data_7WMW # _entry.id 7WMW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7WMW pdb_00007wmw 10.2210/pdb7wmw/pdb WWPDB D_1300026655 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-01-25 2 'Structure model' 1 1 2023-08-09 3 'Structure model' 1 2 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7WMW _pdbx_database_status.recvd_initial_deposition_date 2022-01-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email weilin@njucm.edu.cn _pdbx_contact_author.name_first Wei _pdbx_contact_author.name_last Lin _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-2940-6966 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Lin, W.' 1 ? 'Wang, W.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochem.J. _citation.journal_id_ASTM BIJOAK _citation.journal_id_CSD 0043 _citation.journal_id_ISSN 1470-8728 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 480 _citation.language ? _citation.page_first 1129 _citation.page_last 1146 _citation.title ;Structural and functional characterization of a mycobacterial methylenetetrahydrofolate reductase utilizing NADH as the exclusive cofactor. ; _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1042/BCJ20230138 _citation.pdbx_database_id_PubMed 37435857 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Li, J.' 1 ? primary 'Yang, M.' 2 ? primary 'Li, W.' 3 ? primary 'Lu, C.' 4 ? primary 'Feng, D.' 5 ? primary 'Shang, Z.' 6 ? primary 'Wang, C.' 7 ? primary 'Lin, W.' 8 0000-0002-2940-6966 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Methylenetetrahydrofolate reductase' 32978.758 1 ? ? ? ? 2 water nat water 18.015 41 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MTLNTVALELVPSNLDLGTAHALAELQKVRKLAVDAGLDGRIRHIMIPGMIEEDDGRPVEMKPKLDVLDYWELVQRELPD VRGLCTQVTSFLGERSLRRRLTALIQHGFEGIAFVGVPRTMTDGEGAGVAPTDALSTFSHLVKHRGVILIPTRDDELSRF GFKCKEGATFGMTQLLYSDAIVNFLTEFSRNTDHRPEILLSFGFVPKMESEVGLIDWLIQDPDNGAVATEQQFVRRLAAS EPAQKRAQMLDLYKRVIDGVIDLGFPVSLHFEAPYGVSAPAFETFAAMLDYWAPDR ; _entity_poly.pdbx_seq_one_letter_code_can ;MTLNTVALELVPSNLDLGTAHALAELQKVRKLAVDAGLDGRIRHIMIPGMIEEDDGRPVEMKPKLDVLDYWELVQRELPD VRGLCTQVTSFLGERSLRRRLTALIQHGFEGIAFVGVPRTMTDGEGAGVAPTDALSTFSHLVKHRGVILIPTRDDELSRF GFKCKEGATFGMTQLLYSDAIVNFLTEFSRNTDHRPEILLSFGFVPKMESEVGLIDWLIQDPDNGAVATEQQFVRRLAAS EPAQKRAQMLDLYKRVIDGVIDLGFPVSLHFEAPYGVSAPAFETFAAMLDYWAPDR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 THR n 1 3 LEU n 1 4 ASN n 1 5 THR n 1 6 VAL n 1 7 ALA n 1 8 LEU n 1 9 GLU n 1 10 LEU n 1 11 VAL n 1 12 PRO n 1 13 SER n 1 14 ASN n 1 15 LEU n 1 16 ASP n 1 17 LEU n 1 18 GLY n 1 19 THR n 1 20 ALA n 1 21 HIS n 1 22 ALA n 1 23 LEU n 1 24 ALA n 1 25 GLU n 1 26 LEU n 1 27 GLN n 1 28 LYS n 1 29 VAL n 1 30 ARG n 1 31 LYS n 1 32 LEU n 1 33 ALA n 1 34 VAL n 1 35 ASP n 1 36 ALA n 1 37 GLY n 1 38 LEU n 1 39 ASP n 1 40 GLY n 1 41 ARG n 1 42 ILE n 1 43 ARG n 1 44 HIS n 1 45 ILE n 1 46 MET n 1 47 ILE n 1 48 PRO n 1 49 GLY n 1 50 MET n 1 51 ILE n 1 52 GLU n 1 53 GLU n 1 54 ASP n 1 55 ASP n 1 56 GLY n 1 57 ARG n 1 58 PRO n 1 59 VAL n 1 60 GLU n 1 61 MET n 1 62 LYS n 1 63 PRO n 1 64 LYS n 1 65 LEU n 1 66 ASP n 1 67 VAL n 1 68 LEU n 1 69 ASP n 1 70 TYR n 1 71 TRP n 1 72 GLU n 1 73 LEU n 1 74 VAL n 1 