS n 1 72 ASP n 1 73 ASN n 1 74 TRP n 1 75 ILE n 1 76 HIS n 1 77 ILE n 1 78 THR n 1 79 GLU n 1 80 ALA n 1 81 LYS n 1 82 LYS n 1 83 PHE n 1 84 ASP n 1 85 SER n 1 86 LEU n 1 87 LEU n 1 88 GLU n 1 89 LEU n 1 90 VAL n 1 91 GLU n 1 92 TYR n 1 93 TYR n 1 94 GLN n 1 95 CYS n 1 96 HIS n 1 97 SER n 1 98 LEU n 1 99 LYS n 1 100 GLU n 1 101 SER n 1 102 PHE n 1 103 LYS n 1 104 GLN n 1 105 LEU n 1 106 ASP n 1 107 THR n 1 108 THR n 1 109 LEU n 1 110 LYS n 1 111 TYR n 1 112 PRO n 1 113 TYR n 1 114 LYS n 1 115 SER n 1 116 ARG n 1 117 GLU n 2 1 GLN n 2 2 ASN n 2 3 GLY n 2 4 PTR n 2 5 GLU n 2 6 ASN n 2 7 PRO n 2 8 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 117 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene VAV2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 8 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P' 261.168 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 655 ? ? ? C . n A 1 2 SER 2 656 ? ? ? C . n A 1 3 HIS 3 657 ? ? ? C . n A 1 4 MET 4 658 ? ? ? C . n A 1 5 SER 5 659 ? ? ? C . n A 1 6 ARG 6 660 ? ? ? C . n A 1 7 PRO 7 661 ? ? ? C . n A 1 8 PRO 8 662 ? ? ? C . n A 1 9 SER 9 663 ? ? ? C . n A 1 10 ARG 10 664 ? ? ? C . n A 1 11 GLU 11 665 665 GLU GLU C . n A 1 12 ILE 12 666 666 ILE ILE C . n A 1 13 ASP 13 667 667 ASP ASP C . n A 1 14 TYR 14 668 668 TYR TYR C . n A 1 15 THR 15 669 669 THR THR C . n A 1 16 ALA 16 670 670 ALA ALA C . n A 1 17 TYR 17 671 671 TYR TYR C . n A 1 18 PRO 18 672 672 PRO PRO C . n A 1 19 TRP 19 673 673 TRP TRP C . n A 1 20 PHE 20 674 674 PHE PHE C . n A 1 21 ALA 21 675 675 ALA ALA C . n A 1 22 GLY 22 676 676 GLY GLY C . n A 1 23 ASN 23 677 677 ASN ASN C . n A 1 24 MET 24 678 678 MET MET C . n A 1 25 GLU 25 679 679 GLU GLU C . n A 1 26 ARG 26 680 680 ARG ARG C . n A 1 27 GLN 27 681 681 GLN GLN C . n A 1 28 GLN 28 682 682 GLN GLN C . n A 1 29 THR 29 683 683 THR THR C . n A 1 30 ASP 30 684 684 ASP ASP C . n A 1 31 ASN 31 685 685 ASN ASN C . n A 1 32 LEU 32 686 686 LEU LEU C . n A 1 33 LEU 33 687 687 LEU LEU C . n A 1 34 LYS 34 688 688 LYS LYS C . n A 1 35 SER 35 689 689 SER SER C . n A 1 36 HIS 36 690 690 HIS HIS C . n A 1 37 ALA 37 691 691 ALA ALA C . n A 1 38 SER 38 692 692 SER SER C . n A 1 39 GLY 39 693 693 GLY GLY C . n A 1 40 THR 40 694 694 THR THR C . n A 1 41 TYR 41 695 695 TYR TYR C . n A 1 42 LEU 42 696 696 LEU LEU C . n A 1 43 ILE 43 697 697 ILE ILE C . n A 1 44 ARG 44 698 698 ARG ARG C . n A 1 45 GLU 45 699 699 GLU GLU C . n A 1 46 ARG 46 700 700 ARG ARG C . n A 1 47 PRO 47 701 701 PRO PRO C . n A 1 48 ALA 48 702 702 ALA ALA C . n A 1 49 GLU 49 703 703 GLU GLU C . n A 1 50 ALA 50 704 704 ALA ALA C . n A 1 51 GLU 51 705 705 GLU GLU C . n A 1 52 ARG 52 706 706 ARG ARG C . n A 1 53 PHE 53 707 707 PHE PHE C . n A 1 54 ALA 54 708 708 ALA ALA C . n A 1 55 ILE 55 709 709 ILE ILE C . n A 1 56 SER 56 710 710 SER SER C . n A 1 57 ILE 57 711 711 ILE ILE C . n A 1 58 LYS 58 712 712 LYS LYS C . n A 1 59 PHE 59 713 713 PHE PHE C . n A 