data_7WM5 # _entry.id 7WM5 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7WM5 pdb_00007wm5 10.2210/pdb7wm5/pdb WWPDB D_1300025555 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7WM5 _pdbx_database_status.recvd_initial_deposition_date 2022-01-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jeong, H.' 1 0000-0002-2537-2017 'Kim, J.' 2 0000-0001-5213-9299 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Protein Sci.' _citation.journal_id_ASTM PRCIEI _citation.journal_id_CSD 0795 _citation.journal_id_ISSN 1469-896X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 31 _citation.language ? _citation.page_first e4319 _citation.page_last e4319 _citation.title 'Structural and functional characterization of TrmM in m 6 A modification of bacterial tRNA.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/pro.4319 _citation.pdbx_database_id_PubMed 35481631 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jeong, H.' 1 ? primary 'Lee, Y.' 2 ? primary 'Kim, J.' 3 0000-0001-5213-9299 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7WM5 _cell.details ? _cell.formula_units_Z ? _cell.length_a 112.710 _cell.length_a_esd ? _cell.length_b 112.710 _cell.length_b_esd ? _cell.length_c 110.178 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 18 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7WM5 _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Methyltransferase 30048.598 1 ? ? ? ? 2 water nat water 18.015 30 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MRGSHHHHHHGRSGDDDDKMKVLNDLLGYKNRKLYQDNKMFNFTLDSVLVARFCNLNSKKKKICDFGTNNAVIPLILSKY TKAKIIGVEIQNKAVEIANENIKLNGLEDQIEIVHADIKEFSKLHNQEFDLVVCNPPFFKMDGNPKLKEISLEVANARHE ILITLEDIIKSASRCLKNKGNFTIVHRSERLSEIINLFYKYNIYPKRLRLIQSKKTDNAKMILLDGIYQGNEGMEILPTL ITHNDDETYTDELLKYFHD ; _entity_poly.pdbx_seq_one_letter_code_can ;MRGSHHHHHHGRSGDDDDKMKVLNDLLGYKNRKLYQDNKMFNFTLDSVLVARFCNLNSKKKKICDFGTNNAVIPLILSKY TKAKIIGVEIQNKAVEIANENIKLNGLEDQIEIVHADIKEFSKLHNQEFDLVVCNPPFFKMDGNPKLKEISLEVANARHE ILITLEDIIKSASRCLKNKGNFTIVHRSERLSEIINLFYKYNIYPKRLRLIQSKKTDNAKMILLDGIYQGNEGMEILPTL ITHNDDETYTDELLKYFHD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ARG n 1 3 GLY n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 GLY n 1 12 ARG n 1 13 SER n 1 14 GLY n 1 15 ASP n 1 16 ASP n 1 17 ASP n 1 18 ASP n 1 19 LYS n 1 20 MET n 1 21 LYS n 1 22 VAL n 1 23 LEU n 1 24 ASN n 1 25 ASP n 1 26 LEU n 1 27 LEU n 1 28 GLY n 1 29 TYR n 1 30 LYS n 1 31 ASN n 1 32 ARG n 1 33 LYS n 1 34 LEU n 1 35 TYR n 1 36 GLN n 1 37 ASP n 1 38 ASN n 1 39 LYS n 1 40 MET n 1 41 PHE n 1 42 ASN n 1 43 PHE n 1 44 THR n 1 45 LEU n 1 46 ASP n 1 47 SER n 1 48 VAL n 1 49 LEU n 1 50 VAL n 1 51 ALA n 1 52 ARG n 1 53 PHE n 1 54 CYS n 1 55 ASN n 1 56 LEU n 1 57 ASN n 1 58 SER n 1 59 LYS n 1 60 LYS n 1 61 LYS n 1 62 LYS n 1 63 ILE n 1 64 CYS n 1 65 ASP n 1 66 PHE n 1 67 GLY n 1 68 THR n 1 69 ASN n 1 70 ASN n 1 71 ALA n 1 72 VAL n 1 73 ILE n 1 74 PRO n 1 75 LEU n 1 76 ILE n 1 77 LEU n 1 78 SER n 1 79 LYS n 1 80 TYR n 1 81 THR n 1 82 LYS n 1 83 ALA n 1 84 LYS n 1 85 ILE n 1 86 ILE n 1 87 GLY n 1 88 VAL n 1 89 GLU n 1 90 ILE n 1 91 GLN n 1 92 ASN n 1 93 LYS n 1 94 ALA n 1 95 VAL n 1 96 GLU n 1 97 ILE n 1 98 ALA n 1 99 ASN n 1 100 GLU n 1 101 ASN n 1 102 ILE n 1 103 LYS n 1 104 LEU n 1 105 ASN n 1 106 GLY n 1 107 LEU n 1 108 GLU n 1 109 ASP n 1 110 GLN n 1 111 ILE n 1 112 GLU n 1 113 ILE n 1 114 VAL n 1 115 HIS n 1 116 ALA n 1 117 ASP n 1 118 ILE n 1 119 LYS n 1 120 GLU n 1 121 PHE n 1 122 SER n 1 123 LYS n 1 124 LEU n 1 125 HIS n 1 126 ASN n 1 127 GLN n 1 128 GLU n 1 129 PHE n 1 130 ASP n 1 131 LEU n 1 132 VAL n 1 133 VAL n 1 134 CYS n 1 135 ASN n 1 136 PRO n 1 137 PRO n 1 138 PHE n 1 139 PHE n 1 140 LYS n 1 141 MET n 1 142 ASP n 1 143 GLY n 1 144 ASN n 1 145 PRO n 1 146 LYS n 1 147 LEU n 1 148 LYS n 1 149 GLU n 1 150 ILE n 1 151 SER n 1 152 LEU n 1 153 GLU n 1 154 VAL n 1 155 ALA n 1 156 ASN n 1 157 ALA n 1 158 ARG n 1 159 HIS n 1 160 GLU n 1 161 ILE n 1 162 LEU n 1 163 ILE n 1 164 THR n 1 165 LEU n 1 166 GLU n 1 167 ASP n 1 168 ILE n 1 169 ILE n 1 170 LYS n 1 171 SER n 1 172 ALA n 1 173 SER n 1 174 ARG