data_7WJT # _entry.id 7WJT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7WJT pdb_00007wjt 10.2210/pdb7wjt/pdb WWPDB D_1300026810 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7WJT _pdbx_database_status.recvd_initial_deposition_date 2022-01-07 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Narita, H.' 1 0000-0003-4604-9523 'Nishikawa, S.' 2 ? 'Nakagawa, A.' 3 0000-0002-1700-7861 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochem.J. _citation.journal_id_ASTM BIJOAK _citation.journal_id_CSD 0043 _citation.journal_id_ISSN 1470-8728 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 479 _citation.language ? _citation.page_first 1127 _citation.page_last 1145 _citation.title 'Insight into the function of a unique voltage-sensor protein (TMEM266) and its short form in mouse cerebellum.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1042/BCJ20220033 _citation.pdbx_database_id_PubMed 35574701 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kawai, T.' 1 0000-0001-6632-5551 primary 'Narita, H.' 2 ? primary 'Konno, K.' 3 ? primary 'Akter, S.' 4 ? primary 'Andriani, R.T.' 5 ? primary 'Iwasaki, H.' 6 ? primary 'Nishikawa, S.' 7 ? primary 'Yokoi, N.' 8 ? primary 'Fukata, Y.' 9 ? primary 'Fukata, M.' 10 ? primary 'Wiriyasermkul, P.' 11 ? primary 'Kongpracha, P.' 12 ? primary 'Nagamori, S.' 13 ? primary 'Takao, K.' 14 ? primary 'Miyakawa, T.' 15 ? primary 'Abe, M.' 16 ? primary 'Sakimura, K.' 17 ? primary 'Watanabe, M.' 18 ? primary 'Nakagawa, A.' 19 ? primary 'Okamura, Y.' 20 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 101.846 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7WJT _cell.details ? _cell.formula_units_Z ? _cell.length_a 60.295 _cell.length_a_esd ? _cell.length_b 90.484 _cell.length_b_esd ? _cell.length_c 49.223 _cell.length_c_esd ? _cell.volume 262828.249 _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7WJT _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall 'C 2y' _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Isoform 2 of Transmembrane protein 266' _entity.formula_weight 7308.199 _entity.pdbx_number_of_molecules 4 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GGSVKLEMEMVTQQYEKAKAIQDEQLERLTQICQEQGFEIRQLRAHLAQQDLDLAAEREAALQA _entity_poly.pdbx_seq_one_letter_code_can GGSVKLEMEMVTQQYEKAKAIQDEQLERLTQICQEQGFEIRQLRAHLAQQDLDLAAEREAALQA _entity_poly.pdbx_strand_id A,B,C,D _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLY n 1 3 SER n 1 4 VAL n 1 5 LYS n 1 6 LEU n 1 7 GLU n 1 8 MET n 1 9 GLU n 1 10 MET n 1 11 VAL n 1 12 THR n 1 13 GLN n 1 14 GLN n 1 15 TYR n 1 16 GLU n 1 17 LYS n 1 18 ALA n 1 19 LYS n 1 20 ALA n 1 21 ILE n 1 22 GLN n 1 23 ASP n 1 24 GLU n 1 25 GLN n 1 26 LEU n 1 27 GLU n 1 28 ARG n 1 29 LEU n 1 30 THR n 1 31 GLN n 1 32 ILE n 1 33 CYS n 1 34 GLN n 1 35 GLU n 1 36 GLN n 1 37 GLY n 1 38 PHE n 1 39 GLU n 1 40 ILE n 1 41 ARG n 1 42 GLN n 1 43 LEU n 1 44 ARG n 1 45 ALA n 1 46 HIS n 1 47 LEU n 1 48 ALA n 1 49 GLN n 1 50 GLN n 1 51 ASP n 1 52 LEU n 1 53 ASP n 1 54 LEU n 1 55 ALA n 1 56 ALA n 1 57 GLU n 1 58 ARG n 1 59 GLU n 1 60 ALA n 1 61 ALA n 1 62 LEU n 1 63 GLN n 1 64 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 64 _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Tmem266 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TM266-2_MOUSE _struct_ref.pdbx_db_accession Q8BZB3-2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code VKLEMEMVTQQYEKAKAIQDEQLERLTQICQEQGFEIRQLRAHLAQQDLDLAAEREAALQA _struct_ref.pdbx_align_begin 158 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7WJT A 4 ? 64 ? Q8BZB3-2 158 ? 218 ? 223 283 2 1 7WJT B 4 ? 64 ? Q8BZB3-2 158 ? 218 ? 223 283 3 1 7WJT C 4 ? 64 ? Q8BZB3-2 158 ? 218 ? 223 283 4 1 7WJT D 4 ? 64 ? Q8BZB3-2 158 ? 218 ? 223 283 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7WJT GLY A 1 ? UNP Q8BZB3-2 ? ? 'expression tag' 220 1 1 7WJT GLY A 2 ? UNP Q8BZB3-2 ? ? 'expression tag' 221 2 1 7WJT SER A 3 ? UNP Q8BZB3-2 ? ? 'expression tag' 222 3 2 7WJT GLY B 1 ? UNP Q8BZB3-2 ? ? 'expression tag' 220 4 2 7WJT GLY B 2 ? UNP Q8BZB3-2 ? ? 'expression tag' 221 5 2 7WJT SER B 3 ? UNP Q8BZB3-2 ? ? 'expression tag' 222 6 3 7WJT GLY C 1 ? UNP Q8BZB3-2 ? ? 'expression tag' 220 7 3 7WJT GLY C 2 ? UNP Q8BZB3-2 ? ? 'expression tag' 221 8 3 7WJT SER C 3 ? UNP Q8BZB3-2 ? ? 'expression tag' 222 9 4 7WJT GLY D 1 ? UNP Q8BZB3-2 ? ? 'expression tag' 220 10 4 7WJT GLY D 2 ? UNP Q8BZB3-2 ? ? 