data_7WLP # _entry.id 7WLP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7WLP pdb_00007wlp 10.2210/pdb7wlp/pdb WWPDB D_1300026857 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7WLP _pdbx_database_status.recvd_initial_deposition_date 2022-01-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chen, J.' 1 ? 'Shan, S.' 2 ? 'Zhou, Z.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 119 _citation.language ? _citation.page_first e2203782119 _citation.page_last e2203782119 _citation.title 'Epstein-Barr virus protein BKRF4 restricts nucleosome assembly to suppress host antiviral responses.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.2203782119 _citation.pdbx_database_id_PubMed 36067323 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chen, J.' 1 0000-0001-5705-3961 primary 'Lu, Z.' 2 0000-0003-0913-3785 primary 'Gong, W.' 3 0000-0001-7130-4093 primary 'Xiao, X.' 4 ? primary 'Feng, X.' 5 ? primary 'Li, W.' 6 ? primary 'Shan, S.' 7 0000-0001-7522-2618 primary 'Xu, D.' 8 0000-0001-5711-2618 primary 'Zhou, Z.' 9 0000-0002-1423-7231 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7WLP _cell.details ? _cell.formula_units_Z ? _cell.length_a 88.270 _cell.length_a_esd ? _cell.length_b 88.270 _cell.length_b_esd ? _cell.length_c 105.626 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 36 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7WLP _symmetry.cell_setting ? _symmetry.Int_Tables_number 182 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 63 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Histone H2B type 1-O,Histone H2A type 1-D' 21364.777 1 ? ? ? 'The fusion protein of Histone H2B and H2A' 2 polymer man 'Tegument protein BKRF4' 9917.554 3 ? ? ? ? 3 water nat water 18.015 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'H2B-clustered histone 17,Histone H2B.2,Histone H2B.n,H2B/n,Histone H2A.3,Histone H2A/g' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAV SEGTKAVTKYTSSKKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRI IPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNI ; ;MRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAV SEGTKAVTKYTSSKKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRI IPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNI ; A ? 2 'polypeptide(L)' no no ;MRRLLSDEEEETSQSSSYTLGSQASQSIQEEDVSDTDESDYSDEDEEIDLEEEYPSDEDPSEGSDSDPSWHPSDSDESDY SESDEDEA ; ;MRRLLSDEEEETSQSSSYTLGSQASQSIQEEDVSDTDESDYSDEDEEIDLEEEYPSDEDPSEGSDSDPSWHPSDSDESDY SESDEDEA ; B,D,C ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 LYS n 1 4 GLU n 1 5 SER n 1 6 TYR n 1 7 SER n 1 8 ILE n 1 9 TYR n 1 10 VAL n 1 11 TYR n 1 12 LYS n 1 13 VAL n 1 14 LEU n 1 15 LYS n 1 16 GLN n 1 17 VAL n 1 18 HIS n 1 19 PRO n 1 20 ASP n 1 21 THR n 1 22 GLY n 1 23 ILE n 1 24 SER n 1 25 SER n 1 26 LYS n 1 27 ALA n 1 28 MET n 1 29 GLY n 1 30 ILE n 1 31 MET n 1 32 ASN n 1 33 SER n 1 34 PHE n 1 35 VAL n 1 36 ASN n 1 37 ASP n 1 38 ILE n 1 39 PHE n 1 40 GLU n 1 41 ARG n 1 42 ILE n 1 43 ALA n 1 44 GLY n 1 45 GLU n 1 46 ALA n 1 47 SER n 1 48 ARG n 1 49 LEU n 1 50 ALA n 1 51 HIS n 1 52 TYR n 1 53 ASN n 1 54 LYS n 1 55 ARG n 1 56 SER n 1 57 THR n 1 58 ILE n 1 59 THR n 1 60 SER n 1 61 ARG n 1 62 GLU n 1 63 ILE n 1 64 GLN n 1 65 THR n 1 66 ALA n 1 67 VAL n 1 68 ARG n 1 69 LEU n 1 70 LEU n 1 71 LEU n 1 72 PRO n 1 73 GLY n 1 74 GLU n 1 75 LEU n 1 76 ALA n 1 77 LYS n 1 78 HIS n 1 79 ALA n 1 80 VAL n 1 81 SER n 1 82 GLU n 1 83 GLY n 1 84 THR n 1 85 LYS n 1 86 ALA n 1 87 VAL n 1 88 THR n 1 89 LYS n 1 90 TYR n 1 91 THR n 1 92 SER n 1 93 SER n 1 94 LYS n 1 95 LYS n 1 96 ALA n 1 97 LYS n 1 98 THR n 1 99 ARG n 1 100 SER n 1 101 SER n 1 102 ARG n 1 103 ALA n 1 104 GLY n 1 105 LEU n 1 106 GLN n 1 107 PHE n 1 108 PRO n 1 109 VAL n 1 110 GLY n 1 111 ARG n 1 112 VAL n 1 113 HIS n 1 114 ARG n 1 115 LEU n 1 116 LEU n 1 117 ARG n 1 118 LYS n 1 119 GLY n 1 120 ASN n 1 121 TYR n 1 122 SER n 1 123 GLU n 1 124 ARG n 1 125 VAL n 1 126 GLY n 1 127 ALA n 1 128 GLY n 1 129 ALA n 1 130 PRO n 1 131 VAL n 1 132 TYR n 1 133 LEU n 1 134 ALA n 1 135 ALA n 1 136 VAL n 1 137 LEU n 1 138 GLU n 1 139 TYR n 1 140 LEU n 1 141 THR n 1 142 ALA n 1 143 GLU n 1 144 ILE n 1 145 LEU n 1 146 GLU n 1 147 LEU n 1 148 ALA n 1 149 GLY n 1 150 ASN n 1 151 ALA n 1 152 ALA n 1 153 ARG n 1 154 ASP n 1 155 ASN n 1 156 LYS n 1 157 LYS n 1 158 THR n 1 159 ARG n 1 160 ILE n 1 161 ILE n 1 162 PRO n 1 163 ARG n 1 164 HIS n 1 165 LEU n 1 166 GLN n 1 