data_7X7S # _entry.id 7X7S # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7X7S pdb_00007x7s 10.2210/pdb7x7s/pdb WWPDB D_1300028258 ? ? BMRB 18133 ? 10.13018/BMR18133 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-05-11 2 'Structure model' 1 1 2022-11-23 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' Other 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' pdbx_database_status 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.pdbx_database_id_DOI' 7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 8 2 'Structure model' '_citation.title' 9 2 'Structure model' '_citation.year' 10 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 11 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7X7S _pdbx_database_status.recvd_initial_deposition_date 2022-03-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 18133 _pdbx_database_related.content_type unspecified # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 2 dhlin@xmu.edu.cn Donghai Lin ? 'principal investigator/group leader' 0000-0002-2318-2033 3 guochy78@xmu.edu.cn Chenyun Guo ? 'principal investigator/group leader' 0000-0002-8062-1047 # _audit_author.name 'Zhang, H.' _audit_author.pdbx_ordinal 1 _audit_author.identifier_ORCID 0000-0002-4104-7062 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country CH _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biomolecules _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2218-273X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;ADP-Induced Conformational Transition of Human Adenylate Kinase 1 Is Triggered by Suppressing Internal Motion of alpha 3 alpha 4 and alpha 7 alpha 8 Fragments on the ps-ns Timescale. ; _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.3390/biom12050671 _citation.pdbx_database_id_PubMed 35625598 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Guo, C.' 1 ? primary 'Zhang, H.' 2 0000-0002-4104-7062 primary 'Lin, W.' 3 ? primary 'Chen, H.' 4 ? primary 'Chang, T.' 5 ? primary 'Wu, Z.' 6 ? primary 'Yu, J.' 7 ? primary 'Lin, D.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Adenylate kinase isoenzyme 1' _entity.formula_weight 22079.332 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.7.4.3,2.7.4.6 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'AK 1,ATP-AMP transphosphorylase 1,ATP:AMP phosphotransferase,Adenylate monophosphate kinase,Myokinase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPLGSMEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDM LRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYK ATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK ; _entity_poly.pdbx_seq_one_letter_code_can ;GPLGSMEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDM LRDAMVAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYK ATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 MET n 1 7 GLU n 1 8 GLU n 1 9 LYS n 1 10 LEU n 1 11 LYS n 1 12 LYS n 1 13 THR n 1 14 LYS n 1 15 ILE n 1 16 ILE n 1 17 PHE n 1 18 VAL n 1 19 VAL n 1 20 GLY n 1 21 GLY n 1 22 PRO n 1 23 GLY n 1 24 SER n 1 25 GLY n 1 26 LYS n 1 27 GLY n 1 28 THR n 1 29 GLN n 1 30 CYS n 1 31 GLU n 1 32 LYS n 1 33 ILE n 1 34 VAL n 1 35 GLN n 1 36 LYS n 1 37 TYR n 1 38 GLY n 1 39 TYR n 1 40 THR n 1 41 HIS n 1 42 LEU n 1 43 SER n 1 44 THR n 1 45 GLY n 1 46 ASP n 1 47 LEU n 1 48 LEU n 1 49 ARG n 1 50 SER n 1 51 GLU n 1 52 VAL n 1 53 SER n 1 54 SER n 1 55 GLY n 1 56 SER n 1 57 ALA n 1 58 ARG n 1 59 GLY n 1 60 LYS n 1 61 LYS n 1 62 LEU n 1 63 SER n 1 64 GLU n 1 65 ILE n 1 66 MET n 1 67 GLU n 1 68 LYS n 1 69 GLY n 1 70 GLN n 1 71 LEU n 1 72 VAL n 1 73 PRO n 1 74 LEU n 1 75 GLU n 1 76 THR n 1 77 VAL n 1 78 LEU n 1 79 ASP n 1 80 MET n 1 81 LEU n 1 82 ARG n 1 83 ASP n 1 84 ALA n 1 85 MET n 1 86 VAL n 1 87 ALA n 1 88 LYS n 1 89 VAL n 1 90 ASN n 1 91 THR n 1 92 SER n 1 93 LYS n 1 94 GLY n 1 95 PHE n 1 96 LEU n 1 97 ILE n 1 98 ASP n 1 99 GLY n 1 100 TYR n 1 101 PRO n 1 102 ARG n 1 103 GLU n 1 104 VAL n 1 105 GLN n 1 106 GLN n 1 107 GLY n 1 108 GLU n 1 109 GLU n 1 110 PHE n 1 111 GLU n 1 112 ARG n 1 113 ARG n 1 114 ILE n 1 115 GLY n 1 116 GLN n 1 117 PRO n 1 118 THR n 1 119 LEU n 1 120 LEU n 1 121 LEU n 1 122 TYR n 1 123 VAL n 1 124 ASP n 1 125 ALA n 1 126 GLY n 1 127 PRO n 1 128 GLU n 1 129 THR n 1 130 MET n 1 131 THR n 1 132 GLN n 1 133 ARG n 1 134 LEU n 1 135 LEU n 1 136 LYS n 1 137 ARG n 1 138 GLY n 1 139 GLU n 1 140 THR n 1 141 SER n 1 142 GLY n 1 143 ARG n 1 144 VAL n 1 145 ASP n 1 146 ASP n 1 147 ASN n 1 148 GLU n 1 149 GLU n 1 150 THR n 1 151 ILE n 1 152 LYS n 1 153 LYS n 1 154 ARG n 1 155 LEU n 1 156 GLU n 1 157 THR n 1 158 TYR n 1 159 TYR n 1 160 LYS n 1 161 ALA n 1 162 THR n 1 163 GLU n 1 164 PRO n 1 165 VAL n 1 166 ILE n 1 167 ALA n 1 168 PHE n 1 169 TYR n 1 170 GLU n 1 171 LYS n 1 172 ARG n 1 173 GLY n 1 174 ILE n 1 175 VAL n 1 176 ARG n 1 177 LYS n 1 178 VAL n 1 179 ASN n 1 180 ALA n 1 181 GLU n 1 182 GLY n 1 183 SER n 1 184 VAL n 1 185 ASP n 1 186 SER n 1 187 VAL n 1 188 PHE n 1 189 SER n 1 190 GLN n 1 191 VAL n 1 192 CYS n 1 193 THR n 1 194 HIS n 1 195 LEU n 1 196 ASP n 1 197 ALA n 1 198 LEU n 1 199 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 199 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene AK1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 ? ? ? A . n A 1 2 PRO 2 2 ? ? ? A . n A 1 3 LEU 3 3 ? ? ? A . n A 1 4 GLY 4 4 ? ? ? A . n A 1 5 SER 5 5 ? ? ? A . n A 1 6 MET 6 6 6 MET MET A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 PRO 22 22 22 PRO PRO