'expression tag' 221 11 4 7WJT SER D 3 ? UNP Q8BZB3-2 ? ? 'expression tag' 222 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7WJT _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.25 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.37 _exptl_crystal.description 'THE ENTRY CONTAINS FRIEDEL PAIRS IN I/F_PLUS/MINUS COLUMNS.' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM MES-NaOH (pH6.0), 2%(v/v) 2-propanol, 200 mM calcium acetate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX300HE' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-05-08 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Double Mirrors, Si(111) double crystal monochromator' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.90000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL44XU' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.90000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL44XU _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate 33.12 _reflns.entry_id 7WJT _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.30 _reflns.d_resolution_low 37.91 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11376 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.8 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.2 _reflns.pdbx_Rmerge_I_obs 0.127 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 27.63 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.30 _reflns_shell.d_res_low 2.34 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 4.5 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 575 _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.533 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 4.2 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 46.77 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7WJT _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.30 _refine.ls_d_res_low 37.91 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11365 _refine.ls_number_reflns_R_free 565 _refine.ls_number_reflns_R_work 10800 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.15 _refine.ls_percent_reflns_R_free 4.97 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2136 _refine.ls_R_factor_R_free 0.2562 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2113 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.38 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3A2A _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.9783 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3239 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 37.91 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1860 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1860 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0060 ? 1896 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.7616 ? 2541 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0395 ? 282 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0044 ? 347 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.3894 ? 755 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' d_2 ? ? 1.31019883818 ? ? 1 'Torsion NCS' ? A ? ? ? ens_1 'X-RAY DIFFRACTION' d_3 ? ? 0.802314030295 ? ? 2 'Torsion NCS' ? A ? ? ? ens_1 'X-RAY DIFFRACTION' d_4 ? ? 1.4301654536 ? ? 3 'Torsion NCS' ? A ? ? ? ens_1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.30 2.54 . . 129 2643 97.61 . . . 0.2955 . 0.2148 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.54 2.90 . . 147 2718 100.00 . . . 0.2758 . 0.2142 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.90 3.66 . . 151 2701 99.86 . . . 0.2587 . 0.2199 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.66 37.91 . . 138 2738 99.10 . . . 0.2376 . 0.2047 . . . . . . . . . . . # loop_ _struct_ncs_oper.id _struct_ncs_oper.code _struct_ncs_oper.matrix[1][1] _struct_ncs_oper.matrix[1][2] _struct_ncs_oper.matrix[1][3] _struct_ncs_oper.matrix[2][1] _struct_ncs_oper.matrix[2][2] _struct_ncs_oper.matrix[2][3] _struct_ncs_oper.matrix[3][1] _struct_ncs_oper.matrix[3][2] _struct_ncs_oper.matrix[3][3] _struct_ncs_oper.vector[1] _struct_ncs_oper.vector[2] _struct_ncs_oper.vector[3] _struct_ncs_oper.details 1 given -0.963859668186 -0.263895807022 -0.0365177091331 -0.257326753809 0.957696157955 -0.128844909923 0.0689745012188 -0.114791428578 -0.990992152394 18.6566110269 3.81997005288 18.6420528202 ? 