167 LEU n 1 168 ALA n 1 169 ILE n 1 170 ARG n 1 171 ASN n 1 172 ASP n 1 173 GLU n 1 174 GLU n 1 175 LEU n 1 176 ASN n 1 177 LYS n 1 178 LEU n 1 179 LEU n 1 180 GLY n 1 181 LYS n 1 182 VAL n 1 183 THR n 1 184 ILE n 1 185 ALA n 1 186 GLN n 1 187 GLY n 1 188 GLY n 1 189 VAL n 1 190 LEU n 1 191 PRO n 1 192 ASN n 1 193 ILE n 2 1 MET n 2 2 ARG n 2 3 ARG n 2 4 LEU n 2 5 LEU n 2 6 SER n 2 7 ASP n 2 8 GLU n 2 9 GLU n 2 10 GLU n 2 11 GLU n 2 12 THR n 2 13 SER n 2 14 GLN n 2 15 SER n 2 16 SER n 2 17 SER n 2 18 TYR n 2 19 THR n 2 20 LEU n 2 21 GLY n 2 22 SER n 2 23 GLN n 2 24 ALA n 2 25 SER n 2 26 GLN n 2 27 SER n 2 28 ILE n 2 29 GLN n 2 30 GLU n 2 31 GLU n 2 32 ASP n 2 33 VAL n 2 34 SER n 2 35 ASP n 2 36 THR n 2 37 ASP n 2 38 GLU n 2 39 SER n 2 40 ASP n 2 41 TYR n 2 42 SER n 2 43 ASP n 2 44 GLU n 2 45 ASP n 2 46 GLU n 2 47 GLU n 2 48 ILE n 2 49 ASP n 2 50 LEU n 2 51 GLU n 2 52 GLU n 2 53 GLU n 2 54 TYR n 2 55 PRO n 2 56 SER n 2 57 ASP n 2 58 GLU n 2 59 ASP n 2 60 PRO n 2 61 SER n 2 62 GLU n 2 63 GLY n 2 64 SER n 2 65 ASP n 2 66 SER n 2 67 ASP n 2 68 PRO n 2 69 SER n 2 70 TRP n 2 71 HIS n 2 72 PRO n 2 73 SER n 2 74 ASP n 2 75 SER n 2 76 ASP n 2 77 GLU n 2 78 SER n 2 79 ASP n 2 80 TYR n 2 81 SER n 2 82 GLU n 2 83 SER n 2 84 ASP n 2 85 GLU n 2 86 ASP n 2 87 GLU n 2 88 ALA n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 94 human ? 'H2BC17, H2BFH, H2BFN, HIST1H2BO' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 95 193 human ? 'H2AC7, H2AFG, HIST1H2AD' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 88 'Epstein-Barr virus' ? BKRF4 ? GD1 ? ? ? ? 'Human gammaherpesvirus 4' 10376 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP H2B1O_HUMAN P23527 ? 1 ;RKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVS EGTKAVTKYTSSK ; 34 2 UNP H2A1D_HUMAN P20671 ? 1 ;KAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEE LNKLLGKVTIAQGGVLPNI ; 14 3 UNP BKRF4_EBVG Q3KSS1 ? 2 ;RRLLSDEEEETSQSSSYTLGSQASQSIQEEDVSDTDESDYSDEDEEIDLEEEYPSDEDPSEGSDSDPSWHPSDSDESDYS ESDEDEA ; 16 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7WLP A 2 ? 94 ? P23527 34 ? 126 ? 2 94 2 2 7WLP A 95 ? 193 ? P20671 14 ? 112 ? 95 193 3 3 7WLP B 2 ? 88 ? Q3KSS1 16 ? 102 ? 16 102 4 3 7WLP D 2 ? 88 ? Q3KSS1 16 ? 102 ? 1 87 5 3 7WLP C 2 ? 88 ? Q3KSS1 16 ? 102 ? 1 87 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7WLP MET A 1 ? UNP P23527 ? ? 'initiating methionine' 1 1 3 7WLP MET B 1 ? UNP Q3KSS1 ? ? 'initiating methionine' 15 2 4 7WLP MET D 1 ? UNP Q3KSS1 ? ? 'initiating methionine' 0 3 5 7WLP MET C 1 ? UNP Q3KSS1 ? ? 'initiating methionine' 0 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7WLP _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2M Ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 80 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-05-19 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7WLP _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.29 _reflns.d_resolution_low 50.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 11406 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.7 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 16.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 27.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.0 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.29 _reflns_shell.d_res_low 2.38 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.4 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1077 _reflns_shell.percent_possible_all 97.7 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 10.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.83 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 1.9200 _refine.aniso_B[1][2] 0.9600 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 1.9200 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] -6.2400 _refine.B_iso_max 162.140 _refine.B_iso_mean 62.6320 _refine.B_iso_min 30.000 _refine.correlation_coeff_Fo_to_Fc 0.9470 _refine.correlation_coeff_Fo_to_Fc_free 0.9460 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7WLP _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.2900 _refine.ls_d_res_low 38.2500 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10817 _refine.ls_number_reflns_R_free 564 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.6400 _refine.ls_percent_reflns_R_free 5.