75 GLN n 1 76 ARG n 1 77 GLU n 1 78 LEU n 1 79 PRO n 1 80 ASP n 1 81 VAL n 1 82 ARG n 1 83 GLY n 1 84 LEU n 1 85 CYS n 1 86 THR n 1 87 GLN n 1 88 VAL n 1 89 THR n 1 90 SER n 1 91 PHE n 1 92 LEU n 1 93 GLY n 1 94 GLU n 1 95 ARG n 1 96 SER n 1 97 LEU n 1 98 ARG n 1 99 ARG n 1 100 ARG n 1 101 LEU n 1 102 THR n 1 103 ALA n 1 104 LEU n 1 105 ILE n 1 106 GLN n 1 107 HIS n 1 108 GLY n 1 109 PHE n 1 110 GLU n 1 111 GLY n 1 112 ILE n 1 113 ALA n 1 114 PHE n 1 115 VAL n 1 116 GLY n 1 117 VAL n 1 118 PRO n 1 119 ARG n 1 120 THR n 1 121 MET n 1 122 THR n 1 123 ASP n 1 124 GLY n 1 125 GLU n 1 126 GLY n 1 127 ALA n 1 128 GLY n 1 129 VAL n 1 130 ALA n 1 131 PRO n 1 132 THR n 1 133 ASP n 1 134 ALA n 1 135 LEU n 1 136 SER n 1 137 THR n 1 138 PHE n 1 139 SER n 1 140 HIS n 1 141 LEU n 1 142 VAL n 1 143 LYS n 1 144 HIS n 1 145 ARG n 1 146 GLY n 1 147 VAL n 1 148 ILE n 1 149 LEU n 1 150 ILE n 1 151 PRO n 1 152 THR n 1 153 ARG n 1 154 ASP n 1 155 ASP n 1 156 GLU n 1 157 LEU n 1 158 SER n 1 159 ARG n 1 160 PHE n 1 161 GLY n 1 162 PHE n 1 163 LYS n 1 164 CYS n 1 165 LYS n 1 166 GLU n 1 167 GLY n 1 168 ALA n 1 169 THR n 1 170 PHE n 1 171 GLY n 1 172 MET n 1 173 THR n 1 174 GLN n 1 175 LEU n 1 176 LEU n 1 177 TYR n 1 178 SER n 1 179 ASP n 1 180 ALA n 1 181 ILE n 1 182 VAL n 1 183 ASN n 1 184 PHE n 1 185 LEU n 1 186 THR n 1 187 GLU n 1 188 PHE n 1 189 SER n 1 190 ARG n 1 191 ASN n 1 192 THR n 1 193 ASP n 1 194 HIS n 1 195 ARG n 1 196 PRO n 1 197 GLU n 1 198 ILE n 1 199 LEU n 1 200 LEU n 1 201 SER n 1 202 PHE n 1 203 GLY n 1 204 PHE n 1 205 VAL n 1 206 PRO n 1 207 LYS n 1 208 MET n 1 209 GLU n 1 210 SER n 1 211 GLU n 1 212 VAL n 1 213 GLY n 1 214 LEU n 1 215 ILE n 1 216 ASP n 1 217 TRP n 1 218 LEU n 1 219 ILE n 1 220 GLN n 1 221 ASP n 1 222 PRO n 1 223 ASP n 1 224 ASN n 1 225 GLY n 1 226 ALA n 1 227 VAL n 1 228 ALA n 1 229 THR n 1 230 GLU n 1 231 GLN n 1 232 GLN n 1 233 PHE n 1 234 VAL n 1 235 ARG n 1 236 ARG n 1 237 LEU n 1 238 ALA n 1 239 ALA n 1 240 SER n 1 241 GLU n 1 242 PRO n 1 243 ALA n 1 244 GLN n 1 245 LYS n 1 246 ARG n 1 247 ALA n 1 248 GLN n 1 249 MET n 1 250 LEU n 1 251 ASP n 1 252 LEU n 1 253 TYR n 1 254 LYS n 1 255 ARG n 1 256 VAL n 1 257 ILE n 1 258 ASP n 1 259 GLY n 1 260 VAL n 1 261 ILE n 1 262 ASP n 1 263 LEU n 1 264 GLY n 1 265 PHE n 1 266 PRO n 1 267 VAL n 1 268 SER n 1 269 LEU n 1 270 HIS n 1 271 PHE n 1 272 GLU n 1 273 ALA n 1 274 PRO n 1 275 TYR n 1 276 GLY n 1 277 VAL n 1 278 SER n 1 279 ALA n 1 280 PRO n 1 281 ALA n 1 282 PHE n 1 283 GLU n 1 284 THR n 1 285 PHE n 1 286 ALA n 1 287 ALA n 1 288 MET n 1 289 LEU n 1 290 ASP n 1 291 TYR n 1 292 TRP n 1 293 ALA n 1 294 PRO n 1 295 ASP n 1 296 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 296 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MSMEG_6649 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 700084 / mc(2)155' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycolicibacterium smegmatis MC2 155' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 246196 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 THR 2 2 2 THR THR A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 THR 5 5 5 THR THR A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 