A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 MET 66 66 66 MET MET A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 LEU 74 74 74 LEU LEU A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 ASP 79 79 79 ASP ASP A . n A 1 80 MET 80 80 80 MET MET A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 MET 85 85 85 MET MET A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 GLN 106 106 106 GLN GLN A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 GLN 116 116 116 GLN GLN A . n A 1 117 PRO 117 117 117 PRO PRO A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 THR 129 129 129 THR THR A . n A 1 130 MET 130 130 130 MET MET A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 GLN 132 132 132 GLN GLN A . n A 1 133 ARG 133 133 133 ARG ARG A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 THR 140 140 140 THR THR A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 ASP 146 146 146 ASP ASP A . n A 1 147 ASN 147 147 147 ASN ASN A . n A 1 148 GLU 148 148 148 GLU GLU A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 THR 150 150 150 THR THR A . n A 1 151 ILE 151 151 151 ILE ILE A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 LYS 153 153 153 LYS LYS A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 GLU 156 156 156 GLU GLU A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 TYR 158 158 158 TYR TYR A . n A 1 159 TYR 159 159 159 TYR TYR A . n A 1 160 LYS 160 160 160 LYS LYS A . n A 1 161 ALA 161 161 161 ALA ALA A . n A 1 162 THR 162 162 162 THR THR A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 PRO 164 164 164 PRO PRO A . n A 1 165 VAL 165 165 165 VAL VAL A . n A 1 166 ILE 166 166 166 ILE ILE A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 PHE 168 168 168 PHE PHE A . n A 1 169 TYR 169 169 169 TYR TYR A . n A 1 170 GLU 170 170 170 GLU GLU A . n A 1 171 LYS 171 171 171 LYS LYS A . n A 1 172 ARG 172 172 172 ARG ARG A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 ILE 174 174 174 ILE ILE A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 ARG 176 176 176 ARG ARG A . n A 1 177 LYS 177 177 177 LYS LYS A . n A 1 178 VAL 178 178 178 VAL VAL A . n A 1 179 ASN 179 179 179 ASN ASN A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 GLU 181 181 181 GLU GLU A . n A 1 182 GLY 182 182 182 GLY GLY A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 VAL 184 184 184 VAL VAL A . n A 1 185 ASP 185 185 185 ASP ASP A . n A 1 186 SER 186 186 186 SER SER A . n A 1 187 VAL 187 187 187 VAL VAL A . n A 1 188 PHE 188 188 188 PHE PHE A . n A 1 189 SER 189 189 189 SER SER A . n A 1 190 GLN 190 190 190 GLN GLN A . n A 1 191 VAL 191 191 191 VAL VAL A . n A 1 192 CYS 192 192 192 CYS CYS A . n A 1 193 THR 193 193 193 THR THR A . n A 1 194 HIS 194 194 194 HIS HIS A . n A 1 195 