n 1 175 CYS n 1 176 LEU n 1 177 LYS n 1 178 ASN n 1 179 LYS n 1 180 GLY n 1 181 ASN n 1 182 PHE n 1 183 THR n 1 184 ILE n 1 185 VAL n 1 186 HIS n 1 187 ARG n 1 188 SER n 1 189 GLU n 1 190 ARG n 1 191 LEU n 1 192 SER n 1 193 GLU n 1 194 ILE n 1 195 ILE n 1 196 ASN n 1 197 LEU n 1 198 PHE n 1 199 TYR n 1 200 LYS n 1 201 TYR n 1 202 ASN n 1 203 ILE n 1 204 TYR n 1 205 PRO n 1 206 LYS n 1 207 ARG n 1 208 LEU n 1 209 ARG n 1 210 LEU n 1 211 ILE n 1 212 GLN n 1 213 SER n 1 214 LYS n 1 215 LYS n 1 216 THR n 1 217 ASP n 1 218 ASN n 1 219 ALA n 1 220 LYS n 1 221 MET n 1 222 ILE n 1 223 LEU n 1 224 LEU n 1 225 ASP n 1 226 GLY n 1 227 ILE n 1 228 TYR n 1 229 GLN n 1 230 GLY n 1 231 ASN n 1 232 GLU n 1 233 GLY n 1 234 MET n 1 235 GLU n 1 236 ILE n 1 237 LEU n 1 238 PRO n 1 239 THR n 1 240 LEU n 1 241 ILE n 1 242 THR n 1 243 HIS n 1 244 ASN n 1 245 ASP n 1 246 ASP n 1 247 GLU n 1 248 THR n 1 249 TYR n 1 250 THR n 1 251 ASP n 1 252 GLU n 1 253 LEU n 1 254 LEU n 1 255 LYS n 1 256 TYR n 1 257 PHE n 1 258 HIS n 1 259 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 259 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MCGM508_01850 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycoplasma capricolum subsp. capricolum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 40479 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0A0C2W699_MYCCA _struct_ref.pdbx_db_accession A0A0C2W699 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKVLNDLLGYKNRKLYQDNKMFNFTLDSVLVARFCNLNSKKKKICDFGTNNAVIPLILSKYTKAKIIGVEIQNKAVEIAN ENIKLNGLEDQIEIVHADIKEFSKLHNQEFDLVVCNPPFFKMDGNPKLKEISLEVANARHEILITLEDIIKSASRCLKNK GNFTIVHRSERLSEIINLFYKYNIYPKRLRLIQSKKTDNAKMILLDGIYQGNEGMEILPTLITHNDDETYTDELLKYFHD ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7WM5 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 20 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 259 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0A0C2W699 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 240 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 240 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7WM5 MET A 1 ? UNP A0A0C2W699 ? ? 'initiating methionine' -18 1 1 7WM5 ARG A 2 ? UNP A0A0C2W699 ? ? 'expression tag' -17 2 1 7WM5 GLY A 3 ? UNP A0A0C2W699 ? ? 'expression tag' -16 3 1 7WM5 SER A 4 ? UNP A0A0C2W699 ? ? 'expression tag' -15 4 1 7WM5 HIS A 5 ? UNP A0A0C2W699 ? ? 'expression tag' -14 5 1 7WM5 HIS A 6 ? UNP A0A0C2W699 ? ? 'expression tag' -13 6 1 7WM5 HIS A 7 ? UNP A0A0C2W699 ? ? 'expression tag' -12 7 1 7WM5 HIS A 8 ? UNP A0A0C2W699 ? ? 'expression tag' -11 8 1 7WM5 HIS A 9 ? UNP A0A0C2W699 ? ? 'expression tag' -10 9 1 7WM5 HIS A 10 ? UNP A0A0C2W699 ? ? 'expression tag' -9 10 1 7WM5 GLY A 11 ? UNP A0A0C2W699 ? ? 'expression tag' -8 11 1 7WM5 ARG A 12 ? UNP A0A0C2W699 ? ? 'expression tag' -7 12 1 7WM5 SER A 13 ? UNP A0A0C2W699 ? ? 'expression tag' -6 13 1 7WM5 GLY A 14 ? UNP A0A0C2W699 ? ? 'expression tag' -5 14 1 7WM5 ASP A 15 ? UNP A0A0C2W699 ? ? 'expression tag' -4 15 1 7WM5 ASP A 16 ? UNP A0A0C2W699 ? ? 'expression tag' -3 16 1 7WM5 ASP A 17 ? UNP A0A0C2W699 ? ? 'expression tag' -2 17 1 7WM5 ASP A 18 ? UNP A0A0C2W699 ? ? 'expression tag' -1 18 1 7WM5 LYS A 19 ? UNP A0A0C2W699 ? ? 'expression tag' 0 19 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7WM5 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.24 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.12 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;2.0 M Sodium chloride 10% w/v Polyethylene glycol 6,000 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-07-28 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PAL/PLS BEAMLINE 5C (4A)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline '5C (4A)' _diffrn_source.pdbx_synchrotron_site PAL/PLS # _reflns.B_iso_Wilson_estimate 40.090 _reflns.entry_id 7WM5 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.150 _reflns.d_resolution_low 30.