HIS 21 21 21 HIS HIS A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 GLN 27 27 27 GLN GLN A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 MET 46 46 46 MET MET A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 MET 50 50 50 MET MET A . n A 1 51 ILE 51 51 ? ? ? A . n A 1 52 GLU 52 52 ? ? ? A . n A 1 53 GLU 53 53 ? ? ? A . n A 1 54 ASP 54 54 ? ? ? A . n A 1 55 ASP 55 55 ? ? ? A . n A 1 56 GLY 56 56 ? ? ? A . n A 1 57 ARG 57 57 ? ? ? A . n A 1 58 PRO 58 58 ? ? ? A . n A 1 59 VAL 59 59 ? ? ? A . n A 1 60 GLU 60 60 ? ? ? A . n A 1 61 MET 61 61 ? ? ? A . n A 1 62 LYS 62 62 ? ? ? A . n A 1 63 PRO 63 63 ? ? ? A . n A 1 64 LYS 64 64 ? ? ? A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 TRP 71 71 71 TRP TRP A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 CYS 85 85 85 CYS CYS A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 GLN 87 87 87 GLN GLN A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 SER 90 90 90 SER SER A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 ARG 95 95 95 ARG ARG A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 ARG 98 98 98 ARG ARG A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 GLN 106 106 106 GLN GLN A . n A 1 107 HIS 107 107 107 HIS HIS A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 PHE 109 109 109 PHE PHE A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 ALA 113 113 113 ALA ALA A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 PRO 118 118 ? ? ? A . n A 1 119 ARG 119 119 ? ? ? A . n A 1 120 THR 120 120 ? ? ? A . n A 1 121 MET 121 121 ? ? ? A . n A 1 122 THR 122 122 ? ? ? A . n A 1 123 ASP 123 123 ? ? ? A . n A 1 124 GLY 124 124 ? ? ? A . n A 1 125 GLU 125 125 ? ? ? A . n A 1 126 GLY 126 126 ? ? ? A . n A 1 127 ALA 127 127 ? ? ? A . n A 1 128 GLY 128 128 128 GLY GLY A . n A 1 129 VAL 129 129 129 VAL VAL A . n A 1 130 ALA 130 130 130 ALA ALA A . n A 1 131 PRO 131 131 131 PRO PRO A . n A 1 132 THR 132 132 132 THR THR A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 THR 137 137 137 THR THR A . n A 1 138 PHE 138 138 138 PHE PHE A . n A 1 139 SER 139 139 139 SER SER A . n A 1 140 HIS 140 140 140 HIS HIS A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 LYS 143 143 143 LYS LYS A . n A 1 144 HIS 144 144 144 HIS HIS A . n A 1 145 ARG 145 145 145 ARG ARG A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 ILE 150 150 150 ILE ILE A . n A 1 151 PRO 151 151 151 PRO PRO A . n A 1 152 THR 152 152 152 THR THR A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 ASP 154 154 154 ASP ASP A . n A 1 155 ASP 155 155 155 ASP ASP A . n A 1 156 GLU 156 156 156 GLU GLU A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 PHE 160 160 160 PHE PHE A . n A 1 161 GLY 161 161 161 GLY GLY A . n A 1 162 PHE 162 162 162 PHE PHE A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 CYS 164 164 164 CYS CYS A . n A 1 165 LYS 165 165 165 LYS LYS A . n A 1 166 GLU 166 166 166 GLU GLU A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 THR 169 169 169 THR THR A . n A 1 170 PHE 170 170 170 PHE PHE A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 MET 172 172 172 MET MET A . n A 1 173 THR 173 