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2278 _refine.ls_R_factor_R_free 0.2416 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2271 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2CV5 _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD WITH PHASES' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.2970 _refine.pdbx_overall_ESU_R_Free 0.2110 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 7.5830 _refine.overall_SU_ML 0.1740 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.2900 _refine_hist.d_res_low 38.2500 _refine_hist.number_atoms_solvent 1 _refine_hist.number_atoms_total 1516 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 192 _refine_hist.pdbx_B_iso_mean_ligand 91.37 _refine_hist.pdbx_B_iso_mean_solvent 78.66 _refine_hist.pdbx_number_atoms_protein 1505 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.010 0.013 1527 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.015 1531 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.509 1.648 2055 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.334 1.589 3513 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.480 5.000 190 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 33.578 19.870 77 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 18.074 15.000 280 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 15.932 15.000 15 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.080 0.200 205 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 1683 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 347 ? r_gen_planes_other ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.2950 _refine_ls_shell.d_res_low 2.3540 _refine_ls_shell.number_reflns_all 785 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 28 _refine_ls_shell.number_reflns_R_work 757 _refine_ls_shell.percent_reflns_obs 96.6700 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3220 _refine_ls_shell.R_factor_R_free_error 0.0000 _refine_ls_shell.R_factor_R_work 0.3170 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 7WLP _struct.title 'Epstein-Barr virus protein BKRF4 restricts nucleosome assembly to suppress host antiviral responses' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7WLP _struct_keywords.text 'Epstein-Barr virus, BKRF4, histones, nucleosomes, DNA double-strand break repair, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 TYR A 6 ? HIS A 18 ? TYR A 6 HIS A 18 1 ? 13 HELX_P HELX_P2 AA2 SER A 24 ? ASN A 53 ? SER A 24 ASN A 53 1 ? 30 HELX_P HELX_P3 AA3 THR A 59 ? LEU A 71 ? THR A 59 LEU A 71 1 ? 13 HELX_P HELX_P4 AA4 PRO A 72 ? SER A 92 ? PRO A 72 SER A 92 1 ? 21 HELX_P HELX_P5 AA5 THR A 98 ? GLY A 104 ? THR A 98 GLY A 104 1 ? 7 HELX_P HELX_P6 AA6 PRO A 108 ? LYS A 118 ? PRO A 108 LYS A 118 1 ? 11 HELX_P HELX_P7 AA7 ALA A 127 ? ASN A 155 ? ALA A 127 ASN A 155 1 ? 29 HELX_P HELX_P8 AA8 ILE A 161 ? ASP A 172 ? ILE A 161 ASP A 172 1 ? 12 HELX_P HELX_P9 AA9 ASP A 172 ? THR A 183 ? ASP A 172 THR A 183 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA2 1 2 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 22 ? ILE A 23 ? GLY A 22 ILE A 23 AA1 2 ARG A 159 ? ILE A 160 ? ARG A 159 ILE A 160 AA2 1 THR A 57 ? ILE A 58 ? THR A 57 ILE A 58 AA2 2 ARG A 124 ? VAL A 125 ? ARG A 124 VAL A 125 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 22 ? N GLY A 22 O ILE A 160 ? O ILE A 160 AA2 1 2 N ILE A 58 ? N ILE A 58 O ARG A 124 ? O ARG A 124 # _atom_sites.entry_id 7WLP _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011329 _atom_sites.fract_transf_matrix[1][2] 0.006541 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013081 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009467 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ARG 2 2 ? ? ? A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 HIS 18 18 18 HIS HIS A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 MET 28 28 28 MET MET A . n A 1 29 GLY 29 29 29 GLY GLY A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 MET 31 31 31 MET MET A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 GLU 40 40 40 GLU GLU A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 ARG 48 48 48 ARG ARG A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 HIS 51 51 51 HIS HIS A . n A 1 52 TYR 52 52 52 TYR TYR A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 SER 60 60 60 SER SER A . n A 1 61 ARG 61 61 61 ARG ARG A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ALA 76 76 76 ALA ALA A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 HIS 78 