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13888 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 93.300 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.100 _reflns.pdbx_Rmerge_I_obs 0.082 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 5.800 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.805 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.091 _reflns.pdbx_Rpim_I_all 0.039 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 71295 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.150 2.190 ? ? ? ? ? ? 674 91.800 ? ? ? ? 0.567 ? ? ? ? ? ? ? ? 3.800 ? 0.465 ? ? 0.649 0.305 ? 1 1 0.898 ? ? ? ? ? ? ? ? ? ? 2.190 2.230 ? ? ? ? ? ? 706 95.900 ? ? ? ? 0.539 ? ? ? ? ? ? ? ? 3.900 ? 0.466 ? ? 0.615 0.287 ? 2 1 0.909 ? ? ? ? ? ? ? ? ? ? 2.230 2.270 ? ? ? ? ? ? 708 96.500 ? ? ? ? 0.579 ? ? ? ? ? ? ? ? 4.400 ? 0.486 ? ? 0.650 0.285 ? 3 1 0.924 ? ? ? ? ? ? ? ? ? ? 2.270 2.320 ? ? ? ? ? ? 694 95.700 ? ? ? ? 0.550 ? ? ? ? ? ? ? ? 5.000 ? 0.447 ? ? 0.608 0.250 ? 4 1 0.940 ? ? ? ? ? ? ? ? ? ? 2.320 2.370 ? ? ? ? ? ? 704 96.400 ? ? ? ? 0.472 ? ? ? ? ? ? ? ? 5.200 ? 0.452 ? ? 0.522 0.212 ? 5 1 0.956 ? ? ? ? ? ? ? ? ? ? 2.370 2.420 ? ? ? ? ? ? 712 95.200 ? ? ? ? 0.496 ? ? ? ? ? ? ? ? 5.300 ? 0.494 ? ? 0.547 0.219 ? 6 1 0.939 ? ? ? ? ? ? ? ? ? ? 2.420 2.480 ? ? ? ? ? ? 689 95.200 ? ? ? ? 0.405 ? ? ? ? ? ? ? ? 5.300 ? 0.462 ? ? 0.447 0.180 ? 7 1 0.964 ? ? ? ? ? ? ? ? ? ? 2.480 2.550 ? ? ? ? ? ? 705 94.800 ? ? ? ? 0.293 ? ? ? ? ? ? ? ? 5.200 ? 0.491 ? ? 0.324 0.132 ? 8 1 0.975 ? ? ? ? ? ? ? ? ? ? 2.550 2.620 ? ? ? ? ? ? 696 94.100 ? ? ? ? 0.269 ? ? ? ? ? ? ? ? 4.800 ? 0.589 ? ? 0.301 0.130 ? 9 1 0.967 ? ? ? ? ? ? ? ? ? ? 2.620 2.710 ? ? ? ? ? ? 698 94.200 ? ? ? ? 0.229 ? ? ? ? ? ? ? ? 5.100 ? 0.553 ? ? 0.255 0.106 ? 10 1 0.982 ? ? ? ? ? ? ? ? ? ? 2.710 2.810 ? ? ? ? ? ? 690 93.400 ? ? ? ? 0.187 ? ? ? ? ? ? ? ? 5.100 ? 0.655 ? ? 0.211 0.091 ? 11 1 0.980 ? ? ? ? ? ? ? ? ? ? 2.810 2.920 ? ? ? ? ? ? 693 93.600 ? ? ? ? 0.154 ? ? ? ? ? ? ? ? 5.800 ? 0.721 ? ? 0.171 0.070 ? 12 1 0.981 ? ? ? ? ? ? ? ? ? ? 2.920 3.050 ? ? ? ? ? ? 688 93.400 ? ? ? ? 0.129 ? ? ? ? ? ? ? ? 5.700 ? 0.731 ? ? 0.143 0.059 ? 13 1 0.986 ? ? ? ? ? ? ? ? ? ? 3.050 3.210 ? ? ? ? ? ? 694 93.200 ? ? ? ? 0.112 ? ? ? ? ? ? ? ? 5.700 ? 0.838 ? ? 0.126 0.054 ? 14 1 0.986 ? ? ? ? ? ? ? ? ? ? 3.210 3.410 ? ? ? ? ? ? 704 93.400 ? ? ? ? 0.088 ? ? ? ? ? ? ? ? 5.600 ? 1.021 ? ? 0.098 0.041 ? 15 1 0.993 ? ? ? ? ? ? ? ? ? ? 3.410 3.670 ? ? ? ? ? ? 685 92.300 ? ? ? ? 0.076 ? ? ? ? ? ? ? ? 5.600 ? 1.298 ? ? 0.084 0.036 ? 16 1 0.992 ? ? ? ? ? ? ? ? ? ? 3.670 4.040 ? ? ? ? ? ? 688 92.300 ? ? ? ? 0.064 ? ? ? ? ? ? ? ? 5.500 ? 1.317 ? ? 0.071 0.031 ? 17 1 0.991 ? ? ? ? ? ? ? ? ? ? 4.040 4.630 ? ? ? ? ? ? 693 91.200 ? ? ? ? 0.056 ? ? ? ? ? ? ? ? 5.000 ? 1.434 ? ? 0.064 0.029 ? 18 1 0.992 ? ? ? ? ? ? ? ? ? ? 4.630 5.820 ? ? ? ? ? ? 680 89.100 ? ? ? ? 0.056 ? ? ? ? ? ? ? ? 5.000 ? 1.419 ? ? 0.062 0.027 ? 19 1 0.995 ? ? ? ? ? ? ? ? ? ? 5.820 30.000 ? ? ? ? ? ? 687 86.200 ? ? ? ? 0.051 ? ? ? ? ? ? ? ? 5.900 ? 1.348 ? ? 0.056 0.022 ? 20 1 0.997 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 90.490 _refine.B_iso_mean 49.2221 _refine.B_iso_min 31.280 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7WM5 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1500 _refine.ls_d_res_low 26.5100 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13868 _refine.ls_number_reflns_R_free 738 _refine.ls_number_reflns_R_work 13130 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 93.1600 _refine.ls_percent_reflns_R_free 5.3200 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2051 _refine.ls_R_factor_R_free 0.2580 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2022 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3LPM _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 31.8300 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2600 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.1500 _refine_hist.d_res_low 26.5100 _refine_hist.number_atoms_solvent 30 _refine_hist.number_atoms_total 1701 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 212 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 45.77 _refine_hist.pdbx_number_atoms_protein 1671 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1500 2.3100 2769 . 