LEU 195 195 195 LEU LEU A . n A 1 196 ASP 196 196 196 ASP ASP A . n A 1 197 ALA 197 197 197 ALA ALA A . n A 1 198 LEU 198 198 198 LEU LEU A . n A 1 199 LYS 199 199 199 LYS LYS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7X7S _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7X7S _struct.title 'Solution structure of human adenylate kinase 1 (hAK1)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7X7S _struct_keywords.text 'Adenylate kinase, ADP, ATP, LID domain, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code KAD1_HUMAN _struct_ref.pdbx_db_accession P00568 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEEKLKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSEVSSGSARGKKLSEIMEKGQLVPLETVLDMLRDAM VAKVNTSKGFLIDGYPREVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETSGRVDDNEETIKKRLETYYKATEPV IAFYEKRGIVRKVNAEGSVDSVFSQVCTHLDALK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7X7S _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 6 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 199 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00568 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 194 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 6 _struct_ref_seq.pdbx_auth_seq_align_end 199 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7X7S GLY A 1 ? UNP P00568 ? ? 'expression tag' 1 1 1 7X7S PRO A 2 ? UNP P00568 ? ? 'expression tag' 2 2 1 7X7S LEU A 3 ? UNP P00568 ? ? 'expression tag' 3 3 1 7X7S GLY A 4 ? UNP P00568 ? ? 'expression tag' 4 4 1 7X7S SER A 5 ? UNP P00568 ? ? 'expression tag' 5 5 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 9840 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 MET A 6 ? LYS A 11 ? MET A 6 LYS A 11 1 ? 6 HELX_P HELX_P2 AA2 GLY A 25 ? TYR A 37 ? GLY A 25 TYR A 37 1 ? 13 HELX_P HELX_P3 AA3 THR A 44 ? SER A 53 ? THR A 44 SER A 53 1 ? 10 HELX_P HELX_P4 AA4 SER A 56 ? MET A 66 ? SER A 56 MET A 66 1 ? 11 HELX_P HELX_P5 AA5 PRO A 73 ? VAL A 86 ? PRO A 73 VAL A 86 1 ? 14 HELX_P HELX_P6 AA6 GLU A 103 ? GLU A 109 ? GLU A 103 GLU A 109 1 ? 7 HELX_P HELX_P7 AA7 GLU A 109 ? ILE A 114 ? GLU A 109 ILE A 114 1 ? 6 HELX_P HELX_P8 AA8 GLU A 128 ? LEU A 134 ? GLU A 128 LEU A 134 1 ? 7 HELX_P HELX_P9 AA9 LEU A 135 ? THR A 140 ? LEU A 135 THR A 140 5 ? 6 HELX_P HELX_P10 AB1 ASN A 147 ? ARG A 172 ? ASN A 147 ARG A 172 1 ? 