1 60 ASN 60 714 714 ASN ASN C . n A 1 61 ASP 61 715 715 ASP ASP C . n A 1 62 GLU 62 716 716 GLU GLU C . n A 1 63 VAL 63 717 717 VAL VAL C . n A 1 64 LYS 64 718 718 LYS LYS C . n A 1 65 HIS 65 719 719 HIS HIS C . n A 1 66 ILE 66 720 720 ILE ILE C . n A 1 67 LYS 67 721 721 LYS LYS C . n A 1 68 VAL 68 722 722 VAL VAL C . n A 1 69 VAL 69 723 723 VAL VAL C . n A 1 70 GLU 70 724 724 GLU GLU C . n A 1 71 LYS 71 725 725 LYS LYS C . n A 1 72 ASP 72 726 726 ASP ASP C . n A 1 73 ASN 73 727 727 ASN ASN C . n A 1 74 TRP 74 728 728 TRP TRP C . n A 1 75 ILE 75 729 729 ILE ILE C . n A 1 76 HIS 76 730 730 HIS HIS C . n A 1 77 ILE 77 731 731 ILE ILE C . n A 1 78 THR 78 732 732 THR THR C . n A 1 79 GLU 79 733 733 GLU GLU C . n A 1 80 ALA 80 734 734 ALA ALA C . n A 1 81 LYS 81 735 735 LYS LYS C . n A 1 82 LYS 82 736 736 LYS LYS C . n A 1 83 PHE 83 737 737 PHE PHE C . n A 1 84 ASP 84 738 738 ASP ASP C . n A 1 85 SER 85 739 739 SER SER C . n A 1 86 LEU 86 740 740 LEU LEU C . n A 1 87 LEU 87 741 741 LEU LEU C . n A 1 88 GLU 88 742 742 GLU GLU C . n A 1 89 LEU 89 743 743 LEU LEU C . n A 1 90 VAL 90 744 744 VAL VAL C . n A 1 91 GLU 91 745 745 GLU GLU C . n A 1 92 TYR 92 746 746 TYR TYR C . n A 1 93 TYR 93 747 747 TYR TYR C . n A 1 94 GLN 94 748 748 GLN GLN C . n A 1 95 CYS 95 749 749 CYS CYS C . n A 1 96 HIS 96 750 750 HIS HIS C . n A 1 97 SER 97 751 751 SER SER C . n A 1 98 LEU 98 752 752 LEU LEU C . n A 1 99 LYS 99 753 753 LYS LYS C . n A 1 100 GLU 100 754 754 GLU GLU C . n A 1 101 SER 101 755 755 SER SER C . n A 1 102 PHE 102 756 756 PHE PHE C . n A 1 103 LYS 103 757 757 LYS LYS C . n A 1 104 GLN 104 758 758 GLN GLN C . n A 1 105 LEU 105 759 759 LEU LEU C . n A 1 106 ASP 106 760 760 ASP ASP C . n A 1 107 THR 107 761 761 THR THR C . n A 1 108 THR 108 762 762 THR THR C . n A 1 109 LEU 109 763 763 LEU LEU C . n A 1 110 LYS 110 764 764 LYS LYS C . n A 1 111 TYR 111 765 765 TYR TYR C . n A 1 112 PRO 112 766 766 PRO PRO C . n A 1 113 TYR 113 767 767 TYR TYR C . n A 1 114 LYS 114 768 768 LYS LYS C . n A 1 115 SER 115 769 769 SER SER C . n A 1 116 ARG 116 770 ? ? ? C . n A 1 117 GLU 117 771 ? ? ? C . n B 2 1 GLN 1 -2 ? ? ? A . n B 2 2 ASN 2 -1 -1 ASN ASN A . n B 2 3 GLY 3 0 0 GLY GLY A . n B 2 4 PTR 4 1 1 PTR PTR A . n B 2 5 GLU 5 2 2 GLU GLU A . n B 2 6 ASN 6 3 3 ASN ASN A . n B 2 7 PRO 7 4 4 PRO PRO A . n B 2 8 THR 8 5 5 THR THR A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id PTR _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id PTR _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 801 9 HOH HOH C . C 3 HOH 2 802 4 HOH HOH C . C 3 HOH 3 803 10 HOH HOH C . C 3 HOH 4 804 5 HOH HOH C . C 3 HOH 5 805 2 HOH HOH C . C 3 HOH 6 806 3 HOH HOH C . C 3 HOH 7 807 12 HOH HOH C . D 3 HOH 1 101 13 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 C LYS 688 ? CD ? A LYS 34 CD 2 1 Y 1 C LYS 688 ? CE ? A LYS 34 CE 3 1 Y 1 C LYS 688 ? NZ ? A LYS 34 NZ 4 1 Y 1 C LYS 712 ? CG ? A LYS 58 CG 5 1 Y 1 C