142 2627 95.0000 . . . 0.3222 0.0000 0.2610 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.3100 2.5400 2811 . 157 2654 95.0000 . . . 0.3044 0.0000 0.2409 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.5400 2.9100 2773 . 137 2636 94.0000 . . . 0.3124 0.0000 0.2296 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.9100 3.6700 2778 . 158 2620 93.0000 . . . 0.3020 0.0000 0.2091 . . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.6700 26.5100 2737 . 144 2593 89.0000 . . . 0.2039 0.0000 0.1748 . . . . . . . 5 . . . # _struct.entry_id 7WM5 _struct.title 'Crystal structure of apo TrmM from Mycoplasma capricolum' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7WM5 _struct_keywords.text 't6A, m6A, methyltransferase, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET A 40 ? CYS A 54 ? MET A 21 CYS A 35 1 ? 15 HELX_P HELX_P2 AA2 ALA A 71 ? SER A 78 ? ALA A 52 SER A 59 1 ? 8 HELX_P HELX_P3 AA3 GLN A 91 ? ASN A 105 ? GLN A 72 ASN A 86 1 ? 15 HELX_P HELX_P4 AA4 ASP A 117 ? HIS A 125 ? ASP A 98 HIS A 106 1 ? 9 HELX_P HELX_P5 AA5 THR A 164 ? CYS A 175 ? THR A 145 CYS A 156 1 ? 12 HELX_P HELX_P6 AA6 ARG A 190 ? TYR A 201 ? ARG A 171 TYR A 182 1 ? 12 HELX_P HELX_P7 AA7 THR A 250 ? LYS A 255 ? THR A 231 LYS A 236 1 ? 6 HELX_P HELX_P8 AA8 TYR A 256 ? HIS A 258 ? TYR A 237 HIS A 239 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 8 ? AA3 ? 8 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel AA2 4 5 ? parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA2 7 8 ? parallel AA3 1 2 ? parallel AA3 2 3 ? parallel AA3 3 4 ? parallel AA3 4 5 ? parallel AA3 5 6 ? anti-parallel AA3 6 7 ? anti-parallel AA3 7 8 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ASN A 24 ? ASP A 25 ? ASN A 5 ASP A 6 AA1 2 LYS A 33 ? LEU A 34 ? LYS A 14 LEU A 15 AA2 1 ILE A 111 ? HIS A 115 ? ILE A 92 HIS A 96 AA2 2 LYS A 84 ? GLU A 89 ? LYS A 65 GLU A 70 AA2 3 LYS A 62 ? ASP A 65 ? LYS A 43 ASP A 46 AA2 4 PHE A 129 ? CYS A 134 ? PHE A 110 CYS A 115 AA2 5 LEU A 176 ? ARG A 187 ? LEU A 157 ARG A 168 AA2 6 ALA A 219 ? TYR A 228 ? ALA A 200 TYR A 209 AA2 7 ILE A 203 ? GLN A 212 ? ILE A 184 GLN A 193 AA2 8 GLU A 235 ? ILE A 236 ? GLU A 216 ILE A 217 AA3 1 ILE A 111 ? HIS A 115 ? ILE A 92 HIS A 96 AA3 2 LYS A 84 ? GLU A 89 ? LYS A 65 GLU A 70 AA3 3 LYS A 62 ? ASP A 65 ? LYS A 43 ASP A 46 AA3 4 PHE A 129 ? CYS A 134 ? PHE A 110 CYS A 115 AA3 5 LEU A 176 ? ARG A 187 ? LEU A 157 ARG A 168 AA3 6 ALA A 219 ? TYR A 228 ? ALA A 200 TYR A 209 AA3 7 ILE A 203 ? GLN A 212 ? ILE A 184 GLN A 193 AA3 8 LEU A 240 ? ILE A 241 ? LEU A 221 ILE A 222 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASN A 24 ? N ASN A 5 O LEU A 34 ? O LEU A 15 AA2 1 2 O VAL A 114 ? O VAL A 95 N GLY A 87 ? N GLY A 68 AA2 2 3 O VAL A 88 ? O VAL A 69 N ASP A 65 ? N ASP A 46 AA2 3 4 N CYS A 64 ? N CYS A 45 O LEU A 131 ? O LEU A 112 AA2 4 5 N VAL A 132 ? N VAL A 113 O THR A 183 ? O THR A 164 AA2 5 6 N ILE A 184 ? N ILE A 165 O LEU A 224 ? O LEU A 205 AA2 6 7 O ILE A 227 ? O ILE A 208 N TYR A 204 ? N TYR A 185 AA2 7 8 N LYS A 206 ? N LYS A 187 O GLU A 235 ? O GLU A 216 AA3 1 2 O VAL A 114 ? O VAL A 95 N GLY A 87 ? N GLY A 68 AA3 2 3 O VAL A 88 ? O VAL A 69 N ASP A 65 ? N ASP A 46 AA3 3 4 N CYS A 64 ? N CYS A 45 O LEU A 131 ? O LEU A 112 AA3 4 5 N VAL A 132 ? N VAL A 113 O THR A 183 ? O THR A 164 AA3 5 6 N ILE A 184 ? N ILE A 165 O LEU A 224 ? O LEU A 205 AA3 6 7 O ILE A 227 ? O ILE A 208 N TYR A 204 ? N TYR A 185 AA3 7 8 N LEU A 210 ? N LEU A 191 O LEU A 240 ? O LEU A 221 # _atom_sites.entry_id 7WM5 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.008872 _atom_sites.fract_transf_matrix[1][2] 0.005122 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.010245 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009076 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -18 ? ? ? A . n A 1 2 ARG 2 -17 ? ? ? A . n A 1 3 GLY 3 -16 ? ? ? A . n A 1 4 SER 4 -15 ? ? ? A . n A 1 5 HIS 5 -14 ? ? ? A . n A 1 6 HIS 6 -13 ? ? ? A . n A 1 7 HIS 7 -12 ? ? ? A . n A 1 8 HIS 8 -11 ? ? ? A . n A 1 9 HIS 9 -10 ? ? ? A . n A 1 10 HIS 10 -9 ? ? ? A . n A 1 11 GLY 11 -8 ? ? ? A . n A 1 12 ARG 12 -7 ? ? ? A . n A 1 13 SER 13 -6 ? ? ? A . n A 1 14 GLY 14 -5 ? ? ? A . n A 1 15 ASP 15 -4 ? ? ? A . n A 1 16 ASP 16 -3 ? ? ? A . n A 1 17 ASP 17 -2 ? ? ? A . n A 1 18 ASP 18 -1 ? ? ? A . n A 1 19 LYS 19 0 ? ? ? A . n A 1 20 MET 20 1 ? ? ? A . n A 1 21 LYS 21 2 ? ? ? A . n A 1 22 VAL 22 3 ? ? ? A . n A 1 23 LEU 23 4 4 LEU LEU A . n A 1 24 ASN 24 5 5 ASN ASN A . n A 1 25 ASP 25 6 6 ASP ASP A . n A 1 26 LEU 26 7 7 LEU LEU A . n A 1 27 LEU 27 8 8 LEU LEU A . n A 1 28 GLY 28 9 9 GLY GLY A . n A 1 29 TYR 29 10 10 TYR TYR A . n A 1 30 LYS 30 11 11 LYS LYS A . n A 1 31 ASN 31 12 12 ASN ASN A . n A 1 32 ARG 32 13 13 ARG ARG A . n A 1 33 LYS 33 14 14 LYS LYS A . n A 1 34 LEU 34 15 15 LEU LEU A . n A 1 35 TYR 35 16 16 TYR TYR A . n A 1 36 GLN 36 17 ? ? ? A . n A 1 37 ASP 37 18 ? ? ? A . n A 1 38 ASN 38 19 19 ASN ASN A . n A 1 39 LYS 39 20 20 LYS LYS A . n A 1 40 MET 40 21 21 MET MET A . n A 1 41 PHE 41 22 22 PHE PHE A . n A 1 42 ASN 42 23 23 ASN ASN A . n A 1 43 PHE 43 24 24 PHE PHE A . n A 1 44 THR 44 25 25 THR THR A . n A 1 45 LEU 45 26 26 LEU LEU A . n A 1 46 ASP 46 27 27 ASP ASP A . n A 1 47 SER 47 28 28 SER SER A . n A 1 48 VAL 48 29 29 VAL VAL A . n A 1 49 LEU 49 30 30 LEU LEU A . n A 1 50 VAL 50 31 31 VAL VAL A . n A 1 51 ALA 51 32 32 ALA ALA A . n A 1 52 ARG 52 33 33 ARG ARG A . n A 1 53 PHE 53 34 34 PHE PHE A . n A 1 54 CYS 54 35 35 CYS CYS A . n A 1 55 ASN 55 36 36 ASN ASN A . n A 1 56 LEU 56 37 37 LEU LEU A . n A 1 57 ASN 57 38 38 ASN ASN A . n A 1 58 SER 58 39 39 SER SER A . n A 1 59 LYS 59 40 40 LYS LYS A . n A 1 60 LYS 60 41 41 LYS LYS A . n A 1 61 LYS 61 42 42 LYS LYS A . n A 1 62 LYS 62 43 43 LYS LYS A . n A 1 63 ILE 63 44 44 ILE ILE A . n A 1 64 CYS 64 45 45 CYS CYS A . n A 1 65 ASP 65 46 46 ASP ASP A . n A 1 66 PHE 66 47 47 PHE PHE A . n A 1 67 GLY 67 48 48 GLY GLY A . n A 1 68 THR 68 49 49 THR THR A . n A 1 69 ASN 69 50 50 ASN ASN A . n A 1 70 ASN 70 51 51 ASN ASN A . n A 1 71 ALA 71 52 52 ALA ALA A . n A 1 72 VAL 72 53 53 VAL VAL A . n A 1 73 ILE 73 54 54 ILE ILE A . n A 1 74 PRO 74 55 55 PRO PRO A . n A 1 75 LEU 75 56 56 LEU LEU A . n A 1 76 ILE 76 57 57 ILE ILE A . n A 1 77 LEU 77 58 58 LEU LEU A . n A 1 78 SER 78 59 59 SER SER A . n A 1 79 LYS 79 60 60 LYS LYS A . n A 1 80 TYR 80 61 61 TYR TYR A . n A 1 81 THR 81 62 62 THR THR A . n A 1 82 LYS 82 63 63 LYS LYS A . n A 1 83 ALA 83 64 64 ALA ALA A . n A 1 84 LYS 84 65 65 LYS LYS A . n A 1 85 ILE 85 66 66 ILE ILE A . n A 1 86 ILE 86 67 67 ILE ILE A . n A 1 87 GLY 87 68 68 GLY GLY A . n A 1 88 VAL 88 69 69 VAL VAL A . n A 1 89 GLU 89 70 70 GLU GLU A . n A 1 90 ILE 90 71 71 ILE ILE A . n A 1 91 GLN 91 72 72 GLN GLN A . n A 1 92 ASN 92 73 73 ASN ASN A . n A 1 93 LYS 93 74 74 LYS LYS A . n A 1 94 ALA 94 75 75 ALA ALA A . n A 1 95 VAL 95 76 76 VAL VAL A . n A 1 96 GLU 96 77 77 GLU GLU A . n A 1 97 ILE 97 78 78 ILE ILE A . n A 1 98 ALA 98 79 79 ALA ALA A . n A 1 99 ASN 99 80 80 ASN ASN A . n A 1 100 GLU 100 81 81 GLU GLU A . n A 1 101 ASN 101 82 82 ASN ASN A . n A 1 102 ILE 102 83 83 ILE ILE A . n A 1 103 LYS 103 84 84 LYS LYS A . n A 1 104 LEU 104 85 85 LEU LEU A . n A 1 105 ASN 105 86 86 ASN ASN A . n A 1 106 GLY 106 87 87 GLY GLY A . n A 1 107 LEU 107 88 88 LEU LEU A . n A 1 108 GLU 108 89 89 GLU GLU A . n A 1 109 ASP 109 90 90 ASP ASP A . n A 1 110 GLN 110 91 91 GLN GLN A . n A 1 111 ILE 111 92 92 ILE ILE A . n A 1 112 GLU 112 93 93 GLU GLU A . n A 1 113 ILE 113 94 94 ILE ILE A . n A 1 114 VAL 114 95 95 VAL VAL A . n A 1 115 HIS 115 96 96 HIS HIS A . n A 1 116 ALA 116 97 97 ALA ALA A . n A 1 117 ASP 117 98 98 ASP ASP A . n A 1 118 ILE 118 99 99 ILE ILE A . n A 1 119 LYS 119 100 100 LYS LYS A . n A 1 120 GLU 120 101 101 GLU GLU A . n A 1 121 PHE 121 102 102 PHE PHE A . n A 1 122 SER 122 103 103 SER SER A . n A 1 123 LYS 123 104 104 LYS LYS A . n A 1 124 LEU 124 105 105 LEU LEU A . n A 1 125 HIS 125 106 106 HIS HIS A . n A 1 126 ASN 126 107 107 ASN ASN A . n A 1 127 GLN 127 108 108 GLN GLN A . n A 1 128 GLU 128 109 109 GLU GLU A . n A 1 129 PHE 129 110 110 PHE