26 HELX_P HELX_P11 AB2 SER A 183 ? LEU A 198 ? SER A 183 LEU A 198 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 40 ? SER A 43 ? THR A 40 SER A 43 AA1 2 GLY A 94 ? TYR A 100 ? GLY A 94 TYR A 100 AA1 3 LYS A 14 ? GLY A 20 ? LYS A 14 GLY A 20 AA1 4 LEU A 120 ? ASP A 124 ? LEU A 120 ASP A 124 AA1 5 VAL A 175 ? ASN A 179 ? VAL A 175 ASN A 179 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 42 ? N LEU A 42 O LEU A 96 ? O LEU A 96 AA1 2 3 O ILE A 97 ? O ILE A 97 N ILE A 16 ? N ILE A 16 AA1 3 4 N VAL A 19 ? N VAL A 19 O VAL A 123 ? O VAL A 123 AA1 4 5 N ASP A 124 ? N ASP A 124 O VAL A 178 ? O VAL A 178 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 32 ? ? -49.86 -17.89 2 1 PRO A 101 ? ? -49.57 175.97 3 1 SER A 141 ? ? -147.02 -77.03 4 1 ARG A 143 ? ? -60.60 -176.08 5 1 GLU A 181 ? ? -65.18 9.25 6 1 LEU A 198 ? ? -43.92 -18.83 7 2 PRO A 101 ? ? -46.00 176.27 8 2 ARG A 113 ? ? -121.15 -55.13 9 2 LEU A 119 ? ? -170.96 141.74 10 2 ARG A 143 ? ? -52.77 175.46 11 2 VAL A 144 ? ? -48.32 -70.90 12 2 GLU A 181 ? ? -66.66 8.16 13 3 VAL A 86 ? ? -47.23 -19.53 14 3 VAL A 89 ? ? -39.86 -30.90 15 3 PRO A 101 ? ? -47.62 176.70 16 3 LEU A 119 ? ? -170.53 140.60 17 3 SER A 141 ? ? -155.60 -79.28 18 3 GLU A 181 ? ? -62.43 6.52 19 4 SER A 56 ? ? -74.68 -169.61 20 4 PRO A 101 ? ? -48.56 176.70 21 4 LEU A 119 ? ? -171.28 139.68 22 4 SER A 141 ? ? -150.67 -63.75 23 4 ARG A 143 ? ? -60.92 -177.90 24 4 GLU A 181 ? ? -61.91 2.34 25 4 LEU A 198 ? ? -48.31 -19.81 26 5 VAL A 89 ? ? -39.10 -30.20 27 5 PRO A 101 ? ? -48.44 176.53 28 5 LEU A 119 ? ? -170.17 139.53 29 5 SER A 141 ? ? -148.13 -145.40 30 5 ARG A 143 ? ? -54.82 175.63 31 5 VAL A 144 ? ? -50.68 -70.02 32 5 SER A 183 ? ? -49.58 159.69 33 6 VAL A 89 ? ? -39.65 -30.27 34 6 PRO A 101 ? ? -48.70 176.70 35 6 LEU A 119 ? ? -170.76 140.83 36 6 SER A 141 ? ? -148.47 -150.46 37 6 ARG A 143 ? ? -54.43 178.29 38 6 GLU A 181 ? ? -66.56 8.28 39 6 LEU A 198 ? ? -48.92 -11.69 40 7 SER A 56 ? ? -66.21 -175.61 41 7 VAL A 89 ? ? -38.89 -31.34 42 7 PRO A 101 ? ? -48.02 177.63 43 7 ARG A 113 ? ? -121.50 -51.05 44 7 LEU A 119 ? ? -170.53 139.19 45 7 SER A 141 ? ? -156.14 -79.41 46 7 ARG A 143 ? ? -65.24 -174.50 47 8 VAL A 89 ? ? -39.78 -31.74 48 8 PRO A 101 ? ? -49.62 177.19 49 8 LEU A 119 ? ? -171.01 138.80 50 8 SER A 141 ? ? -139.28 -77.24 51 8 ARG A 143 ? ? 50.41 -168.40 52 8 GLU A 181 ? ? -58.48 -0.19 53 9 PRO A 101 ? ? -48.85 177.14 54 9 ARG A 113 ? ? -120.68 -51.36 55 9 LEU A 119 ? ? -170.78 140.81 56 9 ARG A 137 ? ? -49.94 -18.78 57 9 SER A 141 ? ? -141.30 -66.26 58 9 ARG A 143 ? ? 57.06 174.56 59 9 GLU A 181 ? ? -65.93 9.02 60 10 PRO A 101 ? ? -47.75 175.70 61 10 LEU A 119 ? ? -170.25 139.68 62 10 SER A 141 ? ? -144.08 -155.55 63 10 ARG A 143 ? ? -54.28 177.92 64 11 VAL A 86 ? ? -46.32 -19.99 65 11 PRO A 101 ? ? -49.20 176.89 66 11 LEU A 119 ? ? -171.01 139.95 67 12 PRO A 101 ? ? -48.33 177.36 68 12 SER A 141 ? ? -154.67 -79.34 69 12 ARG A 143 ? ? -68.39 -178.19 70 12 GLU A 181 ? ? -68.55 10.71 71 13 PRO A 101 ? ? -47.26 175.80 72 13 PRO A 117 ? ? -59.80 106.90 73 13 LEU A 119 ? ? -170.97 138.69 74 13 SER A 141 ? ? -154.25 -78.09 75 13 GLU