173 173 THR THR A . n A 1 174 GLN 174 174 174 GLN GLN A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 TYR 177 177 177 TYR TYR A . n A 1 178 SER 178 178 178 SER SER A . n A 1 179 ASP 179 179 179 ASP ASP A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 ILE 181 181 181 ILE ILE A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 ASN 183 183 183 ASN ASN A . n A 1 184 PHE 184 184 184 PHE PHE A . n A 1 185 LEU 185 185 185 LEU LEU A . n A 1 186 THR 186 186 186 THR THR A . n A 1 187 GLU 187 187 187 GLU GLU A . n A 1 188 PHE 188 188 188 PHE PHE A . n A 1 189 SER 189 189 189 SER SER A . n A 1 190 ARG 190 190 190 ARG ARG A . n A 1 191 ASN 191 191 191 ASN ASN A . n A 1 192 THR 192 192 192 THR THR A . n A 1 193 ASP 193 193 193 ASP ASP A . n A 1 194 HIS 194 194 194 HIS HIS A . n A 1 195 ARG 195 195 195 ARG ARG A . n A 1 196 PRO 196 196 196 PRO PRO A . n A 1 197 GLU 197 197 197 GLU GLU A . n A 1 198 ILE 198 198 198 ILE ILE A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 LEU 200 200 200 LEU LEU A . n A 1 201 SER 201 201 201 SER SER A . n A 1 202 PHE 202 202 202 PHE PHE A . n A 1 203 GLY 203 203 203 GLY GLY A . n A 1 204 PHE 204 204 204 PHE PHE A . n A 1 205 VAL 205 205 205 VAL VAL A . n A 1 206 PRO 206 206 206 PRO PRO A . n A 1 207 LYS 207 207 207 LYS LYS A . n A 1 208 MET 208 208 208 MET MET A . n A 1 209 GLU 209 209 209 GLU GLU A . n A 1 210 SER 210 210 210 SER SER A . n A 1 211 GLU 211 211 211 GLU GLU A . n A 1 212 VAL 212 212 212 VAL VAL A . n A 1 213 GLY 213 213 213 GLY GLY A . n A 1 214 LEU 214 214 214 LEU LEU A . n A 1 215 ILE 215 215 215 ILE ILE A . n A 1 216 ASP 216 216 216 ASP ASP A . n A 1 217 TRP 217 217 217 TRP TRP A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 ILE 219 219 219 ILE ILE A . n A 1 220 GLN 220 220 220 GLN GLN A . n A 1 221 ASP 221 221 221 ASP ASP A . n A 1 222 PRO 222 222 222 PRO PRO A . n A 1 223 ASP 223 223 223 ASP ASP A . n A 1 224 ASN 224 224 224 ASN ASN A . n A 1 225 GLY 225 225 225 GLY GLY A . n A 1 226 ALA 226 226 226 ALA ALA A . n A 1 227 VAL 227 227 227 VAL VAL A . n A 1 228 ALA 228 228 228 ALA ALA A . n A 1 229 THR 229 229 229 THR THR A . n A 1 230 GLU 230 230 230 GLU GLU A . n A 1 231 GLN 231 231 231 GLN GLN A . n A 1 232 GLN 232 232 232 GLN GLN A . n A 1 233 PHE 233 233 233 PHE PHE A . n A 1 234 VAL 234 234 234 VAL VAL A . n A 1 235 ARG 235 235 235 ARG ARG A . n A 1 236 ARG 236 236 236 ARG ARG A . n A 1 237 LEU 237 237 237 LEU LEU A . n A 1 238 ALA 238 238 238 ALA ALA A . n A 1 239 ALA 239 239 239 ALA ALA A . n A 1 240 SER 240 240 240 SER SER A . n A 1 241 GLU 241 241 241 GLU GLU A . n A 1 242 PRO 242 242 242 PRO PRO A . n A 1 243 ALA 243 243 243 ALA ALA A . n A 1 244 GLN 244 244 244 GLN GLN A . n A 1 245 LYS 245 245 245 LYS LYS A . n A 1 246 ARG 246 246 246 ARG ARG A . n A 1 247 ALA 247 247 247 ALA ALA A . n A 1 248 GLN 248 248 248 GLN GLN A . n A 1 249 MET 249 249 249 MET MET A . n A 1 250 LEU 250 250 250 LEU LEU A . n A 1 251 ASP 251 251 251 ASP ASP A . n A 1 252 LEU 252 252 252 LEU LEU A . n A 1 253 TYR 253 253 253 TYR TYR A . n A 1 254 LYS 254 254 254 LYS LYS A . n A 1 255 ARG 255 255 255 ARG ARG A . n A 1 256 VAL 256 256 256 VAL VAL