PHE A . n A 1 130 ASP 130 111 111 ASP ASP A . n A 1 131 LEU 131 112 112 LEU LEU A . n A 1 132 VAL 132 113 113 VAL VAL A . n A 1 133 VAL 133 114 114 VAL VAL A . n A 1 134 CYS 134 115 115 CYS CYS A . n A 1 135 ASN 135 116 116 ASN ASN A . n A 1 136 PRO 136 117 117 PRO PRO A . n A 1 137 PRO 137 118 118 PRO PRO A . n A 1 138 PHE 138 119 ? ? ? A . n A 1 139 PHE 139 120 ? ? ? A . n A 1 140 LYS 140 121 ? ? ? A . n A 1 141 MET 141 122 ? ? ? A . n A 1 142 ASP 142 123 ? ? ? A . n A 1 143 GLY 143 124 ? ? ? A . n A 1 144 ASN 144 125 ? ? ? A . n A 1 145 PRO 145 126 ? ? ? A . n A 1 146 LYS 146 127 ? ? ? A . n A 1 147 LEU 147 128 ? ? ? A . n A 1 148 LYS 148 129 ? ? ? A . n A 1 149 GLU 149 130 ? ? ? A . n A 1 150 ILE 150 131 ? ? ? A . n A 1 151 SER 151 132 ? ? ? A . n A 1 152 LEU 152 133 ? ? ? A . n A 1 153 GLU 153 134 ? ? ? A . n A 1 154 VAL 154 135 ? ? ? A . n A 1 155 ALA 155 136 ? ? ? A . n A 1 156 ASN 156 137 ? ? ? A . n A 1 157 ALA 157 138 ? ? ? A . n A 1 158 ARG 158 139 ? ? ? A . n A 1 159 HIS 159 140 ? ? ? A . n A 1 160 GLU 160 141 ? ? ? A . n A 1 161 ILE 161 142 142 ILE ILE A . n A 1 162 LEU 162 143 143 LEU LEU A . n A 1 163 ILE 163 144 144 ILE ILE A . n A 1 164 THR 164 145 145 THR THR A . n A 1 165 LEU 165 146 146 LEU LEU A . n A 1 166 GLU 166 147 147 GLU GLU A . n A 1 167 ASP 167 148 148 ASP ASP A . n A 1 168 ILE 168 149 149 ILE ILE A . n A 1 169 ILE 169 150 150 ILE ILE A . n A 1 170 LYS 170 151 151 LYS LYS A . n A 1 171 SER 171 152 152 SER SER A . n A 1 172 ALA 172 153 153 ALA ALA A . n A 1 173 SER 173 154 154 SER SER A . n A 1 174 ARG 174 155 155 ARG ARG A . n A 1 175 CYS 175 156 156 CYS CYS A . n A 1 176 LEU 176 157 157 LEU LEU A . n A 1 177 LYS 177 158 158 LYS LYS A . n A 1 178 ASN 178 159 159 ASN ASN A . n A 1 179 LYS 179 160 160 LYS LYS A . n A 1 180 GLY 180 161 161 GLY GLY A . n A 1 181 ASN 181 162 162 ASN ASN A . n A 1 182 PHE 182 163 163 PHE PHE A . n A 1 183 THR 183 164 164 THR THR A . n A 1 184 ILE 184 165 165 ILE ILE A . n A 1 185 VAL 185 166 166 VAL VAL A . n A 1 186 HIS 186 167 167 HIS HIS A . n A 1 187 ARG 187 168 168 ARG ARG A . n A 1 188 SER 188 169 169 SER SER A . n A 1 189 GLU 189 170 170 GLU GLU A . n A 1 190 ARG 190 171 171 ARG ARG A . n A 1 191 LEU 191 172 172 LEU LEU A . n A 1 192 SER 192 173 173 SER SER A . n A 1 193 GLU 193 174 174 GLU GLU A . n A 1 194 ILE 194 175 175 ILE ILE A . n A 1 195 ILE 195 176 176 ILE ILE A . n A 1 196 ASN 196 177 177 ASN ASN A . n A 1 197 LEU 197 178 178 LEU LEU A . n A 1 198 PHE 198 179 179 PHE PHE A . n A 1 199 TYR 199 180 180 TYR TYR A . n A 1 200 LYS 200 181 181 LYS LYS A . n A 1 201 TYR 201 182 182 TYR TYR A . n A 1 202 ASN 202 183 183 ASN ASN A . n A 1 203 ILE 203 184 184 ILE ILE A . n A 1 204 TYR 204 185 185 TYR TYR A . n A 1 205 PRO 205 186 186 PRO PRO A . n A 1 206 LYS 206 187 187 LYS LYS A . n A 1 207 ARG 207 188 188 ARG ARG A . n A 1 208 LEU 208 189 189 LEU LEU A . n A 1 209 ARG 209 190 190 ARG ARG A . n A 1 210 LEU 210 191 191 LEU LEU A . n A 1 211 ILE 211 192 192 ILE ILE A . n A 1 212 GLN 212 193 193 GLN GLN A . n A 1 213 SER 213 194 194 SER SER A . n A 1 214 LYS 214 195 195 LYS LYS A . n A 1 215 LYS 215 196 196 LYS LYS A . n A 1 216 THR 216 197 197 THR THR A . n A 1 217 ASP 217 198 198 ASP ASP A . n A 1 218 ASN 218 199 199 ASN ASN A . n A 1 219 ALA 219 200 200 ALA ALA A . n A 1 220 LYS 220 201 201 LYS LYS A . n A 1 221 MET 221 202 202 MET MET A . n A 1 222 ILE 222 203 203 ILE ILE A . n A 1 223 LEU 223 204 204 LEU LEU A . n A 1 224 LEU 224 205 205 LEU LEU A . n A 1 225 ASP 225 206 206 ASP ASP A . n A 1 226 GLY 226 207 207 GLY GLY A . n A 1 227 ILE 227 208 208 ILE ILE A . n A 1 228 TYR 228 209 209 TYR TYR A . n A 1 229 GLN 229 210 210 GLN GLN A . n A 1 230 GLY 230 211 211 GLY GLY A . n A 1 231 ASN 231 212 212 ASN ASN A . n A 1 232 GLU 232 213 213 GLU GLU A . n A 1 233 GLY 233 214 214 GLY GLY A . n A 1 234 MET 234 215 215 MET MET A . n A 1 235 GLU 235 216 216 GLU GLU A . n A 1 236 ILE 236 217 217 ILE ILE A . n A 1 237 LEU 237 218 218 LEU LEU A . n A 1 238 PRO 238 219 219 PRO PRO A . n A 1 239 THR 239 220 220 THR THR A . n A 1 240 LEU 240 221 