A 181 ? ? -65.47 7.50 76 14 VAL A 86 ? ? -46.93 -19.74 77 14 PRO A 101 ? ? -48.06 177.04 78 14 LEU A 119 ? ? -170.74 140.42 79 14 ARG A 143 ? ? -66.03 -176.93 80 14 VAL A 144 ? ? -42.70 -71.30 81 14 GLU A 181 ? ? -65.83 2.34 82 15 VAL A 86 ? ? -49.17 -19.69 83 15 PRO A 101 ? ? -47.28 178.62 84 15 LEU A 119 ? ? -171.16 141.23 85 15 ARG A 137 ? ? -46.98 -18.99 86 15 ARG A 143 ? ? -58.06 170.44 87 15 VAL A 144 ? ? -57.59 -70.09 88 15 GLU A 181 ? ? -68.55 10.45 89 15 LEU A 198 ? ? -44.77 -19.62 90 16 VAL A 89 ? ? -36.63 -34.48 91 16 PRO A 101 ? ? -45.05 176.49 92 16 ARG A 113 ? ? -120.34 -55.15 93 16 PRO A 117 ? ? -59.06 108.87 94 16 LEU A 119 ? ? -170.75 137.66 95 16 SER A 141 ? ? -148.65 -155.62 96 16 ARG A 143 ? ? -57.14 -175.29 97 16 ASP A 146 ? ? 59.08 14.94 98 16 GLU A 181 ? ? -64.40 8.00 99 17 VAL A 89 ? ? -39.09 -33.98 100 17 PRO A 101 ? ? -49.03 177.30 101 17 ARG A 113 ? ? -120.04 -53.14 102 17 LEU A 119 ? ? -170.54 140.78 103 17 SER A 141 ? ? -152.53 -79.35 104 17 ARG A 143 ? ? -59.28 -179.55 105 17 GLU A 181 ? ? -69.25 15.51 106 18 PRO A 101 ? ? -48.39 175.28 107 18 LEU A 119 ? ? -170.80 140.89 108 18 SER A 141 ? ? -152.80 -77.95 109 18 GLU A 181 ? ? -62.26 11.23 110 18 LEU A 198 ? ? -45.88 -18.75 111 19 VAL A 89 ? ? -39.29 -27.84 112 19 PRO A 101 ? ? -47.97 176.27 113 19 LEU A 119 ? ? -171.65 140.56 114 19 SER A 141 ? ? -147.94 -62.96 115 19 GLU A 181 ? ? -64.88 4.87 116 19 LEU A 198 ? ? -43.49 -18.21 117 20 VAL A 89 ? ? -39.23 -30.05 118 20 PRO A 101 ? ? -48.94 176.65 119 20 LEU A 119 ? ? -170.28 138.55 120 20 SER A 141 ? ? -145.58 -61.75 121 20 ARG A 143 ? ? -69.65 -173.62 # _pdbx_nmr_ensemble.entry_id 7X7S _pdbx_nmr_ensemble.conformers_calculated_total_number 300 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7X7S _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '1.0 mM [U-100% 15N] hAK1, 10 mM Na2HPO4, 50 mM NaCl, 100 mM Na2SO4, 90% H2O/10% D2O' '90% H2O/10% D2O' 15N_sample solution ? 2 '1.0 mM [U-100% 13C; U-100% 15N] hAK1, 10 mM Na2HPO4, 50 mM NaCl, 100 mM Na2SO4, 90% H2O/10% D2O' '90% H2O/10% D2O' 13C/15N_sample solution ? # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 hAK1 1.0 ? mM '[U-100% 15N]' 1 Na2HPO4 10 ? mM 'natural abundance' 1 NaCl 50 ? mM 'natural abundance' 1 Na2SO4 100 ? mM 'natural abundance' 2 hAK1 1.0 ? mM '[U-100% 13C; U-100% 15N]' 2 Na2HPO4 10 ? mM 'natural abundance' 2 NaCl 50 ? mM 'natural abundance' 2 Na2SO4 100 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.2 _pdbx_nmr_exptl_sample_conditions.ionic_strength 160 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label NMR_condition _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 2 '3D HNCACB' 1 isotropic 3 1 2 '3D CBCA(CO)NH' 1 isotropic 4 1 2 '3D HNCA' 1 isotropic 5 1 2 '3D HN(CO)CA' 1 isotropic 6 1 2 '3D HNCO' 1 isotropic 7 1 2 '3D 1H-15N TOCSY' 1 isotropic 8 1 2 '3D HBHA(CO)NH' 1 isotropic 9 1 2 '3D HCCH-TOCSY' 1 isotropic 10 1 2 '3D C(CO)NH' 1 isotropic 11 1 2 '3D 1H-13C NOESY' 1 isotropic 12 1 2 '3D 1H-15N NOESY' 1 isotropic # _pdbx_nmr_refine.entry_id 7X7S _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 'chemical shift assignment' NMRFAM-SPARKY ? 