2 given -0.273048777484 0.233143342555 0.933321245304 0.210626324208 -0.9321598904 0.294473242045 0.938659105674 0.276987581946 0.205418993237 10.5241543124 -48.4789932052 3.73794290471 ? 3 given 0.268446602167 0.19651933994 -0.943035826899 0.0526913880803 -0.980499292336 -0.189327112031 -0.961852400011 0.0011343531941 -0.273566580261 23.5545059619 -42.0448169589 25.9702942942 ? # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details ens_1 d_1 ;(chain "A" and (resid 226 through 251 or resid 253 through 275 or (resid 276 and (name N or name CA or name C or name O or name CB )))) ; ens_1 d_2 ;(chain "B" and (resid 226 through 251 or resid 253 through 275 or (resid 276 and (name N or name CA or name C or name O or name CB )))) ; ens_1 d_3 ;(chain "C" and (resid 226 through 251 or resid 253 through 275 or (resid 276 and (name N or name CA or name C or name O or name CB )))) ; ens_1 d_4 ;(chain "D" and (resid 226 through 251 or resid 253 through 276)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.end_auth_comp_id ens_1 d_1 1 . A GLU 1 . A ILE 26 ? ? ? ? ? ? ? ? ens_1 d_1 2 . A GLN 28 . A GLU 51 ? ? ? ? ? ? ? ? ens_1 d_2 1 . B GLU 6 . B ILE 31 ? ? ? ? ? ? ? ? ens_1 d_2 2 . B GLN 33 . B GLU 56 ? ? ? ? ? ? ? ? ens_1 d_3 1 . C GLU 5 . C ILE 30 ? ? ? ? ? ? ? ? ens_1 d_3 2 . C GLN 32 . C GLU 55 ? ? ? ? ? ? ? ? ens_1 d_4 1 . D GLU 6 . D ILE 31 ? ? ? ? ? ? ? ? ens_1 d_4 2 . D GLN 33 . D GLU 56 ? ? ? ? ? ? ? ? # _struct_ncs_ens.id ens_1 _struct_ncs_ens.details ? # loop_ _struct_ncs_ens_gen.ens_id _struct_ncs_ens_gen.dom_id_1 _struct_ncs_ens_gen.dom_id_2 _struct_ncs_ens_gen.oper_id ens_1 d_2 d_1 1 ens_1 d_3 d_1 2 ens_1 d_4 d_1 3 # _struct.entry_id 7WJT _struct.title 'Crystal structure of coiled-coil region of mouse TMEM266' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7WJT _struct_keywords.text 'Voltage-sensor protein, MEMBRANE PROTEIN' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 7 ? ALA A 61 ? GLU A 226 ALA A 280 1 ? 55 HELX_P HELX_P2 AA2 SER B 3 ? ALA B 61 ? SER B 222 ALA B 280 1 ? 59 HELX_P HELX_P3 AA3 VAL C 4 ? ALA C 61 ? VAL C 223 ALA C 280 1 ? 58 HELX_P HELX_P4 AA4 SER D 3 ? GLU D 57 ? SER D 222 GLU D 276 1 ? 55 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id C _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 33 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id A _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id D _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 33 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id A _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id C _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 252 _struct_conn.ptnr2_auth_asym_id D _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 252 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.047 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 7WJT _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.016585 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.003479 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011052 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020758 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 220 ? ? ? A . n A 1 2 GLY 2 221 ? ? ? A . n A 1 3 SER 3 222 ? ? ? A . n A 1 4 VAL 4 223 ? ? ? A . n A 1 5 LYS 5 224 ? ? ? A . n A 1 6 LEU 6 225 ? ? ? A . n A 1 7 GLU 7 226 226 GLU GLU A . n A 1 8 MET 8 227 227 MET MET A . n A 1 9 GLU 9 228 228 GLU GLU A . n A 1 10 MET 10 229 229 MET MET A . n A 1 11 VAL 11 230 230 VAL VAL A . n A 1 12 THR 12 231 231 THR THR A . n A 1 13 GLN 13 232 232 GLN GLN A . n A 1 14 GLN 14 233 233 GLN GLN A . n A 1 15 TYR 15 234 234 TYR TYR A . n A 1 16 GLU 16 235 235 GLU GLU A . n A 1 17 LYS 17 236 236 LYS LYS A . n A 1 18 ALA 18 237 237 ALA ALA A . n A 1 19 LYS 19 238 238 LYS LYS A . n A 1 20 ALA 20 239 239 ALA ALA A . n A 1 21 ILE 21 240 240 ILE ILE A . n A 1 22 GLN 22 241 241 GLN GLN A . n A 1 23 ASP 23 242 242 ASP ASP A . n A 1 24 GLU 24 243 243 GLU GLU A . n A 1 25 GLN 25 244 244 GLN GLN A . n A 1 26 LEU 26 245 245 LEU LEU A . n A 1 27 GLU 27 246 246 GLU GLU A . n A 1 28 ARG 28 247 247 ARG ARG A . n A 1 29 LEU 29 248 248 LEU LEU A . n A 1 30 THR 30 249 249 THR THR A . n A 1 31 GLN 31 250 250 GLN GLN A . n A 1 32 ILE 32 251 251 ILE ILE A . n A 1 33 CYS 33 252 252 CYS CYS A . n A 1 34 GLN 34 253 253 GLN GLN A . n A 1 35 GLU 35 254 254 GLU GLU A . n A 1 36 GLN 36 255 255 GLN GLN A . n A 1 37 GLY 37 256 256 GLY GLY A . n A 1 38 PHE 38 257 257 PHE PHE A . n A 1 39 GLU 39 258 258 GLU GLU