221 LEU LEU A . n A 1 241 ILE 241 222 222 ILE ILE A . n A 1 242 THR 242 223 223 THR THR A . n A 1 243 HIS 243 224 224 HIS HIS A . n A 1 244 ASN 244 225 225 ASN ASN A . n A 1 245 ASP 245 226 226 ASP ASP A . n A 1 246 ASP 246 227 227 ASP ASP A . n A 1 247 GLU 247 228 228 GLU GLU A . n A 1 248 THR 248 229 229 THR THR A . n A 1 249 TYR 249 230 230 TYR TYR A . n A 1 250 THR 250 231 231 THR THR A . n A 1 251 ASP 251 232 232 ASP ASP A . n A 1 252 GLU 252 233 233 GLU GLU A . n A 1 253 LEU 253 234 234 LEU LEU A . n A 1 254 LEU 254 235 235 LEU LEU A . n A 1 255 LYS 255 236 236 LYS LYS A . n A 1 256 TYR 256 237 237 TYR TYR A . n A 1 257 PHE 257 238 238 PHE PHE A . n A 1 258 HIS 258 239 239 HIS HIS A . n A 1 259 ASP 259 240 240 ASP ASP A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email jwkim@gist.ac.kr _pdbx_contact_author.name_first Jungwook _pdbx_contact_author.name_last Kim _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-5213-9299 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 5 HOH HOH A . B 2 HOH 2 302 7 HOH HOH A . B 2 HOH 3 303 12 HOH HOH A . B 2 HOH 4 304 13 HOH HOH A . B 2 HOH 5 305 11 HOH HOH A . B 2 HOH 6 306 30 HOH HOH A . B 2 HOH 7 307 9 HOH HOH A . B 2 HOH 8 308 21 HOH HOH A . B 2 HOH 9 309 10 HOH HOH A . B 2 HOH 10 310 19 HOH HOH A . B 2 HOH 11 311 25 HOH HOH A . B 2 HOH 12 312 1 HOH HOH A . B 2 HOH 13 313 26 HOH HOH A . B 2 HOH 14 314 2 HOH HOH A . B 2 HOH 15 315 29 HOH HOH A . B 2 HOH 16 316 23 HOH HOH A . B 2 HOH 17 317 4 HOH HOH A . B 2 HOH 18 318 16 HOH HOH A . B 2 HOH 19 319 28 HOH HOH A . B 2 HOH 20 320 14 HOH HOH A . B 2 HOH 21 321 24 HOH HOH A . B 2 HOH 22 322 18 HOH HOH A . B 2 HOH 23 323 8 HOH HOH A . B 2 HOH 24 324 15 HOH HOH A . B 2 HOH 25 325 27 HOH HOH A . B 2 HOH 26 326 6 HOH HOH A . B 2 HOH 27 327 20 HOH HOH A . B 2 HOH 28 328 22 HOH HOH A . B 2 HOH 29 329 3 HOH HOH A . B 2 HOH 30 330 17 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1990 ? 1 MORE -12 ? 1 'SSA (A^2)' 18470 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 y,x,-z -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 315 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-06-29 2 'Structure model' 1 1 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.19.2_4158 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 8 ? ? 41.71 -129.36 2 1 LYS A 20 ? ? 59.25 -171.80 3 1 LEU A 37 ? ? -112.34 62.17 4 1 LYS A 187 ? ? -127.81 -65.79 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASN 19 ? CG ? A ASN 38 CG 2 1 Y 1 A ASN 19 ? OD1 ? A ASN 38 OD1 3 1 Y 1 A ASN 19 ? ND2 ? A ASN 38 ND2 4 1 Y 1 A LYS 20 ? CG ? A LYS 39 CG 5 1 Y 1 A LYS 20 ? CD ? A LYS 39 CD 6 1 Y 1 A LYS 20 ? CE ? A LYS 39 CE 7 1 Y 1 A LYS 20 ? NZ ? A LYS 39 NZ 8 1 Y 1 A MET 21 ? CG ? A MET 40 CG 9 1 Y 1 A MET 21 ? SD ? A MET 40 SD 10 1 Y 1 A MET 21 ? CE ? A MET 40 CE 11 1 Y 1 A PHE 24 ? CG ? A PHE 43 CG 12 1 Y 1 A PHE 24 ? CD1 ? A PHE 43 CD1 13 1 Y 1 A PHE 24 ? CD2 ? A PHE 43 CD2 14 1 Y 1 A PHE 24 ? CE1 ? A PHE 43 CE1 15 1 Y 1 A PHE 24 ? CE2 ? A PHE 43 CE2 16 1 Y 1 A PHE 24 ? CZ ? A PHE 43 CZ 17 1 Y 1 A SER 39 ? OG ? A SER 58 OG 18 1 Y 1 A LYS 40 ? CG ? A LYS 59 CG 19 1 Y 1 A LYS 40 ? CD ? A LYS 59 CD 20 1 Y 1 A LYS 40 ? CE ? A LYS 59 CE 21 1 Y 1 A LYS 40 ? NZ ? A LYS 59 NZ 22 1 Y 1 A GLN 72 ? CG ? A GLN 91 CG 23 1 Y 1 A GLN 72 ? CD ? A GLN 91 CD 24 1 Y 1 A GLN 72 ? OE1 ? A GLN 91 OE1 25 1 Y 1 A GLN 72 ? NE2 ? A GLN 91 NE2 26 1 Y 1 A LYS 100 ? CG ? A LYS 119 CG 27 1 Y 1 A LYS 100 ? CD ? A LYS 119 CD 28 1 Y 1 A LYS 100 ? CE ? A LYS 119 CE 29 1 Y 1 A LYS 100 ? NZ ? A LYS 119 NZ 30 1 Y 1 A LYS 104 ? CG ? A LYS 123 CG 31 1 Y 1 A LYS 104 ? CD ? A LYS 123 CD 32 1 Y 1 A LYS 104 ? CE ? A LYS 123 CE 33 1 Y 1 A LYS 104 ? NZ ? A LYS 123 NZ 34 1 Y 1 A GLN 108 ? CG ? A GLN 127 CG 35 1 Y 1 A GLN 108 ? CD ? A GLN 127 CD 36 1 Y 1 A GLN 108 ? OE1 ? A GLN 127 OE1 37 1 Y 1 A GLN 108 ? NE2 ? A GLN 127 NE2 38 1 Y 1 A ILE 142 ? CG1 ? A ILE 161 CG1 39 1 Y 1 A ILE 142 ? CG2 ? A ILE 161 CG2 40 1 Y 1 A ILE 142 ? CD1 ? A ILE 161 CD1 41 1 Y 1 A LEU 143 ? CG ? A LEU 162 CG 42 1 Y 1 A LEU 143 ? CD1 ? A LEU 162 CD1 43 1 Y 1 A LEU 143 ? CD2 ? A LEU 