'Lee W., et al.' 2 'structure calculation' ARIA2alpha ? 'Rieping W., Linge, J. P., et al.' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 1 ? A GLY 1 2 1 Y 1 A PRO 2 ? A PRO 2 3 1 Y 1 A LEU 3 ? A LEU 3 4 1 Y 1 A GLY 4 ? A GLY 4 5 1 Y 1 A SER 5 ? A SER 5 6 2 Y 1 A GLY 1 ? A GLY 1 7 2 Y 1 A PRO 2 ? A PRO 2 8 2 Y 1 A LEU 3 ? A LEU 3 9 2 Y 1 A GLY 4 ? A GLY 4 10 2 Y 1 A SER 5 ? A SER 5 11 3 Y 1 A GLY 1 ? A GLY 1 12 3 Y 1 A PRO 2 ? A PRO 2 13 3 Y 1 A LEU 3 ? A LEU 3 14 3 Y 1 A GLY 4 ? A GLY 4 15 3 Y 1 A SER 5 ? A SER 5 16 4 Y 1 A GLY 1 ? A GLY 1 17 4 Y 1 A PRO 2 ? A PRO 2 18 4 Y 1 A LEU 3 ? A LEU 3 19 4 Y 1 A GLY 4 ? A GLY 4 20 4 Y 1 A SER 5 ? A SER 5 21 5 Y 1 A GLY 1 ? A GLY 1 22 5 Y 1 A PRO 2 ? A PRO 2 23 5 Y 1 A LEU 3 ? A LEU 3 24 5 Y 1 A GLY 4 ? A GLY 4 25 5 Y 1 A SER 5 ? A SER 5 26 6 Y 1 A GLY 1 ? A GLY 1 27 6 Y 1 A PRO 2 ? A PRO 2 28 6 Y 1 A LEU 3 ? A LEU 3 29 6 Y 1 A GLY 4 ? A GLY 4 30 6 Y 1 A SER 5 ? A SER 5 31 7 Y 1 A GLY 1 ? A GLY 1 32 7 Y 1 A PRO 2 ? A PRO 2 33 7 Y 1 A LEU 3 ? A LEU 3 34 7 Y 1 A GLY 4 ? A GLY 4 35 7 Y 1 A SER 5 ? A SER 5 36 8 Y 1 A GLY 1 ? A GLY 1 37 8 Y 1 A PRO 2 ? A PRO 2 38 8 Y 1 A LEU 3 ? A LEU 3 39 8 Y 1 A GLY 4 ? A GLY 4 40 8 Y 1 A SER 5 ? A SER 5 41 9 Y 1 A GLY 1 ? A GLY 1 42 9 Y 1 A PRO 2 ? A PRO 2 43 9 Y 1 A LEU 3 ? A LEU 3 44 9 Y 1 A GLY 4 ? A GLY 4 45 9 Y 1 A SER 5 ? A SER 5 46 10 Y 1 A GLY 1 ? A GLY 1 47 10 Y 1 A PRO 2 ? A PRO 2 48 10 Y 1 A LEU 3 ? A LEU 3 49 10 Y 1 A GLY 4 ? A GLY 4 50 10 Y 1 A SER 5 ? A SER 5 51 11 Y 1 A GLY 1 ? A GLY 1 52 11 Y 1 A PRO 2 ? A PRO 2 53 11 Y 1 A LEU 3 ? A LEU 3 54 11 Y 1 A GLY 4 ? A GLY 4 55 11 Y 1 A SER 5 ? A SER 5 56 12 Y 1 A GLY 1 ? A GLY 1 57 12 Y 1 A PRO 2 ? A PRO 2 58 12 Y 1 A LEU 3 ? A LEU 3 59 12 Y 1 A GLY 4 ? A GLY 4 60 12 Y 1 A SER 5 ? A SER 5 61 13 Y 1 A GLY 1 ? A GLY 1 62 13 Y 1 A PRO 2 ? A PRO 2 63 13 Y 1 A LEU 3 ? A LEU 3 64 13 Y 1 A GLY 4 ? A GLY 4 65 13 Y 1 A SER 5 ? A SER 5 66 14 Y 1 A GLY 1 ? A GLY 1 67 14 Y 1 A PRO 2 ? A PRO 2 68 14 Y 1 A LEU 3 ? A LEU 3 69 14 Y 1 A GLY 4 ? A GLY 4 70 14 Y 1 A SER 5 ? A SER 5 71 15 Y 1 A GLY 1 ? A GLY 1 72 15 Y 1 A PRO 2 ? A PRO 2 73 15 Y 1 A LEU 3 ? A LEU 3 74 15 Y 1 A GLY 4 ? A GLY 4 75 15 Y 1 A SER 5 ? A SER 5 76 16 Y 1 A GLY 1 ? A GLY 1 77 16 Y 1 A PRO 2 ? A PRO 2 78 16 Y 1 A LEU 3 ? A LEU 3 79 16 Y 1 A GLY 4 ? A GLY 4 80 16 Y 1 A SER 5 ? A SER 5 81 17 Y 1 A GLY 