LYS 712 ? CD ? A LYS 58 CD 6 1 Y 1 C LYS 712 ? CE ? A LYS 58 CE 7 1 Y 1 C LYS 712 ? NZ ? A LYS 58 NZ 8 1 Y 1 C LYS 757 ? CG ? A LYS 103 CG 9 1 Y 1 C LYS 757 ? CD ? A LYS 103 CD 10 1 Y 1 C LYS 757 ? CE ? A LYS 103 CE 11 1 Y 1 C LYS 757 ? NZ ? A LYS 103 NZ 12 1 Y 1 A ASN -1 ? CG ? B ASN 2 CG 13 1 Y 1 A ASN -1 ? OD1 ? B ASN 2 OD1 14 1 Y 1 A ASN -1 ? ND2 ? B ASN 2 ND2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10-2155 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7WFY _cell.details ? _cell.formula_units_Z ? _cell.length_a 62.743 _cell.length_a_esd ? _cell.length_b 109.589 _cell.length_b_esd ? _cell.length_c 41.369 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7WFY _symmetry.cell_setting ? _symmetry.Int_Tables_number 21 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7WFY _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.39 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.47 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.4 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '25% PEG 3350, 0.2 M Magnesium chloride hexahydrate, 0.1 M, Tris/HCl, pH 8.4' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-06-08 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL18U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL18U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 36.070 _reflns.entry_id 7WFY _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.449 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5538 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.7 _reflns.pdbx_Rmerge_I_obs 0.085 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 26.33 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.45 _reflns_shell.d_res_low 2.49 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 272 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.347 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 91.380 _refine.B_iso_mean 39.7782 _refine.B_iso_min 18.520 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7WFY _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.4490 _refine.ls_d_res_low 41.3690 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5421 _refine.ls_number_reflns_R_free 583 _refine.ls_number_reflns_R_work 4838 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.8300 _refine.ls_percent_reflns_R_free 10.7500 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2319 _refine.ls_R_factor_R_free 0.2678 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2275 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.380 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3MXC _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.1100 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3400 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.4490 _refine_hist.d_res_low 41.3690 _refine_hist.number_atoms_solvent 8 _refine_hist.number_atoms_total 936 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 112 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 26.24 _refine_hist.pdbx_number_atoms_protein 928 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 951 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.995 ? 