A . n A 1 257 ILE 257 257 257 ILE ILE A . n A 1 258 ASP 258 258 258 ASP ASP A . n A 1 259 GLY 259 259 259 GLY GLY A . n A 1 260 VAL 260 260 260 VAL VAL A . n A 1 261 ILE 261 261 261 ILE ILE A . n A 1 262 ASP 262 262 262 ASP ASP A . n A 1 263 LEU 263 263 263 LEU LEU A . n A 1 264 GLY 264 264 264 GLY GLY A . n A 1 265 PHE 265 265 265 PHE PHE A . n A 1 266 PRO 266 266 266 PRO PRO A . n A 1 267 VAL 267 267 267 VAL VAL A . n A 1 268 SER 268 268 268 SER SER A . n A 1 269 LEU 269 269 269 LEU LEU A . n A 1 270 HIS 270 270 270 HIS HIS A . n A 1 271 PHE 271 271 271 PHE PHE A . n A 1 272 GLU 272 272 272 GLU GLU A . n A 1 273 ALA 273 273 273 ALA ALA A . n A 1 274 PRO 274 274 274 PRO PRO A . n A 1 275 TYR 275 275 275 TYR TYR A . n A 1 276 GLY 276 276 276 GLY GLY A . n A 1 277 VAL 277 277 277 VAL VAL A . n A 1 278 SER 278 278 278 SER SER A . n A 1 279 ALA 279 279 279 ALA ALA A . n A 1 280 PRO 280 280 280 PRO PRO A . n A 1 281 ALA 281 281 281 ALA ALA A . n A 1 282 PHE 282 282 282 PHE PHE A . n A 1 283 GLU 283 283 283 GLU GLU A . n A 1 284 THR 284 284 284 THR THR A . n A 1 285 PHE 285 285 285 PHE PHE A . n A 1 286 ALA 286 286 286 ALA ALA A . n A 1 287 ALA 287 287 287 ALA ALA A . n A 1 288 MET 288 288 288 MET MET A . n A 1 289 LEU 289 289 289 LEU LEU A . n A 1 290 ASP 290 290 290 ASP ASP A . n A 1 291 TYR 291 291 291 TYR TYR A . n A 1 292 TRP 292 292 292 TRP TRP A . n A 1 293 ALA 293 293 293 ALA ALA A . n A 1 294 PRO 294 294 294 PRO PRO A . n A 1 295 ASP 295 295 295 ASP ASP A . n A 1 296 ARG 296 296 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 16 HOH HOH A . B 2 HOH 2 302 24 HOH HOH A . B 2 HOH 3 303 13 HOH HOH A . B 2 HOH 4 304 7 HOH HOH A . B 2 HOH 5 305 15 HOH HOH A . B 2 HOH 6 306 32 HOH HOH A . B 2 HOH 7 307 4 HOH HOH A . B 2 HOH 8 308 18 HOH HOH A . B 2 HOH 9 309 8 HOH HOH A . B 2 HOH 10 310 23 HOH HOH A . B 2 HOH 11 311 6 HOH HOH A . B 2 HOH 12 312 2 HOH HOH A . B 2 HOH 13 313 3 HOH HOH A . B 2 HOH 14 314 20 HOH HOH A . B 2 HOH 15 315 19 HOH HOH A . B 2 HOH 16 316 28 HOH HOH A . B 2 HOH 17 317 17 HOH HOH A . B 2 HOH 18 318 5 HOH HOH A . B 2 HOH 19 319 39 HOH HOH A . B 2 HOH 20 320 41 HOH HOH A . B 2 HOH 21 321 21 HOH HOH A . B 2 HOH 22 322 42 HOH HOH A . B 2 HOH 23 323 38 HOH HOH A . B 2 HOH 24 324 12 HOH HOH A . B 2 HOH 25 325 11 HOH HOH A . B 2 HOH 26 326 27 HOH HOH A . B 2 HOH 27 327 33 HOH HOH A . B 2 HOH 28 328 30 HOH HOH A . B 2 HOH 29 329 25 HOH HOH A . B 2 HOH 30 330 34 HOH HOH A . B 2 HOH 31 331 40 HOH HOH A . B 2 HOH 32 332 43 HOH HOH A . B 2 HOH 33 333 29 HOH HOH A . B 2 HOH 34 334 22 HOH HOH A . B 2 HOH 35 335 35 HOH HOH A . B 2 HOH 36 336 26 HOH HOH A . B 2 HOH 37 337 14 HOH HOH A . B 2 HOH 38 338 37 HOH HOH A . B 2 HOH 39 339 36 HOH HOH A . B 2 HOH 40 340 31 HOH HOH A . B 2 HOH 41 341 10 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14_3260 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7WMW _cell.details ? _cell.formula_units_Z ? _cell.length_a 67.815 _cell.length_a_esd ? _cell.length_b 67.815 _cell.length_b_esd ? _cell.length_c 130.405 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7WMW _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7WMW _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.27 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.89 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'ammonium sulfate, Bis-Tris, PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-01-15 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.987 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL18U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.987 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL18U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7WMW _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.05 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 36223 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.79 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 16 _reflns.pdbx_Rmerge_I_obs 0.064 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 15.47 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.972 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.05 _reflns_shell.d_res_low 2.07 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 36223 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.871 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 86.960 _refine.B_iso_mean 56.4975 _refine.B_iso_min 20.000 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7WMW _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.0530 _refine.ls_d_res_low 32.6010 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 36223 _refine.ls_number_reflns_R_free 3625 _refine.ls_number_reflns_R_work 32598 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.7900 _refine.ls_percent_reflns_R_free 10.0100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2363 _refine.ls_R_factor_R_free 0.2596 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2338 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 33.2600 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3400 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.0530 _refine_hist.d_res_low 32.6010 _refine_hist.number_atoms_solvent 41 _refine_hist.number_atoms_total 2165 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 271 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 56.90 _refine_hist.pdbx_number_atoms_protein 2124 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.0530 2.0796 . . 134 1217 98.0000 . . . 0.4020 0.0000 0.4301 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0796 2.1081 . . 139 1255 100.0000 . . . 0.4241 0.0000 0.4146 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1081 2.1382 . . 144 1253 100.0000 . . . 0.3906 0.0000 0.3880 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1382 2.1701 . . 138 1242 100.0000 . . . 0.3851 0.0000 0.3767 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1701 2.2040 . . 139 1262 100.0000 . . . 0.3672 0.0000 0.3451 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2040 2.2401 . . 137 1254 100.0000 . . . 0.4083 0.0000 0.3458 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2401 2.2787 . . 141 1260 100.0000 . . . 0.3677 0.0000 0.3677 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2787 2.3202 . . 136 1242 100.0000 . . . 0.3738 0.0000 0.3177 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3202 2.3648 . . 