162 CD2 44 1 Y 1 A LYS 196 ? CG ? A LYS 215 CG 45 1 Y 1 A LYS 196 ? CD ? A LYS 215 CD 46 1 Y 1 A LYS 196 ? CE ? A LYS 215 CE 47 1 Y 1 A LYS 196 ? NZ ? A LYS 215 NZ 48 1 Y 1 A LYS 201 ? CG ? A LYS 220 CG 49 1 Y 1 A LYS 201 ? CD ? A LYS 220 CD 50 1 Y 1 A LYS 201 ? CE ? A LYS 220 CE 51 1 Y 1 A LYS 201 ? NZ ? A LYS 220 NZ 52 1 Y 1 A GLU 228 ? CG ? A GLU 247 CG 53 1 Y 1 A GLU 228 ? CD ? A GLU 247 CD 54 1 Y 1 A GLU 228 ? OE1 ? A GLU 247 OE1 55 1 Y 1 A GLU 228 ? OE2 ? A GLU 247 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -18 ? A MET 1 2 1 Y 1 A ARG -17 ? A ARG 2 3 1 Y 1 A GLY -16 ? A GLY 3 4 1 Y 1 A SER -15 ? A SER 4 5 1 Y 1 A HIS -14 ? A HIS 5 6 1 Y 1 A HIS -13 ? A HIS 6 7 1 Y 1 A HIS -12 ? A HIS 7 8 1 Y 1 A HIS -11 ? A HIS 8 9 1 Y 1 A HIS -10 ? A HIS 9 10 1 Y 1 A HIS -9 ? A HIS 10 11 1 Y 1 A GLY -8 ? A GLY 11 12 1 Y 1 A ARG -7 ? A ARG 12 13 1 Y 1 A SER -6 ? A SER 13 14 1 Y 1 A GLY -5 ? A GLY 14 15 1 Y 1 A ASP -4 ? A ASP 15 16 1 Y 1 A ASP -3 ? A ASP 16 17 1 Y 1 A ASP -2 ? A ASP 17 18 1 Y 1 A ASP -1 ? A ASP 18 19 1 Y 1 A LYS 0 ? A LYS 19 20 1 Y 1 A MET 1 ? A MET 20 21 1 Y 1 A LYS 2 ? A LYS 21 22 1 Y 1 A VAL 3 ? A VAL 22 23 1 Y 1 A GLN 17 ? A GLN 36 24 1 Y 1 A ASP 18 ? A ASP 37 25 1 Y 1 A PHE 119 ? A PHE 138 26 1 Y 1 A PHE 120 ? A PHE 139 27 1 Y 1 A LYS 121 ? A LYS 140 28 1 Y 1 A MET 122 ? A MET 141 29 1 Y 1 A ASP 123 ? A ASP 142 30 1 Y 1 A GLY 124 ? A GLY 143 31 1 Y 1 A ASN 125 ? A ASN 144 32 1 Y 1 A PRO 126 ? A PRO 145 33 1 Y 1 A LYS 127 ? A LYS 146 34 1 Y 1 A LEU 128 ? A LEU 147 35 1 Y 1 A LYS 129 ? A LYS 148 36 1 Y 1 A GLU 130 ? A GLU 149 37 1 Y 1 A ILE 131 ? A ILE 150 38 1 Y 1 A SER 132 ? A SER 151 39 1 Y 1 A LEU 133 ? A LEU 152 40 1 Y 1 A GLU 134 ? A GLU 153 41 1 Y 1 A VAL 135 ? A VAL 154 42 1 Y 1 A ALA 136 ? A ALA 155 43 1 Y 1 A ASN 137 ? A ASN 156 44 1 Y 1 A ALA 138 ? A ALA 157 45 1 Y 1 A ARG 139 ? A ARG 158 46 1 Y 1 A HIS 140 ? A HIS 159 47 1 Y 1 A GLU 141 ? A GLU 160 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TYR N N N N 321 TYR CA C N S 322 TYR C C N N 323 TYR O O N N 324 TYR CB C N N 325 TYR CG C Y N 326 TYR CD1 C Y N 327 TYR CD2 C Y N 328 TYR CE1 C Y N 329 TYR CE2 C Y N 330 TYR CZ C Y N 331 TYR OH O N N 332 TYR OXT O N N 333 TYR H H N N 334 TYR H2 H N N 335 TYR HA H N N 336 TYR HB2 H N N 337 TYR HB3 H N N 338 TYR HD1 H N N 339 TYR HD2 H N N 340 TYR HE1 H N N 341 TYR HE2 H N N 342 TYR HH H N N 343 TYR HXT H N N 344 VAL N N N N 345 VAL CA C N S 346 VAL C C N N 347 VAL O O N N 348 VAL CB C N N 349 VAL CG1 C N N 350 VAL CG2 C N N 351 VAL OXT O N N 352 VAL H H N N 353 VAL H2 H N N 354 VAL HA H N N 355 VAL HB H N N 356 VAL HG11 H N N 357 VAL HG12 H N N 358 VAL HG13 H N N 359 VAL HG21 H N N 360 VAL HG22 H N N 361 VAL HG23 H N N 362 VAL HXT H N N 363 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TYR N CA sing N N 306 TYR N H sing N N 307 TYR N H2 sing N N 308 TYR CA C sing N N 309 TYR CA CB sing N N 310 TYR CA HA sing N N 311 TYR C O doub N N 312 TYR C OXT sing N N 313 TYR CB CG sing N N 314 TYR CB HB2 sing N N 315 TYR CB HB3 sing N N 316 TYR CG CD1 doub Y N 317 TYR CG CD2 sing Y N 318 TYR CD1 CE1 sing Y N 319 TYR CD1 HD1 sing N N 320 TYR CD2 CE2 doub Y N 321 TYR CD2 HD2 sing N N 322 TYR CE1 CZ doub Y N 323 TYR CE1 HE1 sing N N 324 TYR CE2 CZ sing Y N 325 TYR CE2 HE2 sing N N 326 TYR CZ OH sing N N 327 TYR OH HH sing N N 328 TYR OXT HXT sing N N 329 VAL N CA sing N N 330 VAL N H sing N N 331 VAL N H2 sing N N 332 VAL CA C sing N N 333 VAL CA CB sing N N 334 VAL CA HA sing N N 335 VAL C O doub N N 336 VAL C OXT sing N N 337 VAL CB CG1 sing N N 338 VAL CB CG2 sing N N 339 VAL CB HB sing N N 340 VAL CG1 HG11 sing N N 341 VAL CG1 HG12 sing N N 342 VAL CG1 HG13 sing N N 343 VAL CG2 HG21 sing N N 344 VAL CG2 HG22 sing N N 345 VAL CG2 HG23 sing N N 346 VAL OXT HXT sing N N 347 # _pdbx_audit_support.funding_organization 'National Research Foundation (NRF, Korea)' _pdbx_audit_support.country 'Korea, Republic Of' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3LPM _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'light scattering' _pdbx_struct_assembly_auth_evidence.details ? #