1288 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.054 ? 136 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 163 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 17.139 ? 563 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.449 2.6950 . . 153 1132 95.0000 . . . 0.3642 0.0000 0.2991 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6950 3.0849 . . 142 1194 99.0000 . . . 0.3536 0.0000 0.2994 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0849 3.8862 . . 143 1228 100.0000 . . . 0.2788 0.0000 0.2278 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.8862 41.3690 . . 145 1284 98.0000 . . . 0.2012 0.0000 0.1825 . . . . . . . . . . . # _struct.entry_id 7WFY _struct.title 'Crystal Structure of the VAV2 SH2 domain in complex with APP phosphorylated peptide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7WFY _struct_keywords.text 'Complex, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP VAV2_HUMAN P52735 ? 1 ;SRPPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDNWIHITEAKKFD SLLELVEYYQCHSLKESFKQLDTTLKYPYKSRE ; 659 2 PDB 7WFY 7WFY ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7WFY C 5 ? 117 ? P52735 659 ? 771 ? 659 771 2 2 7WFY A 1 ? 8 ? 7WFY -2 ? 5 ? -2 5 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7WFY GLY C 1 ? UNP P52735 ? ? 'expression tag' 655 1 1 7WFY SER C 2 ? UNP P52735 ? ? 'expression tag' 656 2 1 7WFY HIS C 3 ? UNP P52735 ? ? 'expression tag' 657 3 1 7WFY MET C 4 ? UNP P52735 ? ? 'expression tag' 658 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 890 ? 1 MORE -4 ? 1 'SSA (A^2)' 6220 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 13 ? TYR A 17 ? ASP C 667 TYR C 671 5 ? 5 HELX_P HELX_P2 AA2 GLU A 25 ? LYS A 34 ? GLU C 679 LYS C 688 1 ? 10 HELX_P HELX_P3 AA3 SER A 85 ? GLN A 94 ? SER C 739 GLN C 748 1 ? 10 HELX_P HELX_P4 AA4 SER A 97 ? SER A 101 ? SER C 751 SER C 755 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 95 SG ? ? ? 1_555 A CYS 95 SG ? ? C CYS 749 C CYS 749 4_555 ? ? ? ? ? ? ? 2.050 ? ? covale1 covale both ? B GLY 3 C ? ? ? 1_555 B PTR 4 N ? ? A GLY 0 A PTR 1 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale2 covale both ? B PTR 4 C ? ? ? 1_555 B GLU 5 N ? ? A PTR 1 A GLU 2 1_555 ? ? ? ? ? ? ? 1.336 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 PTR B 4 ? . . . . PTR A 1 ? 1_555 . . . . . . . TYR 1 PTR Phosphorylation 'Named protein modification' 2 CYS A 95 ? CYS A 95 ? CYS C 749 ? 1_555 CYS C 749 ? 