A . n A 1 40 ILE 40 259 259 ILE ILE A . n A 1 41 ARG 41 260 260 ARG ARG A . n A 1 42 GLN 42 261 261 GLN GLN A . n A 1 43 LEU 43 262 262 LEU LEU A . n A 1 44 ARG 44 263 263 ARG ARG A . n A 1 45 ALA 45 264 264 ALA ALA A . n A 1 46 HIS 46 265 265 HIS HIS A . n A 1 47 LEU 47 266 266 LEU LEU A . n A 1 48 ALA 48 267 267 ALA ALA A . n A 1 49 GLN 49 268 268 GLN GLN A . n A 1 50 GLN 50 269 269 GLN GLN A . n A 1 51 ASP 51 270 270 ASP ASP A . n A 1 52 LEU 52 271 271 LEU LEU A . n A 1 53 ASP 53 272 272 ASP ASP A . n A 1 54 LEU 54 273 273 LEU LEU A . n A 1 55 ALA 55 274 274 ALA ALA A . n A 1 56 ALA 56 275 275 ALA ALA A . n A 1 57 GLU 57 276 276 GLU GLU A . n A 1 58 ARG 58 277 277 ARG ARG A . n A 1 59 GLU 59 278 278 GLU GLU A . n A 1 60 ALA 60 279 279 ALA ALA A . n A 1 61 ALA 61 280 280 ALA ALA A . n A 1 62 LEU 62 281 ? ? ? A . n A 1 63 GLN 63 282 ? ? ? A . n A 1 64 ALA 64 283 ? ? ? A . n B 1 1 GLY 1 220 ? ? ? B . n B 1 2 GLY 2 221 221 GLY GLY B . n B 1 3 SER 3 222 222 SER SER B . n B 1 4 VAL 4 223 223 VAL VAL B . n B 1 5 LYS 5 224 224 LYS LYS B . n B 1 6 LEU 6 225 225 LEU LEU B . n B 1 7 GLU 7 226 226 GLU GLU B . n B 1 8 MET 8 227 227 MET MET B . n B 1 9 GLU 9 228 228 GLU GLU B . n B 1 10 MET 10 229 229 MET MET B . n B 1 11 VAL 11 230 230 VAL VAL B . n B 1 12 THR 12 231 231 THR THR B . n B 1 13 GLN 13 232 232 GLN GLN B . n B 1 14 GLN 14 233 233 GLN GLN B . n B 1 15 TYR 15 234 234 TYR TYR B . n B 1 16 GLU 16 235 235 GLU GLU B . n B 1 17 LYS 17 236 236 LYS LYS B . n B 1 18 ALA 18 237 237 ALA ALA B . n B 1 19 LYS 19 238 238 LYS LYS B . n B 1 20 ALA 20 239 239 ALA ALA B . n B 1 21 ILE 21 240 240 ILE ILE B . n B 1 22 GLN 22 241 241 GLN GLN B . n B 1 23 ASP 23 242 242 ASP ASP B . n B 1 24 GLU 24 243 243 GLU GLU B . n B 1 25 GLN 25 244 244 GLN GLN B . n B 1 26 LEU 26 245 245 LEU LEU B . n B 1 27 GLU 27 246 246 GLU GLU B . n B 1 28 ARG 28 247 247 ARG ARG B . n B 1 29 LEU 29 248 248 LEU LEU B . n B 1 30 THR 30 249 249 THR THR B . n B 1 31 GLN 31 250 250 GLN GLN B . n B 1 32 ILE 32 251 251 ILE ILE B . n B 1 33 CYS 33 252 252 CYS CYS B . n B 1 34 GLN 34 253 253 GLN GLN B . n B 1 35 GLU 35 254 254 GLU GLU B . n B 1 36 GLN 36 255 255 GLN GLN B . n B 1 37 GLY 37 256 256 GLY GLY B . n B 1 38 PHE 38 257 257 PHE PHE B . n B 1 39 GLU 39 258 258 GLU GLU B . n B 1 40 ILE 40 259 259 ILE ILE B . n B 1 41 ARG 41 260 260 ARG ARG B . n B 1 42 GLN 42 261 261 GLN GLN B . n B 1 43 LEU 43 262 262 LEU LEU B . n B 1 44 ARG 44 263 263 ARG ARG B . n B 1 45 ALA 45 264 264 ALA ALA B . n B 1 46 HIS 46 265 265 HIS HIS B . n B 1 47 LEU 47 266 266 LEU LEU B . n B 1 48 ALA 48 267 267 ALA ALA B . n B 1 49 GLN 49 268 268 GLN GLN B . n B 1 50 GLN 50 269 269 GLN GLN B . n B 1 51 ASP 51 270 270 ASP ASP B . n B 1 52 LEU 52 271 271 LEU LEU B . n B 1 53 ASP 53 272 272 ASP ASP B . n B 1 54 LEU 54 273 273 LEU LEU B . n B 1 55 ALA 55 274 274 ALA ALA B . n B 1 56 ALA 56 275 275 ALA ALA B . n B 1 57 GLU 57 276 276 GLU GLU B . n B 1 58 ARG 58 277 277 ARG ARG B . n B 1 59 GLU 59 278 278 GLU GLU B . n B 1 60 ALA 60 279 279 ALA ALA B . n B 1 61 ALA 61 280 280 ALA ALA B . n B 1 62 LEU 62 281 ? ? ? B . n B 1 63 GLN 63 282 ? ? ? B . n B 1 64 ALA 64 283 ? ? ? B . n C 1 1 GLY 1 220 ? ? ? C . n C 1 2 GLY 2 221 ? ? ? C . n C 1 3 SER 3 222 222 SER SER C . n C 1 4 VAL 4 223 223 VAL VAL C . n C 1 5 LYS 5 224 224 LYS LYS C . n C 1 6 LEU 6 225 225 LEU LEU C . n C 1 7 GLU 7 226 226 GLU GLU C . n C 1 8 MET 8 227 227 MET MET C . n C 1 9 GLU 9 228 228 GLU GLU C . n C 1 10 MET 10 229 229 MET MET C . n C 1 11 VAL 11 230 230 VAL VAL C . n C 1 12 THR 12 231 231 THR THR C . n C 1 13 GLN 13 232 232 GLN GLN C . n C 1 14 GLN 14 233 233 GLN GLN C . n C 1 15 TYR 15 234 234 TYR TYR C . n C 1 16 GLU 16 235 235 GLU GLU C . n C 1 17 LYS 17 236 236 LYS LYS C . n C 1 18 ALA 18 237 237 ALA ALA C . n C 1 19 LYS 19 238 238 LYS LYS C . n C 1 20 ALA 20 239 239 ALA ALA C . n C 1 21 ILE 21 240 240 ILE ILE C . n C 1 22 GLN 22 241 241 GLN GLN C . n C 1 23 ASP 23 242 242 ASP ASP C . n C 1 24 GLU 24 243 243 GLU GLU C . n C 1 25 GLN 25 244 244 GLN GLN C . n C 1 26 LEU 26 245 245 LEU LEU C . n C 1 27 GLU 27 246 246 GLU GLU C . n C 1 28 ARG 28 247 247 ARG ARG C . n C 1 29 LEU 29 248 248 LEU LEU C . n C 1 30 THR 30 249 249 THR THR C . n C 1 31 GLN 31 250 250 GLN GLN C . n C 1 32 ILE 32 251 251 ILE ILE C . n C 1 33 CYS 33 252 252 CYS CYS C . n C 1 34 GLN 34 253 253 GLN GLN C . n C 1 35 GLU 35 254 254 GLU GLU C . n C 1 36 GLN 