78 78 HIS HIS A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 THR 84 84 84 THR THR A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 LYS 89 89 89 LYS LYS A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 SER 93 93 93 SER SER A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 ALA 96 96 96 ALA ALA A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 GLN 106 106 106 GLN GLN A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 GLY 110 110 110 GLY GLY A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 VAL 112 112 112 VAL VAL A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 ARG 114 114 114 ARG ARG A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 ASN 120 120 120 ASN ASN A . n A 1 121 TYR 121 121 121 TYR TYR A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 ALA 127 127 127 ALA ALA A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 PRO 130 130 130 PRO PRO A . n A 1 131 VAL 131 131 131 VAL VAL A . n A 1 132 TYR 132 132 132 TYR TYR A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 ALA 135 135 135 ALA ALA A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 GLU 138 138 138 GLU GLU A . n A 1 139 TYR 139 139 139 TYR TYR A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 THR 141 141 141 THR THR A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 ILE 144 144 144 ILE ILE A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 LEU 147 147 147 LEU LEU A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 GLY 149 149 149 GLY GLY A . n A 1 150 ASN 150 150 150 ASN ASN A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 ASP 154 154 154 ASP ASP A . n A 1 155 ASN 155 155 155 ASN ASN A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 LYS 157 157 157 LYS LYS A . n A 1 158 THR 158 158 158 THR THR A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 ILE 160 160 160 ILE ILE A . n A 1 161 ILE 161 161 161 ILE ILE A . n A 1 162 PRO 162 162 162 PRO PRO A . n A 1 163 ARG 163 163 163 ARG ARG A . n A 1 164 HIS 164 164 164 HIS HIS A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 GLN 166 166 166 GLN GLN A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 ILE 169 169 169 ILE ILE A . n A 1 170 ARG 170 170 170 ARG ARG A . n A 1 171 ASN 171 171 171 ASN ASN A . n A 1 172 ASP 172 172 172 ASP ASP A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 ASN 176 176 176 ASN ASN A . n A 1 177 LYS 177 177 177 LYS LYS A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 GLY 180 180 180 GLY GLY A . n A 1 181 LYS 181 181 181 LYS LYS A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 THR 183 183 183 THR THR A . n A 1 184 ILE 184 184 184 ILE ILE A . n A 1 185 ALA 185 185 ? ? ? A . n A 1 186 GLN 186 186 ? ? ? A . n A 1 187 GLY 187 187 ? ? ? A . n A 1 188 GLY 188 188 ? ? ? A . n A 1 189 VAL 189 189 ? ? ? A . n A 1 190 LEU 190 190 ? ? ? A . n A 1 191 PRO 191 191 ? ? ? A . n A 1 192 ASN 192 192 ? ? ? A . n A 1 193 ILE 193 193 ? ? ? A . n B 2 1 MET 1 15 ? ? ? B . n B 2 2 ARG 2 16 ? ? ? B . n B 2 3 ARG 3 17 ? ? ? B . n B 2 4 LEU 4 18 ? ? ? B . n B 2 5 LEU 5 19 ? ? ? B . n B 2 6 SER 6 20 ? ? ? B . n B 2 7 ASP 7 21 ? ? ? B . n B 2 8 GLU 8 22 ? ? ? B . n B 2 9 GLU 9 23 ? ? ? B . n B 2 10 GLU 10 24 ? ? ? B . n B 2 11 GLU 11 25 ? ? ? B . n B 2 12 THR 12 26 ? ? ? B . n B 2 13 SER 13 27 ? ? ? B . n B 2 14 GLN 14 28 ? ? ? B . n B 2 15 SER 15 29 ? ? ? B . n B 2 16 SER 16 30 ? ? ? B . n B 2 17 SER 17 31 ? ? ? B . n B 2 18 TYR 18 32 ? ? ? B . n B 2 19 THR 19 33 ? ? ? B . n B 2 20 LEU 20 34 ? ? ? B . n B 2 21 GLY 21 35 ? ? ? B . n B 2 22 SER 22 36 ? ? ? B . n B 2 23 GLN 23 37 ? ? ? B . n B 2 24 ALA 24 38 ? ? ? B . n B 2 25 SER 25 39 ? ? ? B . n B 2 26 GLN 26 40 ? ? ? B . n B 2 27 SER 27 41 ? ? ? B . n B 2 28 ILE 28 42 ? ? ? B . n B 2 29 GLN 29 43 ? ? ? B . n B 2 30 GLU 30 44 ? ? ? B . n B 2 31 GLU 31 45 ? ? ? B . n B 2 32 ASP 32 46 ? ? ? B . n B 2 33 VAL 33 47 ? ? ? B . n B 2 34 SER 34 48 ? ? ? B . n B 2 35 ASP 35 49 ? ? ? B . n B 2 36 THR 36 50 ? ? ? B . n B 2 37 ASP 37 51 ? ? ? B . n B 2 38 GLU 38 52 ? ? ? B . n B 2 39 SER 39 53 ? ? ? B . n B 2 40 ASP 40 54 ? ? ? B . n B 2 41 TYR 41 55 ? ? ? B . n B 2 42 SER 42 56 ? ? ? B . n B 2 43 ASP 43 57 ? ? ? B . n B 2 44 GLU 44 58 ? ? ? B . n B 2 45 ASP 45 59 ? ? ? B . n B 2 46 GLU 46 60 ? ? ? B . n B 2 47 GLU 47 61 ? ? ? B . n B 2 48 ILE 48 62 ? ? ? B . n B 2 49 ASP 49 63 ? ? ? B . n B 2 50 LEU 50 64 ? ? ? B . n B 2 51 GLU 51 65 ? ? ? B . n B 2 52 GLU 52 66 ? ? ? B . n B 2 53 GLU 53 67 ? ? ? B . n B 2 54 TYR 54 68 ? ? ? B . n B 2 55 PRO 55 69 ? ? ? B . n B 2 56 SER 56 70 ? ? ? B . n B 2 57 ASP 57 71 ? ? ? B . n B 2 58 GLU 58 72 ? ? ? B . n B 2 59 ASP 59 73 ? ? ? B . n B 2 60 PRO 60 74 ? ? ? B . n B 2 61 SER 61 75 ? ? ? B . n B 2 62 GLU 62 76 ? ? ? B . n B 2 63 GLY 63 77 ? ? ? B . n B 2 64 SER 64 78 ? ? ? B . n B 2 65 ASP 65 79 ? ? ? B . n B 2 66 SER 66 80 80 SER SER B . n B 2 67 ASP 67 81 81 ASP ASP B . n B 2 68 PRO 68 82 82 PRO PRO B . n B 2 69 SER 69 83 83 SER SER B . n B 2 70 TRP 70 84 84 TRP TRP B . n B 2 71 HIS 71 85 85 HIS HIS B . n B 2 72 PRO 72 86 86 PRO PRO B . n B 2 73 SER 73 87 ? ? ? B . n B 2 74 ASP 74 88 ? ? ? B . n B 2 75 SER 75 89 ? ? ? B . n B 2 76 ASP 76 90 ? ? ? B . n B 2 77 GLU 77 91 ? ? ? B . n B 2 78 SER 78 92 ? ? ? B . n B 2 79 ASP 79 93 ? ? ? B . n B 2 80 TYR 80 94 ? ? ? B . n B 2 81 SER 81 95 ? ? ? B . n B 2 82 GLU 82 96 ? ? ? B . n B 2 83 SER 83 97 ? ? ? B . n B 2 84 ASP 84 98 ? ? ? B . n B 2 85 GLU 85 99 ? ? ? B . n B 2 86 ASP 86 100 ? ? ? B . n B 2 87 GLU 87 101 ? ? ? B . n B 2 88 ALA 88 102 ? ? ? B . n C 2 1 MET 1 0 ? ? ? D . n C 2 2 ARG 2 1 1 ARG ALA D . n C 2 3 ARG 3 2 2 ARG ALA D . n C 2 4 LEU 4 3 ? ? ? D . n C 2 5 LEU 5 4 ? ? ? D . n C 2 6 SER 6 5 ? ? ? D . n C 2 7 ASP 7 6 ? ? ? D . n C 2 8 GLU 8 7 ? ? ? D . n C 2 9 GLU 9 8 ? ? ? D . n C 2 10 GLU 10 9 ? ? ? D . n C 2 11 GLU 11 10 ? ? ? D . n C 2 12 THR 12 11 ? ? ? D . n C 2 13 SER 13 12 ? ? ? D . n C 2 14 GLN 14 13 ? ? ? D . n C 2 15 SER 15 14 ? ? ? D . n C 2 16 SER 16 15 ? ? ? D . n C 2 17 SER 17 16 ? ? ? D . n C 2 18 TYR 18 17 ? ? ? D . n C 2 19 THR 19 18 ? ? ? D . n C 2 20 LEU 20 19 ? ? ? D . n C 2 21 GLY 21 20 ? ? ? D . n C 2 22 SER 22 21 ? ? ? D . n C 2 23 GLN 23 22 ? ? ? D . n C 2 24 ALA 24 23 ? ? ? D . n C 2 25 SER 25 24 ? ? ? D . n C 2 26 GLN 26 25 ? ? ? D . n C 2 27 SER 27 26 ? ? ? D . n C 2 28 ILE 28 27 ? ? ? D . n C 2 29 GLN 29 28 ? ? ? D . n C 2 30 GLU 30 29 ? ? ? D . n C 2 31 GLU 31 30 ? ? ? D . n C 2 32 ASP 32 31 ? ? ? D . n C 2 33 VAL 33 32 ? ? ? D . n C 2 34 SER 34 33 ? ? ? D . n C 2 35 ASP 35 34 ? ? ? D . n C 2 36 THR 36 35 ? ? ? D . n C 2 37 ASP 37 36 ? ? ? D . n C 2 38 GLU 38 37 ? ? ? D . n C 2 39 SER 39 38 ? ? ? D . n C 2 40 ASP 40 39 ? ? ? D . n C 2 41 TYR 41 40 ? ? ? D . n C 2 42 SER 42 41 ? ? ? D . n C 2 43 ASP 43 42 ? ? ? D . n C 2 44 GLU 44 43 ? ? ? D . n C 2 45 ASP 45 44 ? ? ? D . n C 2 46 GLU 46 45 ? ? ? D . n C 2 47 GLU 47 46 ? ? ? D . n C 2 48 ILE 48 47 ? ? ? D . n C 2 49 ASP 49 48 ? ? ? D . n C 2 50 LEU 50 49 ? ? ? D . n C 2 51 GLU 51 50 ? ? ? D . n C 2 52 GLU 52 51 ? ? ? D . n C 2 53 GLU 53 52 ? ? ? D . n C 2 54 TYR 54 53 ? ? ? D . n C 2 55 PRO 55 54 ? ? ? D . n C 2 56 SER 56 55 ? ? ? D . n C 2 57 ASP 57 56 ? ? ? D . n C 2 58 GLU 58 57 ? ? ? D . n C 2 59 ASP 59 58 ? ? ? D . n C 2 60 PRO 60 59 ? ? ? D . n C 2 61 SER 61 60 ? ? ? D . n C 2 62 GLU 62 61 ? ? ? D . n C 2 63 GLY 63 62 ? ? ? D . n C 2 64 SER 64 63 ? ? ? D . n C 2 65 ASP 65 64 ? ? ? D . n C 2 66 SER 66 65 ? ? ? D . n C 2 67 ASP 67 66 ? ? ? D . n C 2 68 PRO 68 67 ? ? ? D . n C 2 69 SER 69 68 ? ? ? D . n C 2 70 TRP 70 69 ? ? ? D . n C 2 71 HIS 71 70 ? ? ? D . n C 2 72 PRO 72 71 ? ? ? D . n C 2 73 SER 73 72 ? ? ? D . n C 2 74 ASP 74 73 ? ? ? D . n C 2 75 SER 75 74 ? ? ? D . n C 2 76 ASP 76 75 ? ? ? D . n C 2 77 GLU 77 76 ? ? ? D . n C 2 78 SER 78 77 ? ? ? D . n C 2 79 ASP 79 78 ? ? ? D . n C 2 80 TYR 80 79 ? ? ? D . n C 2 81 SER 81 80 ? ? ? D . n C 2 82 GLU 82 81 ? ? ? D . n C 2 83 SER 83 82 ? ? ? D . n C 2 84 ASP 84 83 ? ? ? D . n C 2 85 GLU 85 84 ? ? ? D . n C 2 86 ASP 86 85 ? ? ? D . n C 2 87 GLU 87 86 ? ? ? D . n C 2 88 ALA 88 87 ? ? ? D . n D 2 1 MET 1 0 ? ? ? C . n D 2 2 ARG 2 1 1 ARG ALA C . n D 2 3 ARG 3 2 2 ARG ALA C . n D 2 4 LEU 4 3 3 LEU ALA C . n D 2 5 LEU 5 4 ? ? ? C . n D 2 6 SER 6 5 ? ? ? C . n D 2 7 ASP 7 6 ? ? ? C . n D 2 8 GLU 8 7 ? ? ? C . n D 2 9 GLU 9 8 ? ? ? C . n D 2 10 GLU 10 9 ? ? ? C . n D 2 11 GLU 11 10 ? ? ? C . n D 2 12 THR 12 11 ? ? ? C . n D 2 13 SER 13 12 ? ? ? C . n D 2 14 GLN 14 13 ? ? ? C . n D 2 15 SER 15 14 ? ? ? C . n D 2 16 SER 16 15 ? ? ? C . n D 2 17 SER 17 16 ? ? ? C . n D 2 18 TYR 18 17 ? ? ? C . n D 2 19 THR 19 18 ? ? ? C . n D 2 20 LEU 20 19 ? ? ? C . n D 2 21 GLY 21 20 ? ? ? C . n D 2 22 SER 22 21 ? ? ? C . n D 2 23 GLN 23 22 ? ? ? C . n D 2 24 ALA 24 23 ? ? ? C . n D 2 25 SER 25 24 ? ? ? C . n D 2 26 GLN 26 25 ? ? ? C . n D 2 27 SER 27 26 ? ? ? C . n D 2 28 ILE 