4_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 20 ? ASN A 23 ? PHE C 674 ASN C 677 AA1 2 THR A 40 ? GLU A 45 ? THR C 694 GLU C 699 AA1 3 PHE A 53 ? PHE A 59 ? PHE C 707 PHE C 713 AA1 4 GLU A 62 ? LYS A 71 ? GLU C 716 LYS C 725 AA1 5 TRP A 74 ? THR A 78 ? TRP C 728 THR C 732 AA1 6 LYS A 81 ? PHE A 83 ? LYS C 735 PHE C 737 AA2 1 PHE A 20 ? ASN A 23 ? PHE C 674 ASN C 677 AA2 2 THR A 40 ? GLU A 45 ? THR C 694 GLU C 699 AA2 3 TYR A 111 ? PRO A 112 ? TYR C 765 PRO C 766 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 22 ? N GLY C 676 O GLU A 45 ? O GLU C 699 AA1 2 3 N LEU A 42 ? N LEU C 696 O SER A 56 ? O SER C 710 AA1 3 4 N PHE A 53 ? N PHE C 707 O VAL A 68 ? O VAL C 722 AA1 4 5 N VAL A 69 ? N VAL C 723 O HIS A 76 ? O HIS C 730 AA1 5 6 N ILE A 75 ? N ILE C 729 O PHE A 83 ? O PHE C 737 AA2 1 2 N GLY A 22 ? N GLY C 676 O GLU A 45 ? O GLU C 699 AA2 2 3 N TYR A 41 ? N TYR C 695 O TYR A 111 ? O TYR C 765 # _pdbx_entry_details.entry_id 7WFY _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 O _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 PTR _pdbx_validate_rmsd_angle.auth_seq_id_1 1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 C _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 PTR _pdbx_validate_rmsd_angle.auth_seq_id_2 1 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 N _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 GLU _pdbx_validate_rmsd_angle.auth_seq_id_3 2 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 108.28 _pdbx_validate_rmsd_angle.angle_target_value 122.70 _pdbx_validate_rmsd_angle.angle_deviation -14.42 _pdbx_validate_rmsd_angle.angle_standard_deviation 1.60 _pdbx_validate_rmsd_angle.linker_flag Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO C 672 ? ? -69.33 0.19 2 1 LEU C 759 ? ? -157.47 68.44 3 1 LYS C 768 ? ? -86.85 41.57 4 1 PTR A 1 ? ? -100.35 -144.64 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id PTR _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 1 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle 28.32 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id C _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 806 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 14.8754 12.2328 -6.6981 0.2999 ? 0.0647 ? -0.0258 ? 0.3835 ? -0.0754 ? 0.2507 ? 3.6403 ? -0.0166 ? -0.5904 ? 8.4711 ? -1.4368 ? 1.8913 ? 0.1820 ? 0.2948 ? -0.2135 ? -1.2639 ? -0.1369 ? -0.1674 ? 0.2573 ? 0.2264 ? -0.0868 ? 2 'X-RAY DIFFRACTION' ? refined 8.7820 18.5960 -14.5665 0.9457 ? 0.1655 ? -0.2000 ? 0.6200 ? -0.0866 ? 0.4268 ? 0.8963 ? 2.7818 ? -2.2238 ? 1.9984 ? -4.7081 ? 6.3265 ? 1.1873 ? 0.9146 ? -0.2495 ? -1.2984 ? 0.0884 ? 2.1709 ? -0.4616 ? -1.1887 ? 2.7717 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? C 665 ? ? ? C 769 ? ? ;(chain 'C' and resid 665 through 769) ; 2 'X-RAY DIFFRACTION' 2 ? ? A -1 ? ? ? A 5 ? ? ;(chain 'A' and resid -1 through 5) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 C GLY 655 ? A GLY 1 2 1 Y 1 C SER 656 ? A SER 2 3 1 Y 1 C HIS 657 ? A HIS 3 4 1 Y 1 C MET 658 ? A MET 4 5 1 Y 1 C SER 659 ? A SER 5 6 1 Y 1 C ARG 660 ? A ARG 6 7 1 Y 1 C PRO 661 ? A PRO 7 8 1 Y 1 C PRO 662 ? A PRO 8 9 1 Y 1 C SER 663 ? A SER 9 10 1 Y 1 C ARG 664 ? A ARG 10 11 1 Y 1 C ARG 770 ? A ARG 116 12 1 Y 1 C GLU 771 ? A GLU 117 13 1 Y 1 A GLN -2 ? B GLN 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 PTR N N N N 290 PTR CA C N S 291 PTR C C N N 292 PTR O O N N 293 PTR OXT O N N 294 PTR CB C N N 295 PTR CG C Y N 296 PTR CD1 C Y N 297 PTR CD2 C Y N 298 PTR CE1 C Y N 299 PTR CE2 C Y N 300 PTR CZ C Y N 301 PTR OH O N N 302 PTR P P N N 303 PTR O1P O N N 304 PTR O2P O N N 305 PTR O3P O N N 306 PTR H H N N 307 PTR H2 H N N 308 PTR HA H N N 309 PTR HXT H N N 310 PTR HB2 H N N 311 PTR HB3 H N N 312 PTR HD1 H N N 313 PTR HD2 H N N 314 PTR HE1 H N N 315 PTR HE2 H N N 316 PTR HO2P H N N 317 PTR HO3P H N N 318 SER N N N N 319 SER CA C N S 320 SER C C N N 321 SER O O N N 322 SER CB C N N 323 SER OG O N N 324 SER OXT O N N 325 SER H H N N 326 SER H2 H N N 327 SER HA H N N 328 SER HB2 H N N 329 SER HB3 H N N 330 SER HG H N N 331 SER HXT H N N 332 THR N N N N 333 THR CA C N S 334 THR C C N N 335 THR O O N N 336 THR CB C N R 337 THR OG1 O N N 338 THR CG2 C N N 339 THR OXT O N N 340 THR H H N N 341 THR H2 H N N 342 THR HA H N N 343 THR HB H N N 344 THR HG1 H N N 345 THR HG21 H N N 346 THR HG22 H N N 347 THR HG23 H N N 348 THR HXT H N N 349 TRP N N N N 350 TRP CA C N S 351 TRP C C N N 352 TRP O O N N 353 TRP CB C N N 354 TRP CG C Y N 355 TRP CD1 C Y N 356 TRP CD2 C Y N 357 TRP NE1 N Y N 358 TRP CE2 C Y N 359 TRP CE3 C Y N 360 TRP CZ2 C Y N 361 TRP CZ3 C Y N 362 TRP CH2 C Y N 363 TRP OXT O N N 364 TRP H H N N 365 TRP H2 H N N 366 TRP HA H N N 367 TRP HB2 H N N 368 TRP HB3 H N N 369 TRP HD1 H N N 370 TRP HE1 H N N 371 TRP HE3 H N N 372 TRP HZ2 H N N 373 TRP HZ3 H N N 374 TRP HH2 H N N 375 TRP HXT H N N 376 TYR N N N N 377 TYR CA C N S 378 TYR C C N N 379 TYR O O N N 380 TYR CB C N N 381 TYR CG C Y N 382 TYR CD1 C Y N 383 TYR CD2 C Y N 384 TYR CE1 C Y N 385 TYR CE2 C Y N 386 TYR CZ C Y N 387 TYR OH O N N 388 TYR OXT O N N 389 TYR H H N N 390 TYR H2 H N N 391 TYR HA H N N 392 TYR HB2 H N N 393 TYR HB3 H N N 394 TYR HD1 H N N 395 TYR HD2 H N N 396 TYR HE1 H N N 397 TYR HE2 H N N 398 TYR HH H N N 399 TYR HXT H N N 400 VAL N N N N 401 VAL CA C N S 402 VAL C C N N 403 VAL O O N N 404 VAL CB C N N 405 VAL CG1 C N N 406 VAL CG2 C N N 407 VAL OXT O N N 408 VAL H H N N 409 VAL H2 H N N 410 VAL HA H N N 411 VAL HB H N N 412 VAL HG11 H N N 413 VAL HG12 H N N 414 VAL HG13 H N N 415 VAL HG21 H N N 416 VAL HG22 H N N 417 VAL HG23 H N N 418 VAL HXT H N N 419 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 PTR N CA sing N N 277 PTR N H sing N N 278 PTR N H2 sing N N 279 PTR CA C sing N N 280 PTR CA CB sing N N 281 PTR CA HA sing N N 282 PTR C O doub N N 283 PTR C OXT sing N N 284 PTR OXT HXT sing N N 285 PTR CB CG sing N N 286 PTR CB HB2 sing N N 287 PTR CB HB3 sing N N 288 PTR CG CD1 doub Y N 289 PTR CG CD2 sing Y N 290 PTR CD1 CE1 sing Y N 291 PTR CD1 HD1 sing N N 292 PTR CD2 CE2 doub Y N 293 PTR CD2 HD2 sing N N 294 PTR CE1 CZ doub Y N 295 PTR CE1 HE1 