36 255 255 GLN GLN C . n C 1 37 GLY 37 256 256 GLY GLY C . n C 1 38 PHE 38 257 257 PHE PHE C . n C 1 39 GLU 39 258 258 GLU GLU C . n C 1 40 ILE 40 259 259 ILE ILE C . n C 1 41 ARG 41 260 260 ARG ARG C . n C 1 42 GLN 42 261 261 GLN GLN C . n C 1 43 LEU 43 262 262 LEU LEU C . n C 1 44 ARG 44 263 263 ARG ARG C . n C 1 45 ALA 45 264 264 ALA ALA C . n C 1 46 HIS 46 265 265 HIS HIS C . n C 1 47 LEU 47 266 266 LEU LEU C . n C 1 48 ALA 48 267 267 ALA ALA C . n C 1 49 GLN 49 268 268 GLN GLN C . n C 1 50 GLN 50 269 269 GLN GLN C . n C 1 51 ASP 51 270 270 ASP ASP C . n C 1 52 LEU 52 271 271 LEU LEU C . n C 1 53 ASP 53 272 272 ASP ASP C . n C 1 54 LEU 54 273 273 LEU LEU C . n C 1 55 ALA 55 274 274 ALA ALA C . n C 1 56 ALA 56 275 275 ALA ALA C . n C 1 57 GLU 57 276 276 GLU GLU C . n C 1 58 ARG 58 277 277 ARG ARG C . n C 1 59 GLU 59 278 278 GLU GLU C . n C 1 60 ALA 60 279 279 ALA ALA C . n C 1 61 ALA 61 280 280 ALA ALA C . n C 1 62 LEU 62 281 ? ? ? C . n C 1 63 GLN 63 282 ? ? ? C . n C 1 64 ALA 64 283 ? ? ? C . n D 1 1 GLY 1 220 ? ? ? D . n D 1 2 GLY 2 221 221 GLY GLY D . n D 1 3 SER 3 222 222 SER SER D . n D 1 4 VAL 4 223 223 VAL VAL D . n D 1 5 LYS 5 224 224 LYS LYS D . n D 1 6 LEU 6 225 225 LEU LEU D . n D 1 7 GLU 7 226 226 GLU GLU D . n D 1 8 MET 8 227 227 MET MET D . n D 1 9 GLU 9 228 228 GLU GLU D . n D 1 10 MET 10 229 229 MET MET D . n D 1 11 VAL 11 230 230 VAL VAL D . n D 1 12 THR 12 231 231 THR THR D . n D 1 13 GLN 13 232 232 GLN GLN D . n D 1 14 GLN 14 233 233 GLN GLN D . n D 1 15 TYR 15 234 234 TYR TYR D . n D 1 16 GLU 16 235 235 GLU GLU D . n D 1 17 LYS 17 236 236 LYS LYS D . n D 1 18 ALA 18 237 237 ALA ALA D . n D 1 19 LYS 19 238 238 LYS LYS D . n D 1 20 ALA 20 239 239 ALA ALA D . n D 1 21 ILE 21 240 240 ILE ILE D . n D 1 22 GLN 22 241 241 GLN GLN D . n D 1 23 ASP 23 242 242 ASP ASP D . n D 1 24 GLU 24 243 243 GLU GLU D . n D 1 25 GLN 25 244 244 GLN GLN D . n D 1 26 LEU 26 245 245 LEU LEU D . n D 1 27 GLU 27 246 246 GLU GLU D . n D 1 28 ARG 28 247 247 ARG ARG D . n D 1 29 LEU 29 248 248 LEU LEU D . n D 1 30 THR 30 249 249 THR THR D . n D 1 31 GLN 31 250 250 GLN GLN D . n D 1 32 ILE 32 251 251 ILE ILE D . n D 1 33 CYS 33 252 252 CYS CYS D . n D 1 34 GLN 34 253 253 GLN GLN D . n D 1 35 GLU 35 254 254 GLU GLU D . n D 1 36 GLN 36 255 255 GLN GLN D . n D 1 37 GLY 37 256 256 GLY GLY D . n D 1 38 PHE 38 257 257 PHE PHE D . n D 1 39 GLU 39 258 258 GLU GLU D . n D 1 40 ILE 40 259 259 ILE ILE D . n D 1 41 ARG 41 260 260 ARG ARG D . n D 1 42 GLN 42 261 261 GLN GLN D . n D 1 43 LEU 43 262 262 LEU LEU D . n D 1 44 ARG 44 263 263 ARG ARG D . n D 1 45 ALA 45 264 264 ALA ALA D . n D 1 46 HIS 46 265 265 HIS HIS D . n D 1 47 LEU 47 266 266 LEU LEU D . n D 1 48 ALA 48 267 267 ALA ALA D . n D 1 49 GLN 49 268 268 GLN GLN D . n D 1 50 GLN 50 269 269 GLN GLN D . n D 1 51 ASP 51 270 270 ASP ASP D . n D 1 52 LEU 52 271 271 LEU LEU D . n D 1 53 ASP 53 272 272 ASP ASP D . n D 1 54 LEU 54 273 273 LEU LEU D . n D 1 55 ALA 55 274 274 ALA ALA D . n D 1 56 ALA 56 275 275 ALA ALA D . n D 1 57 GLU 57 276 276 GLU GLU D . n D 1 58 ARG 58 277 ? ? ? D . n D 1 59 GLU 59 278 ? ? ? D . n D 1 60 ALA 60 279 ? ? ? D . n D 1 61 ALA 61 280 ? ? ? D . n D 1 62 LEU 62 281 ? ? ? D . n D 1 63 GLN 63 282 ? ? ? D . n D 1 64 ALA 64 283 ? ? ? D . n # _pdbx_contact_author.id 3 _pdbx_contact_author.email atsushi@protein.osaka-u.ac.jp _pdbx_contact_author.name_first Atsushi _pdbx_contact_author.name_last Nakagawa _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-1700-7861 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? dimeric 2 2 author_defined_assembly ? dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B 2 1 C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-10-26 2 'Structure model' 1 1 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y,-z 3 x+1/2,y+1/2,z 4 -x+1/2,y+1/2,-z # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 5.19177581747 -1.7733039301 7.6917534063 0.323965946371 ? 0.044139197348 ? -0.0265123566025 ? 0.37894794089 ? -0.0458212696172 ? 0.281061954911 ? 1.14030981197 ? 1.01935006238 ? -0.218385475289 ? 3.55300658148 ? -0.278923462596 ? 1.04295616066 ? -0.0437550993117 ? -0.0271362098998 ? 0.0154786959736 ? -0.905348324891 ? 0.0637800193638 ? 0.877339489929 ? 0.0837779125955 ? -0.0294928566367 ? -0.0295729180052 ? 2 'X-RAY DIFFRACTION' ? refined 14.8060827782 -2.9842287105 11.5449328364 0.332464834758 ? 0.0490719159282 ? 