28 27 ? ? ? C . n D 2 29 GLN 29 28 ? ? ? C . n D 2 30 GLU 30 29 ? ? ? C . n D 2 31 GLU 31 30 ? ? ? C . n D 2 32 ASP 32 31 ? ? ? C . n D 2 33 VAL 33 32 ? ? ? C . n D 2 34 SER 34 33 ? ? ? C . n D 2 35 ASP 35 34 ? ? ? C . n D 2 36 THR 36 35 ? ? ? C . n D 2 37 ASP 37 36 ? ? ? C . n D 2 38 GLU 38 37 ? ? ? C . n D 2 39 SER 39 38 ? ? ? C . n D 2 40 ASP 40 39 ? ? ? C . n D 2 41 TYR 41 40 ? ? ? C . n D 2 42 SER 42 41 ? ? ? C . n D 2 43 ASP 43 42 ? ? ? C . n D 2 44 GLU 44 43 ? ? ? C . n D 2 45 ASP 45 44 ? ? ? C . n D 2 46 GLU 46 45 ? ? ? C . n D 2 47 GLU 47 46 ? ? ? C . n D 2 48 ILE 48 47 ? ? ? C . n D 2 49 ASP 49 48 ? ? ? C . n D 2 50 LEU 50 49 ? ? ? C . n D 2 51 GLU 51 50 ? ? ? C . n D 2 52 GLU 52 51 ? ? ? C . n D 2 53 GLU 53 52 ? ? ? C . n D 2 54 TYR 54 53 ? ? ? C . n D 2 55 PRO 55 54 ? ? ? C . n D 2 56 SER 56 55 ? ? ? C . n D 2 57 ASP 57 56 ? ? ? C . n D 2 58 GLU 58 57 ? ? ? C . n D 2 59 ASP 59 58 ? ? ? C . n D 2 60 PRO 60 59 ? ? ? C . n D 2 61 SER 61 60 ? ? ? C . n D 2 62 GLU 62 61 ? ? ? C . n D 2 63 GLY 63 62 ? ? ? C . n D 2 64 SER 64 63 ? ? ? C . n D 2 65 ASP 65 64 ? ? ? C . n D 2 66 SER 66 65 ? ? ? C . n D 2 67 ASP 67 66 ? ? ? C . n D 2 68 PRO 68 67 ? ? ? C . n D 2 69 SER 69 68 ? ? ? C . n D 2 70 TRP 70 69 ? ? ? C . n D 2 71 HIS 71 70 ? ? ? C . n D 2 72 PRO 72 71 ? ? ? C . n D 2 73 SER 73 72 ? ? ? C . n D 2 74 ASP 74 73 ? ? ? C . n D 2 75 SER 75 74 ? ? ? C . n D 2 76 ASP 76 75 ? ? ? C . n D 2 77 GLU 77 76 ? ? ? C . n D 2 78 SER 78 77 ? ? ? C . n D 2 79 ASP 79 78 ? ? ? C . n D 2 80 TYR 80 79 ? ? ? C . n D 2 81 SER 81 80 ? ? ? C . n D 2 82 GLU 82 81 ? ? ? C . n D 2 83 SER 83 82 ? ? ? C . n D 2 84 ASP 84 83 ? ? ? C . n D 2 85 GLU 85 84 ? ? ? C . n D 2 86 ASP 86 85 ? ? ? C . n D 2 87 GLU 87 86 ? ? ? C . n D 2 88 ALA 88 87 ? ? ? C . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email zhouzh@ibp.ac.cn _pdbx_contact_author.name_first zheng _pdbx_contact_author.name_last ZHOU _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-1423-7231 # _pdbx_nonpoly_scheme.asym_id E _pdbx_nonpoly_scheme.entity_id 3 _pdbx_nonpoly_scheme.mon_id HOH _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 301 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id HOH _pdbx_nonpoly_scheme.auth_mon_id HOH _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1620 ? 1 MORE -24 ? 1 'SSA (A^2)' 10350 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-11-16 2 'Structure model' 1 1 2022-11-23 3 'Structure model' 1 2 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 7WLP _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 95 ? ? 56.44 -145.62 2 1 THR A 98 ? ? -47.66 152.40 3 1 ASN A 120 ? ? -73.58 -71.82 4 1 TYR A 121 ? ? 68.88 -12.93 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 D ARG 1 ? CG ? C ARG 2 CG 2 1 Y 1 D ARG 1 ? CD ? C ARG 2 CD 3 1 Y 1 D ARG 1 ? NE ? C ARG 2 NE 4 1 Y 1 D ARG 1 ? CZ ? C ARG 2 CZ 5 1 Y 1 D ARG 1 ? NH1 ? C ARG 2 NH1 6 1 Y 1 D ARG 1 ? NH2 ? C ARG 2 NH2 7 1 Y 1 D ARG 2 ? CG ? C ARG 3 CG 8 1 Y 1 D ARG 2 ? CD ? C ARG 3 CD 9 1 Y 1 D ARG 2 ? NE ? C ARG 3 NE 10 1 Y 1 D ARG 2 ? CZ ? C ARG 3 CZ 11 1 Y 1 D ARG 2 ? NH1 ? C ARG 3 NH1 12 1 Y 1 D ARG 2 ? NH2 ? C ARG 3 NH2 13 1 Y 1 C ARG 1 ? CG ? D ARG 2 CG 14 1 Y 1 C ARG 1 ? CD ? D ARG 2 CD 15 1 Y 1 C ARG 1 ? NE ? D ARG 2 NE 16 1 Y 1 C ARG 1 ? CZ ? D ARG 2 CZ 17 1 Y 1 C ARG 1 ? NH1 ? D ARG 2 NH1 18 1 Y 1 C ARG 1 ? NH2 ? D ARG 2 NH2 19 1 Y 1 C ARG 2 ? CG ? D ARG 3 CG 20 1 Y 1 C ARG 2 ? CD ? D ARG 3 CD 21 1 Y 1 C ARG 2 ? NE ? D ARG 3 NE 22 1 Y 1 C ARG 2 ? CZ ? D ARG 3 CZ 23 1 Y 1 C ARG 2 ? NH1 ? D ARG 3 NH1 24 1 Y 1 C ARG 2 ? NH2 ? D ARG 3 NH2 25 1 Y 1 C LEU 3 ? CG ? D LEU 4 CG 26 1 Y 1 C LEU 3 ? CD1 ? D LEU 4 CD1 27 1 Y 1 C LEU 3 ? CD2 ? D LEU 4 CD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ARG 2 ? A ARG 2 3 1 Y 1 A ALA 185 ? A ALA 185 4 1 Y 1 A GLN 186 ? A GLN 186 5 1 Y 1 A GLY 187 ? A GLY 187 6 1 Y 1 A GLY 188 ? A GLY 188 7 1 Y 1 A VAL 189 ? A VAL 189 8 1 Y 1 A LEU 190 ? A LEU 190 9 1 Y 1 A PRO 191 ? A PRO 191 10 1 Y 1 A ASN 192 ? A ASN 192 11 1 Y 1 A ILE 193 ? A ILE 193 12 1 Y 1 B MET 15 ? B MET 1 13 1 Y 1 B ARG 16 ? B ARG 2 14 1 Y 1 B ARG 17 ? B ARG 3 15 1 Y 1 B LEU 18 ? B LEU 4 16 1 Y 1 B LEU 19 ? B LEU 5 17 1 Y 1 B SER 20 ? B SER 6 18 1 Y 1 B ASP 21 ? B ASP 7 19 1 Y 1 B GLU 22 ? B GLU 8 20 1 Y 1 B GLU 23 ? B GLU 9 21 1 Y 1 B GLU 24 ? B GLU 10 22 1 Y 1 B GLU 25 ? B GLU 11 23 1 Y 1 B THR 26 ? B THR 12 24 1 Y 1 B SER 27 ? B SER 13 25 1 Y 1 B GLN 28 ? B