sing N N 296 PTR CE2 CZ sing Y N 297 PTR CE2 HE2 sing N N 298 PTR CZ OH sing N N 299 PTR OH P sing N N 300 PTR P O1P doub N N 301 PTR P O2P sing N N 302 PTR P O3P sing N N 303 PTR O2P HO2P sing N N 304 PTR O3P HO3P sing N N 305 SER N CA sing N N 306 SER N H sing N N 307 SER N H2 sing N N 308 SER CA C sing N N 309 SER CA CB sing N N 310 SER CA HA sing N N 311 SER C O doub N N 312 SER C OXT sing N N 313 SER CB OG sing N N 314 SER CB HB2 sing N N 315 SER CB HB3 sing N N 316 SER OG HG sing N N 317 SER OXT HXT sing N N 318 THR N CA sing N N 319 THR N H sing N N 320 THR N H2 sing N N 321 THR CA C sing N N 322 THR CA CB sing N N 323 THR CA HA sing N N 324 THR C O doub N N 325 THR C OXT sing N N 326 THR CB OG1 sing N N 327 THR CB CG2 sing N N 328 THR CB HB sing N N 329 THR OG1 HG1 sing N N 330 THR CG2 HG21 sing N N 331 THR CG2 HG22 sing N N 332 THR CG2 HG23 sing N N 333 THR OXT HXT sing N N 334 TRP N CA sing N N 335 TRP N H sing N N 336 TRP N H2 sing N N 337 TRP CA C sing N N 338 TRP CA CB sing N N 339 TRP CA HA sing N N 340 TRP C O doub N N 341 TRP C OXT sing N N 342 TRP CB CG sing N N 343 TRP CB HB2 sing N N 344 TRP CB HB3 sing N N 345 TRP CG CD1 doub Y N 346 TRP CG CD2 sing Y N 347 TRP CD1 NE1 sing Y N 348 TRP CD1 HD1 sing N N 349 TRP CD2 CE2 doub Y N 350 TRP CD2 CE3 sing Y N 351 TRP NE1 CE2 sing Y N 352 TRP NE1 HE1 sing N N 353 TRP CE2 CZ2 sing Y N 354 TRP CE3 CZ3 doub Y N 355 TRP CE3 HE3 sing N N 356 TRP CZ2 CH2 doub Y N 357 TRP CZ2 HZ2 sing N N 358 TRP CZ3 CH2 sing Y N 359 TRP CZ3 HZ3 sing N N 360 TRP CH2 HH2 sing N N 361 TRP OXT HXT sing N N 362 TYR N CA sing N N 363 TYR N H sing N N 364 TYR N H2 sing N N 365 TYR CA C sing N N 366 TYR CA CB sing N N 367 TYR CA HA sing N N 368 TYR C O doub N N 369 TYR C OXT sing N N 370 TYR CB CG sing N N 371 TYR CB HB2 sing N N 372 TYR CB HB3 sing N N 373 TYR CG CD1 doub Y N 374 TYR CG CD2 sing Y N 375 TYR CD1 CE1 sing Y N 376 TYR CD1 HD1 sing N N 377 TYR CD2 CE2 doub Y N 378 TYR CD2 HD2 sing N N 379 TYR CE1 CZ doub Y N 380 TYR CE1 HE1 sing N N 381 TYR CE2 CZ sing Y N 382 TYR CE2 HE2 sing N N 383 TYR CZ OH sing N N 384 TYR OH HH sing N N 385 TYR OXT HXT sing N N 386 VAL N CA sing N N 387 VAL N H sing N N 388 VAL N H2 sing N N 389 VAL CA C sing N N 390 VAL CA CB sing N N 391 VAL CA HA sing N N 392 VAL C O doub N N 393 VAL C OXT sing N N 394 VAL CB CG1 sing N N 395 VAL CB CG2 sing N N 396 VAL CB HB sing N N 397 VAL CG1 HG11 sing N N 398 VAL CG1 HG12 sing N N 399 VAL CG1 HG13 sing N N 400 VAL CG2 HG21 sing N N 401 VAL CG2 HG22 sing N N 402 VAL CG2 HG23 sing N N 403 VAL OXT HXT sing N N 404 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3MXC _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7WFY _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.015938 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009125 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.024173 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O P S # loop_