142 1249 100.0000 . . . 0.3875 0.0000 0.3331 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3648 2.4130 . . 145 1296 100.0000 . . . 0.3020 0.0000 0.2952 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4130 2.4655 . . 141 1229 100.0000 . . . 0.2798 0.0000 0.2745 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4655 2.5228 . . 140 1268 100.0000 . . . 0.3719 0.0000 0.2914 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5228 2.5859 . . 138 1247 100.0000 . . . 0.3815 0.0000 0.3035 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5859 2.6558 . . 139 1259 100.0000 . . . 0.3642 0.0000 0.2973 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6558 2.7339 . . 142 1244 100.0000 . . . 0.3446 0.0000 0.2988 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7339 2.8221 . . 137 1273 100.0000 . . . 0.3124 0.0000 0.2967 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8221 2.9229 . . 139 1236 100.0000 . . . 0.3174 0.0000 0.3148 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9229 3.0398 . . 135 1250 100.0000 . . . 0.3455 0.0000 0.2977 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0398 3.1781 . . 143 1272 100.0000 . . . 0.3253 0.0000 0.2818 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1781 3.3455 . . 136 1256 100.0000 . . . 0.2698 0.0000 0.2616 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3455 3.5548 . . 141 1265 100.0000 . . . 0.2834 0.0000 0.2398 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5548 3.8289 . . 137 1241 100.0000 . . . 0.2517 0.0000 0.2175 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.8289 4.2135 . . 144 1268 100.0000 . . . 0.2127 0.0000 0.1851 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.2135 4.8215 . . 144 1251 100.0000 . . . 0.1838 0.0000 0.1631 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.8215 6.0682 . . 140 1257 100.0000 . . . 0.2172 0.0000 0.1853 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.0682 32.6010 . . 134 1252 99.0000 . . . 0.1800 0.0000 0.1755 . . . . . . . . . . . # _struct.entry_id 7WMW _struct.title 'Crystal structure of methylenetetrahydrofolate reductase MSMEG_6649 from Mycobacterium smegmatis' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7WMW _struct_keywords.text 'methylenetetrahydrofolate reductase, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0R6S0_MYCS2 _struct_ref.pdbx_db_accession A0R6S0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTLNTVALELVPSNLDLGTAHALAELQKVRKLAVDAGLDGRIRHIMIPGMIEEDDGRPVEMKPKLDVLDYWELVQRELPD VRGLCTQVTSFLGERSLRRRLTALIQHGFEGIAFVGVPRTMTDGEGAGVAPTDALSTFSHLVKHRGVILIPTRDDELSRF GFKCKEGATFGMTQLLYSDAIVNFLTEFSRNTDHRPEILLSFGFVPKMESEVGLIDWLIQDPDNGAVATEQQFVRRLAAS EPAQKRAQMLDLYKRVIDGVIDLGFPVSLHFEAPYGVSAPAFETFAAMLDYWAPDR ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7WMW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 296 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0R6S0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 296 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 296 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 12560 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 14 ? LEU A 17 ? ASN A 14 LEU A 17 5 ? 