1 ? A GLY 1 82 17 Y 1 A PRO 2 ? A PRO 2 83 17 Y 1 A LEU 3 ? A LEU 3 84 17 Y 1 A GLY 4 ? A GLY 4 85 17 Y 1 A SER 5 ? A SER 5 86 18 Y 1 A GLY 1 ? A GLY 1 87 18 Y 1 A PRO 2 ? A PRO 2 88 18 Y 1 A LEU 3 ? A LEU 3 89 18 Y 1 A GLY 4 ? A GLY 4 90 18 Y 1 A SER 5 ? A SER 5 91 19 Y 1 A GLY 1 ? A GLY 1 92 19 Y 1 A PRO 2 ? A PRO 2 93 19 Y 1 A LEU 3 ? A LEU 3 94 19 Y 1 A GLY 4 ? A GLY 4 95 19 Y 1 A SER 5 ? A SER 5 96 20 Y 1 A GLY 1 ? A GLY 1 97 20 Y 1 A PRO 2 ? A PRO 2 98 20 Y 1 A LEU 3 ? A LEU 3 99 20 Y 1 A GLY 4 ? A GLY 4 100 20 Y 1 A SER 5 ? A SER 5 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TYR N N N N 318 TYR CA C N S 319 TYR C C N N 320 TYR O O N N 321 TYR CB C N N 322 TYR CG C Y N 323 TYR CD1 C Y N 324 TYR CD2 C Y N 325 TYR CE1 C Y N 326 TYR CE2 C Y N 327 TYR CZ C Y N 328 TYR OH O N N 329 TYR OXT O N N 330 TYR H H N N 331 TYR H2 H N N 332 TYR HA H N N 333 TYR HB2 H N N 334 TYR HB3 H N N 335 TYR HD1 H N N 336 TYR HD2 H N N 337 TYR HE1 H N N 338 TYR HE2 H N N 339 TYR HH H N N 340 TYR HXT H N N 341 VAL N N N N 342 VAL CA C N S 343 VAL C C N N 344 VAL O O N N 345 VAL CB C N N 346 VAL CG1 C N N 347 VAL CG2 C N N 348 VAL OXT O N N 349 VAL H H N N 350 VAL H2 H N N 351 VAL HA H N N 352 VAL HB H N N 353 VAL HG11 H N N 354 VAL HG12 H N N 355 VAL HG13 H N N 356 VAL HG21 H N N 357 VAL HG22 H N N 358 VAL HG23 H N N 359 VAL HXT H N N 360 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TYR N CA sing N N 304 TYR N H sing N N 305 TYR N H2 sing N N 306 TYR CA C sing N N 307 TYR CA CB sing N N 308 TYR CA HA sing N N 309 TYR C O doub N N 310 TYR C OXT sing N N 311 TYR CB CG sing N N 312 TYR CB HB2 sing N N 313 TYR CB HB3 sing N N 314 TYR CG CD1 doub Y N 315 TYR CG CD2 sing Y N 316 TYR CD1 CE1 sing Y N 317 TYR CD1 HD1 sing N N 318 TYR CD2 CE2 doub Y N 319 TYR CD2 HD2 sing N N 320 TYR CE1 CZ doub Y N 321 TYR CE1 HE1 sing N N 322 TYR CE2 CZ sing Y N 323 TYR CE2 HE2 sing N N 324 TYR CZ OH sing N N 325 TYR OH HH sing N N 326 TYR OXT HXT sing N N 327 VAL N CA sing N N 328 VAL N H sing N N 329 VAL N H2 sing N N 330 VAL CA C sing N N 331 VAL CA CB sing N N 332 VAL CA HA sing N N 333 VAL C O doub N N 334 VAL C OXT sing N N 335 VAL CB CG1 sing N N 336 VAL CB CG2 sing N N 337 VAL CB HB sing N N 338 VAL CG1 HG11 sing N N 339 VAL CG1 HG12 sing N N 340 VAL CG1 HG13 sing N N 341 VAL CG2 HG21 sing N N 342 VAL CG2 HG22 sing N N 343 VAL CG2 HG23 sing N N 344 VAL OXT HXT sing N N 345 # _pdbx_audit_support.funding_organization 'Natural Science Foundation of Fujian Province' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 2011J01246 _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model UNITY _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 7X7S _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_