GLN 14 26 1 Y 1 B SER 29 ? B SER 15 27 1 Y 1 B SER 30 ? B SER 16 28 1 Y 1 B SER 31 ? B SER 17 29 1 Y 1 B TYR 32 ? B TYR 18 30 1 Y 1 B THR 33 ? B THR 19 31 1 Y 1 B LEU 34 ? B LEU 20 32 1 Y 1 B GLY 35 ? B GLY 21 33 1 Y 1 B SER 36 ? B SER 22 34 1 Y 1 B GLN 37 ? B GLN 23 35 1 Y 1 B ALA 38 ? B ALA 24 36 1 Y 1 B SER 39 ? B SER 25 37 1 Y 1 B GLN 40 ? B GLN 26 38 1 Y 1 B SER 41 ? B SER 27 39 1 Y 1 B ILE 42 ? B ILE 28 40 1 Y 1 B GLN 43 ? B GLN 29 41 1 Y 1 B GLU 44 ? B GLU 30 42 1 Y 1 B GLU 45 ? B GLU 31 43 1 Y 1 B ASP 46 ? B ASP 32 44 1 Y 1 B VAL 47 ? B VAL 33 45 1 Y 1 B SER 48 ? B SER 34 46 1 Y 1 B ASP 49 ? B ASP 35 47 1 Y 1 B THR 50 ? B THR 36 48 1 Y 1 B ASP 51 ? B ASP 37 49 1 Y 1 B GLU 52 ? B GLU 38 50 1 Y 1 B SER 53 ? B SER 39 51 1 Y 1 B ASP 54 ? B ASP 40 52 1 Y 1 B TYR 55 ? B TYR 41 53 1 Y 1 B SER 56 ? B SER 42 54 1 Y 1 B ASP 57 ? B ASP 43 55 1 Y 1 B GLU 58 ? B GLU 44 56 1 Y 1 B ASP 59 ? B ASP 45 57 1 Y 1 B GLU 60 ? B GLU 46 58 1 Y 1 B GLU 61 ? B GLU 47 59 1 Y 1 B ILE 62 ? B ILE 48 60 1 Y 1 B ASP 63 ? B ASP 49 61 1 Y 1 B LEU 64 ? B LEU 50 62 1 Y 1 B GLU 65 ? B GLU 51 63 1 Y 1 B GLU 66 ? B GLU 52 64 1 Y 1 B GLU 67 ? B GLU 53 65 1 Y 1 B TYR 68 ? B TYR 54 66 1 Y 1 B PRO 69 ? B PRO 55 67 1 Y 1 B SER 70 ? B SER 56 68 1 Y 1 B ASP 71 ? B ASP 57 69 1 Y 1 B GLU 72 ? B GLU 58 70 1 Y 1 B ASP 73 ? B ASP 59 71 1 Y 1 B PRO 74 ? B PRO 60 72 1 Y 1 B SER 75 ? B SER 61 73 1 Y 1 B GLU 76 ? B GLU 62 74 1 Y 1 B GLY 77 ? B GLY 63 75 1 Y 1 B SER 78 ? B SER 64 76 1 Y 1 B ASP 79 ? B ASP 65 77 1 Y 1 B SER 87 ? B SER 73 78 1 Y 1 B ASP 88 ? B ASP 74 79 1 Y 1 B SER 89 ? B SER 75 80 1 Y 1 B ASP 90 ? B ASP 76 81 1 Y 1 B GLU 91 ? B GLU 77 82 1 Y 1 B SER 92 ? B SER 78 83 1 Y 1 B ASP 93 ? B ASP 79 84 1 Y 1 B TYR 94 ? B TYR 80 85 1 Y 1 B SER 95 ? B SER 81 86 1 Y 1 B GLU 96 ? B GLU 82 87 1 Y 1 B SER 97 ? B SER 83 88 1 Y 1 B ASP 98 ? B ASP 84 89 1 Y 1 B GLU 99 ? B GLU 85 90 1 Y 1 B ASP 100 ? B ASP 86 91 1 Y 1 B GLU 101 ? B GLU 87 92 1 Y 1 B ALA 102 ? B ALA 88 93 1 Y 1 D MET 0 ? C MET 1 94 1 Y 1 D LEU 3 ? C LEU 4 95 1 Y 1 D LEU 4 ? C LEU 5 96 1 Y 1 D SER 5 ? C SER 6 97 1 Y 1 D ASP 6 ? C ASP 7 98 1 Y 1 D GLU 7 ? C GLU 8 99 1 Y 1 D GLU 8 ? C GLU 9 100 1 Y 1 D GLU 9 ? C GLU 10 101 1 Y 1 D GLU 10 ? C GLU 11 102 1 Y 1 D THR 11 ? C THR 12 103 1 Y 1 D SER 12 ? C SER 13 104 1 Y 1 D GLN 13 ? C GLN 14 105 1 Y 1 D SER 14 ? C SER 15 106 1 Y 1 D SER 15 ? C SER 16 107 1 Y 1 D SER 16 ? C SER 17 108 1 Y 1 D TYR 17 ? C TYR 18 109 1 Y 1 D THR 18 ? C THR 19 110 1 Y 1 D LEU 19 ? C LEU 20 111 1 Y 1 D GLY 20 ? C GLY 21 112 1 Y 1 D SER 21 ? C SER 22 113 1 Y 1 D GLN 22 ? C GLN 23 114 1 Y 1 D ALA 23 ? C ALA 24 115 1 Y 1 D SER 24 ? C SER 25 116 1 Y 1 D GLN 25 ? C GLN 26 117 1 Y 1 D SER 26 ? C SER 27 118 1 Y 1 D ILE 27 ? C ILE 28 119 1 Y 1 D GLN 28 ? C GLN 29 120 1 Y 1 D GLU 29 ? C GLU 30 121 1 Y 1 D GLU 30 ? C GLU 31 122 1 Y 1 D ASP 31 ? C ASP 32 123 1 Y 1 D VAL 32 ? C VAL 33 124 1 Y 1 D SER 33 ? C SER 34 125 1 Y 1 D ASP 34 ? C ASP 35 126 1 Y 1 D THR 35 ? C THR 36 127 1 Y 1 D ASP 36 ? C ASP 37 128 1 Y 1 D GLU 37 ? C GLU 38 129 1 Y 1 D SER 38 ? C SER 39 130 1 Y 1 D ASP 39 ? C ASP 40 131 1 Y 1 D TYR 40 ? C TYR 41 132 1 Y 1 D SER 41 ? C SER 42 133 1 Y 1 D ASP 42 ? C ASP 43 134 1 Y 1 D GLU 43 ? C GLU 44 135 1 Y 1 D ASP 44 ? C ASP 45 136 1 Y 1 D GLU 45 ? C GLU 46 137 1 Y 1 D GLU 46 ? C GLU 47 138 1 Y 1 D ILE 47 ? C ILE 48 139 1 Y 1 D ASP 48 ? C ASP 49 140 1 Y 1 D LEU 49 ? C LEU 50 141 1 Y 1 D GLU 50 ? C GLU 51 142 1 Y 1 D GLU 51 ? C GLU 52 143 1 Y 1 D GLU 52 ? C GLU 53 144 1 Y 1 D TYR 53 ? C TYR 54 145 1 Y 1 D PRO 54 ? C PRO 55 146 1 Y 1 D SER 55 ? C SER 56 147 1 Y 1 D ASP 56 ? C ASP 57 148 1 Y 1 D GLU 57 ? C GLU 58 149 1 Y 1 D ASP 58 ? C ASP 59 150 1 Y 1 D PRO 59 ? C PRO 60 151 1 Y 1 D SER 60 ? C SER 61 152 1 Y 1 D GLU 61 ? C GLU 62 153 1 Y 1 D GLY 62 ? C GLY 63 154 1 Y 1 D SER 63 ? C SER 64 155 1 Y 1 D ASP 64 ? C ASP 65 156 1 Y 1 D SER 65 ? C SER 66 157 1 Y 1 D ASP 66 ? C ASP 67 158 1 Y 1 D PRO 67 ? C PRO 68 159 1 Y 1 D SER 68 ? C SER 69 160 1 Y 1 D TRP 69 ? C TRP 70 161 1 Y 1 D HIS 70 ? C HIS 71 162 1 Y 1 D PRO 71 ? C PRO 72 163 1 Y 1 D SER 72 ? C SER 73 164 1 Y 1 D ASP 73 ? C ASP 74 165 1 Y 1 D SER 74 ? C SER 75 166 1 Y 1 D ASP 75 ? C ASP 76 167 1 Y 1 D GLU 76 ? C GLU 77 168 1 Y 1 D SER 77 ? C SER 78 169 1 Y 1 D ASP 78 ? C ASP 79 170 1 Y 1 D TYR 79 ? C TYR 80 171 1 Y 1 D SER 80 ? C SER 81 172 1 Y 1 D GLU 81 ? C GLU 82 173 1 Y 1 D SER 82 ? C SER 83 174 1 Y 1 D ASP 83 ? C ASP 84 175 1 Y 