0.0346642968838 ? 0.327582825932 ? 0.0479617449449 ? 0.404062426246 ? 1.20249272275 ? -1.80998957094 ? -0.043606155361 ? 3.57336128904 ? 0.415323727383 ? -0.0364040842396 ? 0.0610927941048 ? 0.0996160590383 ? 0.229650276306 ? 0.337813628003 ? -0.270074832311 ? -0.518520496785 ? 0.0472030854081 ? 0.0183949267763 ? 0.0799234756709 ? 3 'X-RAY DIFFRACTION' ? refined 15.7673188162 -40.9686667446 8.98880240773 0.303051655289 ? 0.00522428140391 ? -0.000666300174631 ? 0.362307932077 ? -0.00394107123939 ? 0.30065382496 ? 0.267674095927 ? -0.48450553907 ? 0.424838935583 ? 3.67203147646 ? -1.40086495958 ? 0.904551406019 ? 0.0441573083118 ? 0.00295884555688 ? -0.114150407309 ? -0.337232780383 ? 0.207965602112 ? 0.425815107484 ? 0.0731627625521 ? -0.170099120884 ? -0.289662432769 ? 4 'X-RAY DIFFRACTION' ? refined 15.5223724762 -35.8255995491 18.9855814463 0.331670832695 ? 0.0409139673335 ? 0.0395997163022 ? 0.335701786413 ? -0.0150373628713 ? 0.298844646874 ? 1.98189981444 ? -2.48188299576 ? -0.0383050222503 ? 3.0780704676 ? -0.0704202357719 ? -0.018450174752 ? 0.0407116612951 ? -0.05349412371 ? 0.108070364429 ? 0.303968740976 ? -0.117958475207 ? -0.187447482786 ? -0.0890699155657 ? 0.00121639233882 ? 0.00604372750805 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 1 A 226 ? A 55 A 280 ? ? ;chain 'A' and (resid 226 through 280 ) ; 2 'X-RAY DIFFRACTION' 2 B 1 B 221 ? B 60 B 280 ? ? ;chain 'B' and (resid 221 through 280 ) ; 3 'X-RAY DIFFRACTION' 3 C 1 C 222 ? C 59 C 280 ? ? ;chain 'C' and (resid 222 through 280 ) ; 4 'X-RAY DIFFRACTION' 4 D 1 D 221 ? D 56 D 276 ? ? ;chain 'D' and (resid 221 through 276 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? 714 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? 714 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? 1.11.7.03 3 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? 0.9.6 4 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 5 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 D GLU 276 ? CG ? D GLU 57 CG 2 1 Y 1 D GLU 276 ? CD ? D GLU 57 CD 3 1 Y 1 D GLU 276 ? OE1 ? D GLU 57 OE1 4 1 Y 1 D GLU 276 ? OE2 ? D GLU 57 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 220 ? A GLY 1 2 1 Y 1 A GLY 221 ? A GLY 2 3 1 Y 1 A SER 222 ? A SER 3 4 1 Y 1 A VAL 223 ? A VAL 4 5 1 Y 1 A LYS 224 ? A LYS 5 6 1 Y 1 A LEU 225 ? A LEU 6 7 1 Y 1 A LEU 281 ? A LEU 62 8 1 Y 1 A GLN 282 ? A GLN 63 9 1 Y 1 A ALA 283 ? A ALA 64 10 1 Y 1 B GLY 220 ? B GLY 1 11 1 Y 1 B LEU 281 ? B LEU 62 12 1 Y 1 B GLN 282 ? B GLN 63 13 1 Y 1 B ALA 283 ? B ALA 64 14 1 Y 1 C GLY 220 ? C GLY 1 15 1 Y 1 C GLY 221 ? C GLY 2 16 1 Y 1 C LEU 281 ? C LEU 62 17 1 Y 1 C GLN 282 ? C GLN 63 18 1 Y 1 C ALA 283 ? C ALA 64 19 1 Y 1 D GLY 220 ? D GLY 1 20 1 Y 1 D ARG 277 ? D ARG 58 21 1 Y 1 D GLU 278 ? D GLU 59 22 1 Y 1 D ALA 279 ? D ALA 60 23 1 Y 1 D ALA 280 ? D ALA 61 24 1 Y 1 D LEU 281 ? D LEU 62 25 1 Y 1 D GLN 282 ? D GLN 63 26 1 Y 1 D ALA 283 ? D ALA 64 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLN N N N N 71 GLN CA C N S 72 GLN C C N N 73 GLN O O N N 74 GLN CB C N N 75 GLN CG C N N 76 GLN CD C N N 77 GLN OE1 O N N 78 GLN NE2 N N N 79 GLN OXT O N N 80 GLN H H N N 81 GLN H2 H N N 82 GLN HA H N N 83 GLN HB2 H N N 84 GLN HB3 H N N 85 GLN HG2 H N N 86 GLN HG3 H N N 87 GLN HE21 H N N 88 GLN HE22 H N N 89 GLN HXT H N N 90 GLU N N N N 91 GLU CA C N S 92 GLU C C N N 93 GLU O O N N 94 GLU CB C N N 95 GLU CG C N N 96 GLU CD C N N 97 GLU OE1 O N N 98 GLU OE2 O N N 99 GLU OXT O N N 100 GLU H H N N 101 GLU H2 H N N 102 GLU HA H N N 103 GLU HB2 H N N 104 GLU HB3 H N N 105 GLU HG2 H N N 106 GLU HG3 H N N 107 GLU HE2 H N N 108 GLU HXT H N N 109 GLY N N N N 110 GLY CA C N N 111 GLY C C N N 112 GLY O O N N 113 GLY OXT O N N 114 GLY H H N N 115 GLY H2 H N N 116 GLY HA2 H N N 117 GLY HA3 H N N 118 GLY HXT H N N 119 HIS N N N N 120 HIS CA C N S 121 HIS C C N N 122 HIS O O N N 123 HIS CB C N N 124 HIS CG C Y N 125 HIS ND1 N Y N 126 HIS CD2 C Y N 127 HIS CE1 C Y N 128 HIS NE2 N Y N 129 HIS OXT O N N 130 HIS H H N N 131 HIS H2 H N N 132 HIS HA H N N 133 HIS HB2 H N N 134 HIS HB3 H N N 135 HIS HD1 H N N 136 HIS HD2 H N N 137 HIS HE1 H N N 138 HIS HE2 H N N 139 HIS HXT H N N 140 ILE N N N N 141 ILE CA C N S 142 ILE C C N N 143 ILE O O N N 144 ILE CB C N S 145 ILE CG1 C N N 146 ILE CG2 C N N 147 ILE CD1 C N N 148 ILE OXT O N N 149 ILE H H N N 150 ILE H2 H N N 151 ILE HA H N N 152 ILE HB H N N 153 ILE HG12 H N N 154 ILE HG13 H N N 155 ILE HG21 H N N 156 ILE HG22 H N N 157 ILE HG23 H N N 158 ILE HD11 H N N 159 ILE HD12 H N N 160 ILE HD13 H N N 161 ILE HXT H N N 162 LEU N N N N 163 LEU CA C N S 164 LEU C C N N 165 LEU O O N N 166 LEU CB C N N 167 LEU CG C N N 168 LEU CD1 C N N 169 LEU CD2 C N N 170 LEU OXT O N N 171 LEU H H N N 172 LEU H2 H N N 173 LEU HA H N N 174 LEU HB2 H N N 175 LEU HB3 H N N 176 LEU HG H N N 177 LEU HD11 H N N 178 LEU HD12 H N N 179 LEU HD13 H N N 180 LEU HD21 H N N 181 LEU HD22 H N N 182 LEU HD23 H N N 183 LEU HXT H N N 184 LYS N N N N 185 LYS CA C N S 186 LYS C C N N 187 LYS O O N N 188 LYS CB C N N 189 LYS CG C N N 190 LYS CD C N N 191 LYS CE C N N 192 LYS NZ N N N 193 LYS OXT O N N 194 LYS H H N N 195 LYS H2 H N N 196 LYS HA H N N 197 LYS HB2 H N N 198 LYS HB3 H N N 199 LYS HG2 H N N 200 LYS HG3 H N N 201 LYS HD2 H N N 202 LYS HD3 H N N 203 LYS HE2 H N N 204 LYS HE3 H N N 205 LYS HZ1 H N N 206 LYS HZ2 H N N 207 LYS HZ3 H N N 208 LYS HXT H N N 209 MET N N N N 210 MET CA C N S 211 MET C C N N 212 MET O O N N 213 MET CB C N N 214 MET CG C N N 215 MET SD S N N 216 MET CE C N N 217 MET OXT O N N 218 MET H H N N 219 MET H2 H N N 220 MET HA H N N 221 MET HB2 H N N 222 MET HB3 H N N 223 MET HG2 H N N 224 MET HG3 H N N 225 MET HE1 H N N 226 MET HE2 H N N 227 MET HE3 H N N 228 MET HXT H N N 229 PHE N N N N 230 PHE CA C N S 231 PHE C C N N 232 PHE O O N N 233 PHE CB C N N 234 PHE CG C Y N 235 PHE CD1 C Y N 236 PHE CD2 C Y N 237 PHE CE1 C Y N 238 PHE CE2 C Y N 239 PHE CZ C Y N 240 PHE OXT O N N 241 PHE H H N N 242 PHE H2 H N N 243 PHE HA H N N 244 PHE HB2 H N N 245 PHE HB3 H N N 246 PHE HD1 H N N 247 PHE HD2 H N N 248 PHE HE1 H N N 249 PHE HE2 H N N 250 PHE HZ H N N 251 PHE HXT H N N 252 SER N N N N 253 SER CA C N S 254 SER C C N N 255 SER O O N N 256 SER CB C N N 257 SER OG O N N 258 SER OXT O N N 259 SER H H N N 260 SER H2 H N N 261 SER HA H N N 262 SER HB2 H N N 263 SER HB3 H N N 264 SER HG H N N 265 SER HXT H N N 266 THR N N N N 267 THR CA C N S 268 THR C C N N 269 THR O O N N 270 THR CB C N R 271 THR OG1 O N N 272 THR CG2 C N N 273 THR OXT O N N 274 THR H H N N 275 THR H2 H N N 276 THR HA H N N 277 THR HB H N N 278 THR HG1 H N N 279 THR HG21 H N N 280 THR HG22 H N N 281 THR HG23 H N N 282 THR HXT H N N 283 TYR N N N N 284 TYR CA C N S 285 TYR C C N N 286 TYR O O N N 287 TYR CB C N N 288 TYR CG C Y N 289 TYR CD1 C Y N 290 TYR CD2 C Y N 291 TYR CE1 C Y N 292 TYR CE2 C Y N 293 TYR CZ C Y N 294 TYR OH O N N 295 TYR OXT O N N 296 TYR H H N N 297 TYR H2 H N N 298 TYR HA H N N 299 TYR HB2 H N N 300 TYR HB3 H N N 301 TYR HD1 H N N 302 TYR HD2 H N N 303 TYR HE1 H N N 304 TYR HE2 H N N 305 TYR HH H N N 306 TYR HXT H N N 307 VAL N N N N 308 VAL CA C N S 309 VAL C C N N 310 VAL O O N N 311 VAL CB C N N 312 VAL CG1 C N N 313 VAL CG2 C N N 314 VAL OXT O N N 315 VAL H H N N 316 VAL H2 H N N 317 VAL HA H N N 318 VAL HB H N N 319 VAL HG11 H N N 320 VAL HG12 H N N 321 VAL HG13 H N N 322 VAL HG21 H N N 323 VAL HG22 H N N 324 VAL HG23 H N N 325 VAL HXT H N N 326 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLU N CA sing N N 86 GLU N H sing N N 87 GLU N H2 sing N N 88 GLU CA C sing N N 89 GLU CA CB sing N N 90 GLU CA HA sing N N 91 GLU C O doub N N 92 GLU C OXT sing N N 93 GLU CB CG sing N N 94 GLU CB HB2 sing N N 95 GLU CB HB3 sing N N 96 GLU CG CD sing N N 97 GLU CG HG2 sing N N 98 GLU CG HG3 sing N N 99 GLU CD OE1 doub N N 100 GLU CD OE2 sing N N 101 GLU OE2 HE2 sing N N 102 GLU OXT HXT sing N N 103 GLY N CA sing N N 104 GLY N H sing N N 105 GLY N H2 sing N N 106 GLY CA C sing N N 107 GLY CA HA2 sing N N 108 GLY CA HA3 sing N N 109 GLY C O doub N N 110 GLY C OXT sing N N 111 GLY OXT HXT sing N N 112 HIS N CA sing N N 113 HIS N H sing N N 114 HIS N H2 sing N N 115 HIS CA C sing N N 116 HIS CA CB sing N N 117 HIS CA HA sing N N 118 HIS C O doub N N 119 HIS C OXT sing N N 120 HIS CB CG sing N N 121 HIS CB HB2 sing N N 122 HIS CB HB3 sing N N 123 HIS CG ND1 sing Y N 124 HIS CG CD2 doub Y N 125 HIS ND1 CE1 doub Y N 126 HIS ND1 HD1 sing N N 127 HIS CD2 NE2 sing Y N 128 HIS CD2 HD2 sing N N 129 HIS CE1 NE2 sing Y N 130 HIS CE1 HE1 sing N N 131 HIS NE2 HE2 sing N N 132 HIS OXT HXT sing N N 133 ILE N CA sing N N 134 ILE N H sing N N 135 ILE N H2 sing N N 136 ILE CA C sing N N 137 ILE CA CB sing N N 138 ILE CA HA sing N N 139 ILE C O doub N N 140 ILE C OXT sing N N 141 ILE CB CG1 sing N N 142 ILE CB CG2 sing N N 143 ILE CB HB sing N N 144 ILE CG1 CD1 sing N N 145 ILE CG1 HG12 sing N N 146 ILE CG1 HG13 sing N N 147 ILE CG2 HG21 sing N N 148 ILE CG2 HG22 sing N N 149 ILE CG2 HG23 sing N N 150 ILE CD1 HD11 sing N N 151 ILE CD1 HD12 sing N N 152 ILE CD1 HD13 sing N N 153 ILE OXT HXT sing N N 154 LEU N CA sing N N 155 LEU N H sing N N 156 LEU N H2 sing N N 157 LEU CA C sing N N 158 LEU CA CB sing N N 159 LEU CA HA sing N N 160 LEU C O doub N N 161 LEU C OXT sing N N 162 LEU CB CG sing N N 163 LEU CB HB2 sing N N 164 LEU CB HB3 sing N N 165 LEU CG CD1 sing N N 166 LEU CG CD2 sing N N 167 LEU CG HG sing N N 168 LEU CD1 HD11 sing N N 169 LEU CD1 HD12 sing N N 170 LEU CD1 HD13 sing N N 171 LEU CD2 HD21 sing N N 172 LEU CD2 HD22 sing N N 173 LEU CD2 HD23 sing N N 174 LEU OXT HXT sing N N 175 LYS N CA sing N N 176 LYS N H sing N N 177 LYS N H2 sing N N 178 LYS CA C sing N N 179 LYS CA CB sing N N 180 LYS CA HA sing N N 181 LYS C O doub N N 182 LYS C OXT sing N N 183 LYS CB CG sing N N 184 LYS CB HB2 sing N N 185 LYS CB HB3 sing N N 186 LYS CG CD sing N N 187 LYS CG HG2 sing N N 188 LYS CG HG3 sing N N 189 LYS CD CE sing N N 190 LYS CD HD2 sing N N 191 LYS CD HD3 sing N N 192 LYS CE NZ sing N N 193 LYS CE HE2 sing N N 194 LYS CE HE3 sing N N 195 LYS NZ HZ1 sing N N 196 LYS NZ HZ2 sing N N 197 LYS NZ HZ3 sing N N 198 LYS OXT HXT sing N N 199 MET N CA sing N N 200 MET N H sing N N 201 MET N H2 sing N N 202 MET CA C sing N N 203 MET CA CB sing N N 204 MET CA HA sing N N 205 MET C O doub N N 206 MET C OXT sing N N 207 MET CB CG sing N N 208 MET CB HB2 sing N N 209 MET CB HB3 sing N N 210 MET CG SD sing N N 211 MET CG HG2 sing N N 212 MET CG HG3 sing N N 213 MET SD CE sing N N 214 MET CE HE1 sing N N 215 MET CE HE2 sing N N 216 MET CE HE3 sing N N 217 MET OXT HXT sing N N 218 PHE N CA sing N N 219 PHE N H sing N N 220 PHE N H2 sing N N 221 PHE CA C sing N N 222 PHE CA CB sing N N 223 PHE CA HA sing N N 224 PHE C O doub N N 225 PHE C OXT sing N N 226 PHE CB CG sing N N 227 PHE CB HB2 sing N N 228 PHE CB HB3 sing N N 229 PHE CG CD1 doub Y N 230 PHE CG CD2 sing Y N 231 PHE CD1 CE1 sing Y N 232 PHE CD1 HD1 sing N N 233 PHE CD2 CE2 doub Y N 234 PHE CD2 HD2 sing N N 235 PHE CE1 CZ doub Y N 236 PHE CE1 HE1 sing N N 237 PHE CE2 CZ sing Y N 238 PHE CE2 HE2 sing N N 239 PHE CZ HZ sing N N 240 PHE OXT HXT sing N N 241 SER N CA sing N N 242 SER N H sing N N 243 SER N H2 sing N N 244 SER CA C sing N N 245 SER CA CB sing N N 246 SER CA HA sing N N 247 SER C O doub N N 248 SER C OXT sing N N 249 SER CB OG sing N N 250 SER CB HB2 sing N N 251 SER CB HB3 sing N N 252 SER OG HG sing N N 253 SER OXT HXT sing N N 254 THR N CA sing N N 255 THR N H sing N N 256 THR N H2 sing N N 257 THR CA C sing N N 258 THR CA CB sing N N 259 THR CA HA sing N N 260 THR C O doub N N 261 THR C OXT sing N N 262 THR CB OG1 sing N N 263 THR CB CG2 sing N N 264 THR CB HB sing N N 265 THR OG1 HG1 sing N N 266 THR CG2 HG21 sing N N 267 THR CG2 HG22 sing N N 268 THR CG2 HG23 sing N N 269 THR OXT HXT sing N N 270 TYR N CA sing N N 271 TYR N H sing N N 272 TYR N H2 sing N N 273 TYR CA C sing N N 274 TYR CA CB sing N N 275 TYR CA HA sing N N 276 TYR C O doub N N 277 TYR C OXT sing N N 278 TYR CB CG sing N N 279 TYR CB HB2 sing N N 280 TYR CB HB3 sing N N 281 TYR CG CD1 doub Y N 282 TYR CG CD2 sing Y N 283 TYR CD1 CE1 sing Y N 284 TYR CD1 HD1 sing N N 285 TYR CD2 CE2 doub Y N 286 TYR CD2 HD2 sing N N 287 TYR CE1 CZ doub Y N 288 TYR CE1 HE1 sing N N 289 TYR CE2 CZ sing Y N 290 TYR CE2 HE2 sing N N 291 TYR CZ OH sing N N 292 TYR OH HH sing N N 293 TYR OXT HXT sing N N 294 VAL N CA sing N N 295 VAL N H sing N N 296 VAL N H2 sing N N 297 VAL CA C sing N N 298 VAL CA CB sing N N 299 VAL CA HA sing N N 300 VAL C O doub N N 301 VAL C OXT sing N N 302 VAL CB CG1 sing N N 303 VAL CB CG2 sing N N 304 VAL CB HB sing N N 305 VAL CG1 HG11 sing N N 306 VAL CG1 HG12 sing N N 307 VAL CG1 HG13 sing N N 308 VAL CG2 HG21 sing N N 309 VAL CG2 HG22 sing N N 310 VAL CG2 HG23 sing N N 311 VAL OXT HXT sing N N 312 # _pdbx_audit_support.funding_organization 'Japan Science and Technology' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number JPMJCR14M3 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3A2A _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details dimer # _space_group.name_H-M_alt 'C 1 2 1' _space_group.name_Hall 'C 2y' _space_group.IT_number 5 _space_group.crystal_system monoclinic _space_group.id 1 #