4 HELX_P HELX_P2 AA2 GLY A 18 ? ALA A 36 ? GLY A 18 ALA A 36 1 ? 19 HELX_P HELX_P3 AA3 ASP A 66 ? LEU A 78 ? ASP A 66 LEU A 78 1 ? 13 HELX_P HELX_P4 AA4 GLY A 93 ? HIS A 107 ? GLY A 93 HIS A 107 1 ? 15 HELX_P HELX_P5 AA5 ALA A 130 ? PHE A 138 ? ALA A 130 PHE A 138 1 ? 9 HELX_P HELX_P6 AA6 ASP A 155 ? GLU A 166 ? ASP A 155 GLU A 166 1 ? 12 HELX_P HELX_P7 AA7 ASP A 179 ? THR A 192 ? ASP A 179 THR A 192 1 ? 14 HELX_P HELX_P8 AA8 MET A 208 ? GLY A 213 ? MET A 208 GLY A 213 1 ? 6 HELX_P HELX_P9 AA9 GLY A 213 ? ILE A 219 ? GLY A 213 ILE A 219 1 ? 7 HELX_P HELX_P10 AB1 GLY A 225 ? SER A 240 ? GLY A 225 SER A 240 1 ? 16 HELX_P HELX_P11 AB2 GLU A 241 ? GLY A 259 ? GLU A 241 GLY A 259 1 ? 19 HELX_P HELX_P12 AB3 SER A 278 ? TRP A 292 ? SER A 278 TRP A 292 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA1 7 8 ? parallel AA1 8 9 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 6 ? GLU A 9 ? VAL A 6 GLU A 9 AA1 2 HIS A 44 ? ILE A 47 ? HIS A 44 ILE A 47 AA1 3 ARG A 82 ? VAL A 88 ? ARG A 82 VAL A 88 AA1 4 PHE A 109 ? VAL A 115 ? PHE A 109 VAL A 115 AA1 5 ARG A 145 ? LEU A 149 ? ARG A 145 LEU A 149 AA1 6 PHE A 170 ? LEU A 175 ? PHE A 170 LEU A 175 AA1 7 GLU A 197 ? GLY A 203 ? GLU A 197 GLY A 203 AA1 8 VAL A 267 ? GLU A 272 ? VAL A 267 GLU A 272 AA1 9 VAL A 6 ? GLU A 9 ? VAL A 6 GLU A 9 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 8 ? N LEU A 8 O MET A 46 ? O MET A 46 AA1 2 3 N ILE A 45 ? N ILE A 45 O LEU A 84 ? O LEU A 84 AA1 3 4 N GLY A 83 ? N GLY A 83 O GLU A 110 ? O GLU A 110 AA1 4 5 N PHE A 114 ? N PHE A 114 O GLY A 146 ? O GLY A 146 AA1 5 6 N VAL A 147 ? N VAL A 147 O MET A 172 ? O MET A 172 AA1 6 7 N GLY A 171 ? N GLY A 171 O LEU A 199 ? O LEU A 199 AA1 7 8 N LEU A 200 ? N LEU A 200 O HIS A 270 ? O HIS A 270 AA1 8 9 O LEU A 269 ? O LEU A 269 N ALA A 7 ? N ALA A 7 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 39 ? ? -67.78 14.95 2 1 VAL A 260 ? ? -135.37 -46.37 # _pdbx_entry_details.entry_id 7WMW _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ILE 51 ? A ILE 51 2 1 Y 1 A GLU 52 ? A GLU 52 3 1 Y 1 A GLU 53 ? A GLU 53 4 1 Y 1 A ASP 54 ? A ASP 54 5 1 Y 1 A ASP 55 ? A ASP 55 6 1 Y 1 A GLY 56 ? A GLY 56 7 1 Y 1 A ARG 57 ? A ARG 57 8 1 Y 1 A PRO 58 ? A PRO 58 9 1 Y 1 A VAL 59 ? A VAL 59 10 1 Y 1 A GLU 60 ? A GLU 60 11 1 Y 1 A MET 61 ? A MET 61 12 1 Y 1 A LYS 62 ? A LYS 62 13 1 Y 1 A PRO 63 ? A PRO 63 14 1 Y 1 A LYS 64 ? A LYS 64 15 1 Y 1 A PRO 118 ? A PRO 118 16 1 Y 1 A ARG 119 ? A ARG 119 17 1 Y 1 A THR 120 ? A THR 120 18 1 Y 1 A MET 121 ? A MET 121 19 1 Y 1 A THR 122 ? A THR 122 20 1 Y 1 A ASP 123 ? A ASP 123 21 1 Y 1 A GLY 124 ? A GLY 124 22 1 Y 1 A GLU 125 ? A GLU 125 23 1 Y 1 A GLY 126 ? A GLY 126 24 1 Y 1 A ALA 127 ? A ALA 127 25 1 Y 1 A ARG 296 ? A ARG 296 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 81903526 _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 7WMW _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014746 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014746 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007668 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S SE # loop_