1 D GLU 84 ? C GLU 85 176 1 Y 1 D ASP 85 ? C ASP 86 177 1 Y 1 D GLU 86 ? C GLU 87 178 1 Y 1 D ALA 87 ? C ALA 88 179 1 Y 1 C MET 0 ? D MET 1 180 1 Y 1 C LEU 4 ? D LEU 5 181 1 Y 1 C SER 5 ? D SER 6 182 1 Y 1 C ASP 6 ? D ASP 7 183 1 Y 1 C GLU 7 ? D GLU 8 184 1 Y 1 C GLU 8 ? D GLU 9 185 1 Y 1 C GLU 9 ? D GLU 10 186 1 Y 1 C GLU 10 ? D GLU 11 187 1 Y 1 C THR 11 ? D THR 12 188 1 Y 1 C SER 12 ? D SER 13 189 1 Y 1 C GLN 13 ? D GLN 14 190 1 Y 1 C SER 14 ? D SER 15 191 1 Y 1 C SER 15 ? D SER 16 192 1 Y 1 C SER 16 ? D SER 17 193 1 Y 1 C TYR 17 ? D TYR 18 194 1 Y 1 C THR 18 ? D THR 19 195 1 Y 1 C LEU 19 ? D LEU 20 196 1 Y 1 C GLY 20 ? D GLY 21 197 1 Y 1 C SER 21 ? D SER 22 198 1 Y 1 C GLN 22 ? D GLN 23 199 1 Y 1 C ALA 23 ? D ALA 24 200 1 Y 1 C SER 24 ? D SER 25 201 1 Y 1 C GLN 25 ? D GLN 26 202 1 Y 1 C SER 26 ? D SER 27 203 1 Y 1 C ILE 27 ? D ILE 28 204 1 Y 1 C GLN 28 ? D GLN 29 205 1 Y 1 C GLU 29 ? D GLU 30 206 1 Y 1 C GLU 30 ? D GLU 31 207 1 Y 1 C ASP 31 ? D ASP 32 208 1 Y 1 C VAL 32 ? D VAL 33 209 1 Y 1 C SER 33 ? D SER 34 210 1 Y 1 C ASP 34 ? D ASP 35 211 1 Y 1 C THR 35 ? D THR 36 212 1 Y 1 C ASP 36 ? D ASP 37 213 1 Y 1 C GLU 37 ? D GLU 38 214 1 Y 1 C SER 38 ? D SER 39 215 1 Y 1 C ASP 39 ? D ASP 40 216 1 Y 1 C TYR 40 ? D TYR 41 217 1 Y 1 C SER 41 ? D SER 42 218 1 Y 1 C ASP 42 ? D ASP 43 219 1 Y 1 C GLU 43 ? D GLU 44 220 1 Y 1 C ASP 44 ? D ASP 45 221 1 Y 1 C GLU 45 ? D GLU 46 222 1 Y 1 C GLU 46 ? D GLU 47 223 1 Y 1 C ILE 47 ? D ILE 48 224 1 Y 1 C ASP 48 ? D ASP 49 225 1 Y 1 C LEU 49 ? D LEU 50 226 1 Y 1 C GLU 50 ? D GLU 51 227 1 Y 1 C GLU 51 ? D GLU 52 228 1 Y 1 C GLU 52 ? D GLU 53 229 1 Y 1 C TYR 53 ? D TYR 54 230 1 Y 1 C PRO 54 ? D PRO 55 231 1 Y 1 C SER 55 ? D SER 56 232 1 Y 1 C ASP 56 ? D ASP 57 233 1 Y 1 C GLU 57 ? D GLU 58 234 1 Y 1 C ASP 58 ? D ASP 59 235 1 Y 1 C PRO 59 ? D PRO 60 236 1 Y 1 C SER 60 ? D SER 61 237 1 Y 1 C GLU 61 ? D GLU 62 238 1 Y 1 C GLY 62 ? D GLY 63 239 1 Y 1 C SER 63 ? D SER 64 240 1 Y 1 C ASP 64 ? D ASP 65 241 1 Y 1 C SER 65 ? D SER 66 242 1 Y 1 C ASP 66 ? D ASP 67 243 1 Y 1 C PRO 67 ? D PRO 68 244 1 Y 1 C SER 68 ? D SER 69 245 1 Y 1 C TRP 69 ? D TRP 70 246 1 Y 1 C HIS 70 ? D HIS 71 247 1 Y 1 C PRO 71 ? D PRO 72 248 1 Y 1 C SER 72 ? D SER 73 249 1 Y 1 C ASP 73 ? D ASP 74 250 1 Y 1 C SER 74 ? D SER 75 251 1 Y 1 C ASP 75 ? D ASP 76 252 1 Y 1 C GLU 76 ? D GLU 77 253 1 Y 1 C SER 77 ? D SER 78 254 1 Y 1 C ASP 78 ? D ASP 79 255 1 Y 1 C TYR 79 ? D TYR 80 256 1 Y 1 C SER 80 ? D SER 81 257 1 Y 1 C GLU 81 ? D GLU 82 258 1 Y 1 C SER 82 ? D SER 83 259 1 Y 1 C ASP 83 ? D ASP 84 260 1 Y 1 C GLU 84 ? D GLU 85 261 1 Y 1 C ASP 85 ? D ASP 86 262 1 Y 1 C GLU 86 ? D GLU 87 263 1 Y 1 C ALA 87 ? D ALA 88 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 THR N N N N 290 THR CA C N S 291 THR C C N N 292 THR O O N N 293 THR CB C N R 294 THR OG1 O N N 295 THR CG2 C N N 296 THR OXT O N N 297 THR H H N N 298 THR H2 H N N 299 THR HA H N N 300 THR HB H N N 301 THR HG1 H N N 302 THR HG21 H N N 303 THR HG22 H N N 304 THR HG23 H N N 305 THR HXT H N N 306 TRP N N N N 307 TRP CA C N S 308 TRP C C N N 309 TRP O O N N 310 TRP CB C N N 311 TRP CG C Y N 312 TRP CD1 C Y N 313 TRP CD2 C Y N 314 TRP NE1 N Y N 315 TRP CE2 C Y N 316 TRP CE3 C Y N 317 TRP CZ2 C Y N 318 TRP CZ3 C Y N 319 TRP CH2 C Y N 320 TRP OXT O N N 321 TRP H H N N 322 TRP H2 H N N 323 TRP HA H N N 324 TRP HB2 H N N 325 TRP HB3 H N N 326 TRP HD1 H N N 327 TRP HE1 H N N 328 TRP HE3 H N N 329 TRP HZ2 H N N 330 TRP HZ3 H N N 331 TRP HH2 H N N 332 TRP HXT H N N 333 TYR N N N N 334 TYR CA C N S 335 TYR C C N N 336 TYR O O N N 337 TYR CB C N N 338 TYR CG C Y N 339 TYR CD1 C Y N 340 TYR CD2 C Y N 341 TYR CE1 C Y N 342 TYR CE2 C Y N 343 TYR CZ C Y N 344 TYR OH O N N 345 TYR OXT O N N 346 TYR H H N N 347 TYR H2 H N N 348 TYR HA H N N 349 TYR HB2 H N N 350 TYR HB3 H N N 351 TYR HD1 H N N 352 TYR HD2 H N N 353 TYR HE1 H N N 354 TYR HE2 H N N 355 TYR HH H N N 356 TYR HXT H N N 357 VAL N N N N 358 VAL CA C N S 359 VAL C C N N 360 VAL O O N N 361 VAL CB C N N 362 VAL CG1 C N N 363 VAL CG2 C N N 364 VAL OXT O N N 365 VAL H H N N 366 VAL H2 H N N 367 VAL HA H N N 368 VAL HB H N N 369 VAL HG11 H N N 370 VAL HG12 H N N 371 VAL HG13 H N N 372 VAL HG21 H N N 373 VAL HG22 H N N 374 VAL HG23 H N N 375 VAL HXT H N N 376 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 31970621 _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2CV5 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #