data_7X88 # _entry.id 7X88 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7X88 pdb_00007x88 10.2210/pdb7x88/pdb WWPDB D_1300027612 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7X88 _pdbx_database_status.recvd_initial_deposition_date 2022-03-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Li, Y.Y.' 1 ? 'Li, H.T.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Mol.Cell _citation.journal_id_ASTM MOCEFL _citation.journal_id_CSD 2168 _citation.journal_id_ISSN 1097-2765 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 82 _citation.language ? _citation.page_first 4080 _citation.page_last 4098.e12 _citation.title 'Hotspot mutations in the structured ENL YEATS domain link aberrant transcriptional condensates and cancer.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.molcel.2022.09.034 _citation.pdbx_database_id_PubMed 36272410 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Song, L.' 1 ? primary 'Yao, X.' 2 ? primary 'Li, H.' 3 ? primary 'Peng, B.' 4 ? primary 'Boka, A.P.' 5 ? primary 'Liu, Y.' 6 ? primary 'Chen, G.' 7 ? primary 'Liu, Z.' 8 ? primary 'Mathias, K.M.' 9 ? primary 'Xia, L.' 10 ? primary 'Li, Q.' 11 ? primary 'Mir, M.' 12 ? primary 'Li, Y.' 13 ? primary 'Li, H.' 14 ? primary 'Wan, L.' 15 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7X88 _cell.details ? _cell.formula_units_Z ? _cell.length_a 52.141 _cell.length_a_esd ? _cell.length_b 52.141 _cell.length_b_esd ? _cell.length_c 136.394 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7X88 _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Protein ENL' 18327.076 1 ? 'Deletion 112-113, V114L' ? ? 2 polymer syn 'Histone H3K27ac(24-27) peptide' 487.573 1 ? ? ? ? 3 non-polymer syn 'CITRIC ACID' 192.124 1 ? ? ? ? 4 water nat water 18.015 16 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'YEATS domain-containing protein 1' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GSHMDNQCTVQVRLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVVFWLHDSFPKPRRVCKEPPYKVEESG YAGFIMPIEVHFKNKEEPRKVCFTYDLFLNLEGNLNHLRCEKLTFNNPTTEFRYKLLRAGGVMVMPEGAHHHHHH ; ;GSHMDNQCTVQVRLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVVFWLHDSFPKPRRVCKEPPYKVEESG YAGFIMPIEVHFKNKEEPRKVCFTYDLFLNLEGNLNHLRCEKLTFNNPTTEFRYKLLRAGGVMVMPEGAHHHHHH ; A ? 2 'polypeptide(L)' no yes 'AAR(ALY)' AARK B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 ASP n 1 6 ASN n 1 7 GLN n 1 8 CYS n 1 9 THR n 1 10 VAL n 1 11 GLN n 1 12 VAL n 1 13 ARG n 1 14 LEU n 1 15 GLU n 1 16 LEU n 1 17 GLY n 1 18 HIS n 1 19 ARG n 1 20 ALA n 1 21 GLN n 1 22 LEU n 1 23 ARG n 1 24 LYS n 1 25 LYS n 1 26 PRO n 1 27 THR n 1 28 THR n 1 29 GLU n 1 30 GLY n 1 31 PHE n 1 32 THR n 1 33 HIS n 1 34 ASP n 1 35 TRP n 1 36 MET n 1 37 VAL n 1 38 PHE n 1 39 VAL n 1 40 ARG n 1 41 GLY n 1 42 PRO n 1 43 GLU n 1 44 GLN n 1 45 CYS n 1 46 ASP n 1 47 ILE n 1 48 GLN n 1 49 HIS n 1 50 PHE n 1 51 VAL n 1 52 GLU n 1 53 LYS n 1 54 VAL n 1 55 VAL n 1 56 PHE n 1 57 TRP n 1 58 LEU n 1 59 HIS n 1 60 ASP n 1 61 SER n 1 62 PHE n 1 63 PRO n 1 64 LYS n 1 65 PRO n 1 66 ARG n 1 67 ARG n 1 68 VAL n 1 69 CYS n 1 70 LYS n 1 71 GLU n 1 72 PRO n 1 73 PRO n 1 74 TYR n 1 75 LYS n 1 76 VAL n 1 77 GLU n 1 78 GLU n 1 79 SER n 1 80 GLY n 1 81 TYR n 1 82 ALA n 1 83 GLY n 1 84 PHE n 1 85 ILE n 1 86 MET n 1 87 PRO n 1 88 ILE n 1 89 GLU n 1 90 VAL n 1 91 HIS n 1 92 PHE n 1 93 LYS n 1 94 ASN n 1 95 LYS n 1 96 GLU n 1 97 GLU n 1 98 PRO n 1 99 ARG n 1 100 LYS n 1 101 VAL n 1 102 CYS n 1 103 PHE n 1 104 THR n 1 105 TYR n 1 106 ASP n 1 107 LEU n 1 108 PHE n 1 109 LEU n 1 110 ASN n 1 111 LEU n 1 112 GLU n 1 113 GLY n 1 114 ASN n 1 115 LEU n 1 116 ASN n 1 117 HIS n 1 118 LEU n 1 119 ARG n 1 120 CYS n 1 121 GLU n 1 122 LYS n 1 123 LEU n 1 124 THR n 1 125 PHE n 1 126 ASN n 1 127 ASN n 1 128 PRO n 1 129 THR n 1 130 THR n 1 131 GLU n 1 132 PHE n 1 133 ARG n 1 134 TYR n 1 135 LYS n 1 136 LEU n 1 137 LEU n 1 138 ARG n 1 139 ALA n 1 140 GLY n 1 141 GLY n 1 142 VAL n 1 143 MET n 1 144 VAL n 1 145 MET n 1 146 PRO n 1 147 GLU n 1 148 GLY n 1 149 ALA n 1 150 HIS n 1 151 HIS n 1 152 HIS n 1 153 HIS n 1 154 HIS n 1 155 HIS n 2 1 ALA n 2 2 ALA n 2 3 ARG n 2 4 ALY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 155 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MLLT1, ENL, LTG19, YEATS1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 4 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP ENL_HUMAN Q03111 ? 1 ;MDNQCTVQVRLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEKVVFWLHDSFPKPRRVCKEPPYKVEESGYAG FIMPIEVHFKNKEEPRKVCFTYDLFLNLEGNPPVNHLRCEKLTFNNPTTEFRYKLLRAGGVMVMPEGA ; 1 2 PDB 7X88 7X88 ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7X88 A 4 ? 149 ? Q03111 1 ? 148 ? 1 146 2 2 7X88 B 1 ? 4 ? 7X88 24 ? 27 ? 24 27 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7X88 GLY A 1 ? UNP Q03111 ? ? 'expression tag' -2 1 1 7X88 SER A 2 ? UNP Q03111 ? ? 'expression tag' -1 2 1 7X88 HIS A 3 ? UNP Q03111 ? ? 'expression tag' 0 3 1 7X88 ? A ? ? UNP Q03111 PRO 112 deletion ? 4 1 7X88 ? A ? ? UNP Q03111 PRO 113 deletion ? 5 1 7X88 LEU A 115 ? UNP Q03111 VAL 114 'engineered mutation' 112 6 1 7X88 HIS A 150 ? UNP Q03111 ? ? 'expression tag' 147 7 1 7X88 HIS A 151 ? UNP Q03111 ? ? 'expression tag' 148 8 1 7X88 HIS A 152 ? UNP Q03111 ? ? 'expression tag' 149 9 1 7X88 HIS A 153 ? UNP Q03111 ? ? 'expression tag' 150 10 1 7X88 HIS A 154 ? UNP Q03111 ? ? 'expression tag' 151 11 1 7X88 HIS A 155 ? UNP Q03111 ? ? 'expression tag' 152 12 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ALY 'L-peptide linking' n 'N(6)-ACETYLLYSINE' ? 'C8 H16 N2 O3' 188.224 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CIT non-polymer . 'CITRIC ACID' ? 'C6 H8 O7' 192.124 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7X88 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.84 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.76 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% (w/v) PE G3350, 0.1M sodium citrate/citric acid pH 4.0, 0.2M sodium citrate tribasic' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MAR CCD 130 mm' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-11-15 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9789 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9789 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7X88 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.250 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10777 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.500 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 15.200 _reflns.pdbx_Rmerge_I_obs 0.132 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.200 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.026 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.136 _reflns.pdbx_Rpim_I_all 0.034 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 163971 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.250 2.290 ? ? ? ? ? ? 489 94.600 ? ? ? ? 0.735 ? ? ? ? ? ? ? ? 7.700 ? 0.596 ? ? 0.775 0.235 ? 1 1 0.960 ? ? ? ? ? ? ? ? ? ? 2.290 2.330 ? ? ? ? ? ? 505 98.200 ? ? ? ? 0.622 ? ? ? ? ? ? ? ? 9.700 ? 0.694 ? ? 0.651 0.186 ? 2 1 0.974 ? ? ? ? ? ? ? ? ? ? 2.330 2.380 ? ? ? ? ? ? 558 99.600 ? ? ? ? 0.581 ? ? ? ? ? ? ? ? 10.100 ? 0.658 ? ? 0.608 0.172 ? 3 1 0.965 ? ? ? ? ? ? ? ? ? ? 2.380 2.420 ? ? ? ? ? ? 496 99.600 ? ? ? ? 0.573 ? ? ? ? ? ? ? ? 11.900 ? 0.663 ? ? 0.596 0.160 ? 4 1 0.981 ? ? ? ? ? ? ? ? ? ? 2.420 2.480 ? ? ? ? ? ? 548 99.800 ? ? ? ? 0.607 ? ? ? ? ? ? ? ? 13.100 ? 0.668 ? ? 0.630 0.164 ? 5 1 0.993 ? ? ? ? ? ? ? ? ? ? 2.480 2.530 ? ? ? ? ? ? 502 99.800 ? ? ? ? 0.610 ? ? ? ? ? ? ? ? 14.200 ? 0.611 ? ? 0.631 0.160 ? 6 1 0.992 ? ? ? ? ? ? ? ? ? ? 2.530 2.600 ? ? ? ? ? ? 556 100.000 ? ? ? ? 0.588 ? ? ? ? ? ? ? ? 15.800 ? 0.649 ? ? 0.608 0.149 ? 7 1 0.992 ? ? ? ? ? ? ? ? ? ? 2.600 2.670 ? ? ? ? ? ? 521 100.000 ? ? ? ? 0.568 ? ? ? ? ? ? ? ? 16.400 ? 0.688 ? ? 0.587 0.142 ? 8 1 0.991 ? ? ? ? ? ? ? ? ? ? 2.670 2.750 ? ? ? ? ? ? 536 100.000 ? ? ? ? 0.529 ? ? ? ? ? ? ? ? 17.800 ? 0.705 ? ? 0.545 0.129 ? 9 1 0.997 ? ? ? ? ? ? ? ? ? ? 2.750 2.830 ? ? ? ? ? ? 525 100.000 ? ? ? ? 0.436 ? ? ? ? ? ? ? ? 17.100 ? 0.768 ? ? 0.449 0.108 ? 10 1 0.997 ? ? ? ? ? ? ? ? ? ? 2.830 2.940 ? ? ? ? ? ? 543 100.000 ? ? ? ? 0.339 ? ? ? ? ? ? ? ? 16.600 ? 0.863 ? ? 0.350 0.085 ? 11 1 0.995 ? ? ? ? ? ? ? ? ? ? 2.940 3.050 ? ? ? ? ? ? 536 100.000 ? ? ? ? 0.277 ? ? ? ? ? ? ? ? 19.500 ? 1.065 ? ? 0.285 0.065 ? 12 1 0.998 ? ? ? ? ? ? ? ? ? ? 3.050 3.190 ? ? ? ? ? ? 530 100.000 ? ? ? ? 0.237 ? ? ? ? ? ? ? ? 19.600 ? 1.126 ? ? 0.243 0.055 ? 13 1 0.997 ? ? ? ? ? ? ? ? ? ? 3.190 3.360 ? ? ? ? ? ? 540 100.000 ? ? ? ? 0.170 ? ? ? ? ? ? ? ? 18.800 ? 1.340 ? ? 0.175 0.041 ? 14 1 0.999 ? ? ? ? ? ? ? ? ? ? 3.360 3.570 ? ? ? ? ? ? 543 100.000 ? ? ? ? 0.131 ? ? ? ? ? ? ? ? 18.000 ? 1.507 ? ? 0.135 0.032 ? 15 1 0.999 ? ? ? ? ? ? ? ? ? ? 3.570 3.850 ? ? ? ? ? ? 547 100.000 ? ? ? ? 0.104 ? ? ? ? ? ? ? ? 17.000 ? 1.639 ? ? 0.107 0.026 ? 16 1 0.997 ? ? ? ? ? ? ? ? ? ? 3.850 4.230 ? ? ? ? ? ? 545 99.100 ? ? ? ? 0.081 ? ? ? ? ? ? ? ? 15.300 ? 1.490 ? ? 0.084 0.022 ? 17 1 0.998 ? ? ? ? ? ? ? ? ? ? 4.230 4.850 ? ? ? ? ? ? 559 99.800 ? ? ? ? 0.063 ? ? ? ? ? ? ? ? 16.200 ? 1.199 ? ? 0.065 0.017 ? 18 1 0.998 ? ? ? ? ? ? ? ? ? ? 4.850 6.100 ? ? ? ? ? ? 569 100.000 ? ? ? ? 0.066 ? ? ? ? ? ? ? ? 16.200 ? 1.270 ? ? 0.068 0.017 ? 19 1 0.999 ? ? ? ? ? ? ? ? ? ? 6.100 50.000 ? ? ? ? ? ? 629 98.900 ? ? ? ? 0.076 ? ? ? ? ? ? ? ? 12.600 ? 1.395 ? ? 0.079 0.023 ? 20 1 0.997 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 125.400 _refine.B_iso_mean 51.2133 _refine.B_iso_min 29.680 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7X88 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.2500 _refine.ls_d_res_low 45.1600 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10688 _refine.ls_number_reflns_R_free 554 _refine.ls_number_reflns_R_work 10134 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.0200 _refine.ls_percent_reflns_R_free 5.1800 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2125 _refine.ls_R_factor_R_free 0.2403 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2110 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.380 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5J9S _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.6000 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1800 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.2500 _refine_hist.d_res_low 45.1600 _refine_hist.number_atoms_solvent 16 _refine_hist.number_atoms_total 1235 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 142 _refine_hist.pdbx_B_iso_mean_ligand 60.83 _refine_hist.pdbx_B_iso_mean_solvent 49.93 _refine_hist.pdbx_number_atoms_protein 1193 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 26 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2500 2.4700 2566 . 152 2414 97.0000 . . . 0.3177 0.0000 0.2729 . . . . . . . 4 . . . 'X-RAY DIFFRACTION' 2.4700 2.8300 2617 . 129 2488 99.0000 . . . 0.2706 0.0000 0.2530 . . . . . . . 4 . . . 'X-RAY DIFFRACTION' 2.8300 3.5700 2679 . 149 2530 100.0000 . . . 0.2767 0.0000 0.2185 . . . . . . . 4 . . . 'X-RAY DIFFRACTION' 3.5700 45.1600 2826 . 124 2702 100.0000 . . . 0.1995 0.0000 0.1900 . . . . . . . 4 . . . # _struct.entry_id 7X88 _struct.title 'Crystal structure of ENL YEATS domain T2 mutant in complex with histone H3 acetylation at K27' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7X88 _struct_keywords.text 'YEATS domain, Complex, histone, Transcription, GENE REGULATION' _struct_keywords.pdbx_keywords 'GENE REGULATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 46 ? HIS A 49 ? ASP A 43 HIS A 46 5 ? 4 HELX_P HELX_P2 AA2 THR A 129 ? ALA A 139 ? THR A 126 ALA A 136 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id B _struct_conn.ptnr1_label_comp_id ARG _struct_conn.ptnr1_label_seq_id 3 _struct_conn.ptnr1_label_atom_id C _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id ALY _struct_conn.ptnr2_label_seq_id 4 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id B _struct_conn.ptnr1_auth_comp_id ARG _struct_conn.ptnr1_auth_seq_id 26 _struct_conn.ptnr2_auth_asym_id B _struct_conn.ptnr2_auth_comp_id ALY _struct_conn.ptnr2_auth_seq_id 27 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.426 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PRO 72 A . ? PRO 69 A PRO 73 A ? PRO 70 A 1 -4.67 2 GLU 97 A . ? GLU 94 A PRO 98 A ? PRO 95 A 1 -2.56 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 TYR A 74 ? GLY A 80 ? TYR A 71 GLY A 77 AA1 2 HIS A 33 ? ARG A 40 ? HIS A 30 ARG A 37 AA1 3 THR A 9 ? LEU A 22 ? THR A 6 LEU A 19 AA1 4 ASN A 114 ? ASN A 126 ? ASN A 111 ASN A 123 AA2 1 TYR A 74 ? GLY A 80 ? TYR A 71 GLY A 77 AA2 2 HIS A 33 ? ARG A 40 ? HIS A 30 ARG A 37 AA2 3 THR A 9 ? LEU A 22 ? THR A 6 LEU A 19 AA2 4 VAL A 142 ? VAL A 144 ? VAL A 139 VAL A 141 AA3 1 ARG A 66 ? CYS A 69 ? ARG A 63 CYS A 66 AA3 2 VAL A 51 ? TRP A 57 ? VAL A 48 TRP A 54 AA3 3 PHE A 84 ? PHE A 92 ? PHE A 81 PHE A 89 AA3 4 LYS A 100 ? LEU A 107 ? LYS A 97 LEU A 104 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 78 ? O GLU A 75 N TRP A 35 ? N TRP A 32 AA1 2 3 O ASP A 34 ? O ASP A 31 N GLN A 21 ? N GLN A 18 AA1 3 4 N LEU A 16 ? N LEU A 13 O ARG A 119 ? O ARG A 116 AA2 1 2 O GLU A 78 ? O GLU A 75 N TRP A 35 ? N TRP A 32 AA2 2 3 O ASP A 34 ? O ASP A 31 N GLN A 21 ? N GLN A 18 AA2 3 4 N GLN A 11 ? N GLN A 8 O VAL A 142 ? O VAL A 139 AA3 1 2 O ARG A 67 ? O ARG A 64 N PHE A 56 ? N PHE A 53 AA3 2 3 N LYS A 53 ? N LYS A 50 O HIS A 91 ? O HIS A 88 AA3 3 4 N MET A 86 ? N MET A 83 O TYR A 105 ? O TYR A 102 # _atom_sites.entry_id 7X88 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.019179 _atom_sites.fract_transf_matrix[1][2] 0.011073 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022146 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007332 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 HIS 3 0 ? ? ? A . n A 1 4 MET 4 1 ? ? ? A . n A 1 5 ASP 5 2 ? ? ? A . n A 1 6 ASN 6 3 ? ? ? A . n A 1 7 GLN 7 4 4 GLN GLN A . n A 1 8 CYS 8 5 5 CYS CYS A . n A 1 9 THR 9 6 6 THR THR A . n A 1 10 VAL 10 7 7 VAL VAL A . n A 1 11 GLN 11 8 8 GLN GLN A . n A 1 12 VAL 12 9 9 VAL VAL A . n A 1 13 ARG 13 10 10 ARG ARG A . n A 1 14 LEU 14 11 11 LEU LEU A . n A 1 15 GLU 15 12 12 GLU GLU A . n A 1 16 LEU 16 13 13 LEU LEU A . n A 1 17 GLY 17 14 14 GLY GLY A . n A 1 18 HIS 18 15 15 HIS HIS A . n A 1 19 ARG 19 16 16 ARG ARG A . n A 1 20 ALA 20 17 17 ALA ALA A . n A 1 21 GLN 21 18 18 GLN GLN A . n A 1 22 LEU 22 19 19 LEU LEU A . n A 1 23 ARG 23 20 20 ARG ARG A . n A 1 24 LYS 24 21 21 LYS LYS A . n A 1 25 LYS 25 22 22 LYS LYS A . n A 1 26 PRO 26 23 23 PRO PRO A . n A 1 27 THR 27 24 24 THR THR A . n A 1 28 THR 28 25 25 THR THR A . n A 1 29 GLU 29 26 26 GLU GLU A . n A 1 30 GLY 30 27 27 GLY GLY A . n A 1 31 PHE 31 28 28 PHE PHE A . n A 1 32 THR 32 29 29 THR THR A . n A 1 33 HIS 33 30 30 HIS HIS A . n A 1 34 ASP 34 31 31 ASP ASP A . n A 1 35 TRP 35 32 32 TRP TRP A . n A 1 36 MET 36 33 33 MET MET A . n A 1 37 VAL 37 34 34 VAL VAL A . n A 1 38 PHE 38 35 35 PHE PHE A . n A 1 39 VAL 39 36 36 VAL VAL A . n A 1 40 ARG 40 37 37 ARG ARG A . n A 1 41 GLY 41 38 38 GLY GLY A . n A 1 42 PRO 42 39 39 PRO PRO A . n A 1 43 GLU 43 40 40 GLU GLU A . n A 1 44 GLN 44 41 41 GLN GLN A . n A 1 45 CYS 45 42 42 CYS CYS A . n A 1 46 ASP 46 43 43 ASP ASP A . n A 1 47 ILE 47 44 44 ILE ILE A . n A 1 48 GLN 48 45 45 GLN GLN A . n A 1 49 HIS 49 46 46 HIS HIS A . n A 1 50 PHE 50 47 47 PHE PHE A . n A 1 51 VAL 51 48 48 VAL VAL A . n A 1 52 GLU 52 49 49 GLU GLU A . n A 1 53 LYS 53 50 50 LYS LYS A . n A 1 54 VAL 54 51 51 VAL VAL A . n A 1 55 VAL 55 52 52 VAL VAL A . n A 1 56 PHE 56 53 53 PHE PHE A . n A 1 57 TRP 57 54 54 TRP TRP A . n A 1 58 LEU 58 55 55 LEU LEU A . n A 1 59 HIS 59 56 56 HIS HIS A . n A 1 60 ASP 60 57 57 ASP ASP A . n A 1 61 SER 61 58 58 SER SER A . n A 1 62 PHE 62 59 59 PHE PHE A . n A 1 63 PRO 63 60 60 PRO PRO A . n A 1 64 LYS 64 61 61 LYS LYS A . n A 1 65 PRO 65 62 62 PRO PRO A . n A 1 66 ARG 66 63 63 ARG ARG A . n A 1 67 ARG 67 64 64 ARG ARG A . n A 1 68 VAL 68 65 65 VAL VAL A . n A 1 69 CYS 69 66 66 CYS CYS A . n A 1 70 LYS 70 67 67 LYS LYS A . n A 1 71 GLU 71 68 68 GLU GLU A . n A 1 72 PRO 72 69 69 PRO PRO A . n A 1 73 PRO 73 70 70 PRO PRO A . n A 1 74 TYR 74 71 71 TYR TYR A . n A 1 75 LYS 75 72 72 LYS LYS A . n A 1 76 VAL 76 73 73 VAL VAL A . n A 1 77 GLU 77 74 74 GLU GLU A . n A 1 78 GLU 78 75 75 GLU GLU A . n A 1 79 SER 79 76 76 SER SER A . n A 1 80 GLY 80 77 77 GLY GLY A . n A 1 81 TYR 81 78 78 TYR TYR A . n A 1 82 ALA 82 79 79 ALA ALA A . n A 1 83 GLY 83 80 80 GLY GLY A . n A 1 84 PHE 84 81 81 PHE PHE A . n A 1 85 ILE 85 82 82 ILE ILE A . n A 1 86 MET 86 83 83 MET MET A . n A 1 87 PRO 87 84 84 PRO PRO A . n A 1 88 ILE 88 85 85 ILE ILE A . n A 1 89 GLU 89 86 86 GLU GLU A . n A 1 90 VAL 90 87 87 VAL VAL A . n A 1 91 HIS 91 88 88 HIS HIS A . n A 1 92 PHE 92 89 89 PHE PHE A . n A 1 93 LYS 93 90 90 LYS LYS A . n A 1 94 ASN 94 91 91 ASN ASN A . n A 1 95 LYS 95 92 92 LYS LYS A . n A 1 96 GLU 96 93 93 GLU GLU A . n A 1 97 GLU 97 94 94 GLU GLU A . n A 1 98 PRO 98 95 95 PRO PRO A . n A 1 99 ARG 99 96 96 ARG ARG A . n A 1 100 LYS 100 97 97 LYS LYS A . n A 1 101 VAL 101 98 98 VAL VAL A . n A 1 102 CYS 102 99 99 CYS CYS A . n A 1 103 PHE 103 100 100 PHE PHE A . n A 1 104 THR 104 101 101 THR THR A . n A 1 105 TYR 105 102 102 TYR TYR A . n A 1 106 ASP 106 103 103 ASP ASP A . n A 1 107 LEU 107 104 104 LEU LEU A . n A 1 108 PHE 108 105 105 PHE PHE A . n A 1 109 LEU 109 106 106 LEU LEU A . n A 1 110 ASN 110 107 107 ASN ASN A . n A 1 111 LEU 111 108 108 LEU LEU A . n A 1 112 GLU 112 109 109 GLU GLU A . n A 1 113 GLY 113 110 110 GLY GLY A . n A 1 114 ASN 114 111 111 ASN ASN A . n A 1 115 LEU 115 112 112 LEU LEU A . n A 1 116 ASN 116 113 113 ASN ASN A . n A 1 117 HIS 117 114 114 HIS HIS A . n A 1 118 LEU 118 115 115 LEU LEU A . n A 1 119 ARG 119 116 116 ARG ARG A . n A 1 120 CYS 120 117 117 CYS CYS A . n A 1 121 GLU 121 118 118 GLU GLU A . n A 1 122 LYS 122 119 119 LYS LYS A . n A 1 123 LEU 123 120 120 LEU LEU A . n A 1 124 THR 124 121 121 THR THR A . n A 1 125 PHE 125 122 122 PHE PHE A . n A 1 126 ASN 126 123 123 ASN ASN A . n A 1 127 ASN 127 124 124 ASN ASN A . n A 1 128 PRO 128 125 125 PRO PRO A . n A 1 129 THR 129 126 126 THR THR A . n A 1 130 THR 130 127 127 THR THR A . n A 1 131 GLU 131 128 128 GLU GLU A . n A 1 132 PHE 132 129 129 PHE PHE A . n A 1 133 ARG 133 130 130 ARG ARG A . n A 1 134 TYR 134 131 131 TYR TYR A . n A 1 135 LYS 135 132 132 LYS LYS A . n A 1 136 LEU 136 133 133 LEU LEU A . n A 1 137 LEU 137 134 134 LEU LEU A . n A 1 138 ARG 138 135 135 ARG ARG A . n A 1 139 ALA 139 136 136 ALA ALA A . n A 1 140 GLY 140 137 137 GLY GLY A . n A 1 141 GLY 141 138 138 GLY GLY A . n A 1 142 VAL 142 139 139 VAL VAL A . n A 1 143 MET 143 140 140 MET MET A . n A 1 144 VAL 144 141 141 VAL VAL A . n A 1 145 MET 145 142 142 MET MET A . n A 1 146 PRO 146 143 ? ? ? A . n A 1 147 GLU 147 144 ? ? ? A . n A 1 148 GLY 148 145 ? ? ? A . n A 1 149 ALA 149 146 ? ? ? A . n A 1 150 HIS 150 147 ? ? ? A . n A 1 151 HIS 151 148 ? ? ? A . n A 1 152 HIS 152 149 ? ? ? A . n A 1 153 HIS 153 150 ? ? ? A . n A 1 154 HIS 154 151 ? ? ? A . n A 1 155 HIS 155 152 ? ? ? A . n B 2 1 ALA 1 24 24 ALA ALA B . n B 2 2 ALA 2 25 25 ALA ALA B . n B 2 3 ARG 3 26 26 ARG ARG B . n B 2 4 ALY 4 27 27 ALY ALY B . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email lht@tsinghua.edu.cn _pdbx_contact_author.name_first Haitao _pdbx_contact_author.name_last Li _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-6741-293X # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 CIT 1 201 201 CIT CIT A . D 4 HOH 1 301 14 HOH HOH A . D 4 HOH 2 302 12 HOH HOH A . D 4 HOH 3 303 7 HOH HOH A . D 4 HOH 4 304 4 HOH HOH A . D 4 HOH 5 305 5 HOH HOH A . D 4 HOH 6 306 3 HOH HOH A . D 4 HOH 7 307 11 HOH HOH A . D 4 HOH 8 308 9 HOH HOH A . D 4 HOH 9 309 6 HOH HOH A . D 4 HOH 10 310 16 HOH HOH A . D 4 HOH 11 311 10 HOH HOH A . D 4 HOH 12 312 2 HOH HOH A . D 4 HOH 13 313 1 HOH HOH A . D 4 HOH 14 314 13 HOH HOH A . D 4 HOH 15 315 15 HOH HOH A . E 4 HOH 1 101 8 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 910 ? 1 MORE -1 ? 1 'SSA (A^2)' 8430 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-01-18 2 'Structure model' 1 1 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.17.1_3660 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _pdbx_entry_details.entry_id 7X88 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 ND1 A HIS 114 ? ? O A HOH 301 ? ? 2.15 2 1 NE2 A GLN 18 ? ? OD1 A ASN 111 ? ? 2.19 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 NZ A LYS 21 ? ? 1_555 O A MET 140 ? ? 3_454 1.38 2 1 OE2 A GLU 68 ? ? 1_555 CE A MET 142 ? ? 6_445 2.01 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CB _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 VAL _pdbx_validate_rmsd_bond.auth_seq_id_1 139 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CG2 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 VAL _pdbx_validate_rmsd_bond.auth_seq_id_2 139 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.391 _pdbx_validate_rmsd_bond.bond_target_value 1.524 _pdbx_validate_rmsd_bond.bond_deviation -0.133 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.021 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A LEU 104 ? ? CB A LEU 104 ? ? CG A LEU 104 ? ? 100.13 115.30 -15.17 2.30 N 2 1 CA A VAL 139 ? ? CB A VAL 139 ? ? CG2 A VAL 139 ? ? 122.20 110.90 11.30 1.50 N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id GLN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 41 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 74.81 _pdbx_validate_torsion.psi -19.11 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id ARG _pdbx_validate_main_chain_plane.auth_asym_id B _pdbx_validate_main_chain_plane.auth_seq_id 26 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle -10.28 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 A HIS 0 ? A HIS 3 4 1 Y 1 A MET 1 ? A MET 4 5 1 Y 1 A ASP 2 ? A ASP 5 6 1 Y 1 A ASN 3 ? A ASN 6 7 1 Y 1 A PRO 143 ? A PRO 146 8 1 Y 1 A GLU 144 ? A GLU 147 9 1 Y 1 A GLY 145 ? A GLY 148 10 1 Y 1 A ALA 146 ? A ALA 149 11 1 Y 1 A HIS 147 ? A HIS 150 12 1 Y 1 A HIS 148 ? A HIS 151 13 1 Y 1 A HIS 149 ? A HIS 152 14 1 Y 1 A HIS 150 ? A HIS 153 15 1 Y 1 A HIS 151 ? A HIS 154 16 1 Y 1 A HIS 152 ? A HIS 155 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ALY OH O N N 14 ALY CH C N N 15 ALY CH3 C N N 16 ALY NZ N N N 17 ALY CE C N N 18 ALY CD C N N 19 ALY CG C N N 20 ALY CB C N N 21 ALY CA C N S 22 ALY N N N N 23 ALY C C N N 24 ALY O O N N 25 ALY OXT O N N 26 ALY HH31 H N N 27 ALY HH32 H N N 28 ALY HH33 H N N 29 ALY HZ H N N 30 ALY HE3 H N N 31 ALY HE2 H N N 32 ALY HD3 H N N 33 ALY HD2 H N N 34 ALY HG3 H N N 35 ALY HG2 H N N 36 ALY HB3 H N N 37 ALY HB2 H N N 38 ALY HA H N N 39 ALY H H N N 40 ALY H2 H N N 41 ALY HXT H N N 42 ARG N N N N 43 ARG CA C N S 44 ARG C C N N 45 ARG O O N N 46 ARG CB C N N 47 ARG CG C N N 48 ARG CD C N N 49 ARG NE N N N 50 ARG CZ C N N 51 ARG NH1 N N N 52 ARG NH2 N N N 53 ARG OXT O N N 54 ARG H H N N 55 ARG H2 H N N 56 ARG HA H N N 57 ARG HB2 H N N 58 ARG HB3 H N N 59 ARG HG2 H N N 60 ARG HG3 H N N 61 ARG HD2 H N N 62 ARG HD3 H N N 63 ARG HE H N N 64 ARG HH11 H N N 65 ARG HH12 H N N 66 ARG HH21 H N N 67 ARG HH22 H N N 68 ARG HXT H N N 69 ASN N N N N 70 ASN CA C N S 71 ASN C C N N 72 ASN O O N N 73 ASN CB C N N 74 ASN CG C N N 75 ASN OD1 O N N 76 ASN ND2 N N N 77 ASN OXT O N N 78 ASN H H N N 79 ASN H2 H N N 80 ASN HA H N N 81 ASN HB2 H N N 82 ASN HB3 H N N 83 ASN HD21 H N N 84 ASN HD22 H N N 85 ASN HXT H N N 86 ASP N N N N 87 ASP CA C N S 88 ASP C C N N 89 ASP O O N N 90 ASP CB C N N 91 ASP CG C N N 92 ASP OD1 O N N 93 ASP OD2 O N N 94 ASP OXT O N N 95 ASP H H N N 96 ASP H2 H N N 97 ASP HA H N N 98 ASP HB2 H N N 99 ASP HB3 H N N 100 ASP HD2 H N N 101 ASP HXT H N N 102 CIT C1 C N N 103 CIT O1 O N N 104 CIT O2 O N N 105 CIT C2 C N N 106 CIT C3 C N N 107 CIT O7 O N N 108 CIT C4 C N N 109 CIT C5 C N N 110 CIT O3 O N N 111 CIT O4 O N N 112 CIT C6 C N N 113 CIT O5 O N N 114 CIT O6 O N N 115 CIT HO2 H N N 116 CIT H21 H N N 117 CIT H22 H N N 118 CIT HO7 H N N 119 CIT H41 H N N 120 CIT H42 H N N 121 CIT HO4 H N N 122 CIT HO6 H N N 123 CYS N N N N 124 CYS CA C N R 125 CYS C C N N 126 CYS O O N N 127 CYS CB C N N 128 CYS SG S N N 129 CYS OXT O N N 130 CYS H H N N 131 CYS H2 H N N 132 CYS HA H N N 133 CYS HB2 H N N 134 CYS HB3 H N N 135 CYS HG H N N 136 CYS HXT H N N 137 GLN N N N N 138 GLN CA C N S 139 GLN C C N N 140 GLN O O N N 141 GLN CB C N N 142 GLN CG C N N 143 GLN CD C N N 144 GLN OE1 O N N 145 GLN NE2 N N N 146 GLN OXT O N N 147 GLN H H N N 148 GLN H2 H N N 149 GLN HA H N N 150 GLN HB2 H N N 151 GLN HB3 H N N 152 GLN HG2 H N N 153 GLN HG3 H N N 154 GLN HE21 H N N 155 GLN HE22 H N N 156 GLN HXT H N N 157 GLU N N N N 158 GLU CA C N S 159 GLU C C N N 160 GLU O O N N 161 GLU CB C N N 162 GLU CG C N N 163 GLU CD C N N 164 GLU OE1 O N N 165 GLU OE2 O N N 166 GLU OXT O N N 167 GLU H H N N 168 GLU H2 H N N 169 GLU HA H N N 170 GLU HB2 H N N 171 GLU HB3 H N N 172 GLU HG2 H N N 173 GLU HG3 H N N 174 GLU HE2 H N N 175 GLU HXT H N N 176 GLY N N N N 177 GLY CA C N N 178 GLY C C N N 179 GLY O O N N 180 GLY OXT O N N 181 GLY H H N N 182 GLY H2 H N N 183 GLY HA2 H N N 184 GLY HA3 H N N 185 GLY HXT H N N 186 HIS N N N N 187 HIS CA C N S 188 HIS C C N N 189 HIS O O N N 190 HIS CB C N N 191 HIS CG C Y N 192 HIS ND1 N Y N 193 HIS CD2 C Y N 194 HIS CE1 C Y N 195 HIS NE2 N Y N 196 HIS OXT O N N 197 HIS H H N N 198 HIS H2 H N N 199 HIS HA H N N 200 HIS HB2 H N N 201 HIS HB3 H N N 202 HIS HD1 H N N 203 HIS HD2 H N N 204 HIS HE1 H N N 205 HIS HE2 H N N 206 HIS HXT H N N 207 HOH O O N N 208 HOH H1 H N N 209 HOH H2 H N N 210 ILE N N N N 211 ILE CA C N S 212 ILE C C N N 213 ILE O O N N 214 ILE CB C N S 215 ILE CG1 C N N 216 ILE CG2 C N N 217 ILE CD1 C N N 218 ILE OXT O N N 219 ILE H H N N 220 ILE H2 H N N 221 ILE HA H N N 222 ILE HB H N N 223 ILE HG12 H N N 224 ILE HG13 H N N 225 ILE HG21 H N N 226 ILE HG22 H N N 227 ILE HG23 H N N 228 ILE HD11 H N N 229 ILE HD12 H N N 230 ILE HD13 H N N 231 ILE HXT H N N 232 LEU N N N N 233 LEU CA C N S 234 LEU C C N N 235 LEU O O N N 236 LEU CB C N N 237 LEU CG C N N 238 LEU CD1 C N N 239 LEU CD2 C N N 240 LEU OXT O N N 241 LEU H H N N 242 LEU H2 H N N 243 LEU HA H N N 244 LEU HB2 H N N 245 LEU HB3 H N N 246 LEU HG H N N 247 LEU HD11 H N N 248 LEU HD12 H N N 249 LEU HD13 H N N 250 LEU HD21 H N N 251 LEU HD22 H N N 252 LEU HD23 H N N 253 LEU HXT H N N 254 LYS N N N N 255 LYS CA C N S 256 LYS C C N N 257 LYS O O N N 258 LYS CB C N N 259 LYS CG C N N 260 LYS CD C N N 261 LYS CE C N N 262 LYS NZ N N N 263 LYS OXT O N N 264 LYS H H N N 265 LYS H2 H N N 266 LYS HA H N N 267 LYS HB2 H N N 268 LYS HB3 H N N 269 LYS HG2 H N N 270 LYS HG3 H N N 271 LYS HD2 H N N 272 LYS HD3 H N N 273 LYS HE2 H N N 274 LYS HE3 H N N 275 LYS HZ1 H N N 276 LYS HZ2 H N N 277 LYS HZ3 H N N 278 LYS HXT H N N 279 MET N N N N 280 MET CA C N S 281 MET C C N N 282 MET O O N N 283 MET CB C N N 284 MET CG C N N 285 MET SD S N N 286 MET CE C N N 287 MET OXT O N N 288 MET H H N N 289 MET H2 H N N 290 MET HA H N N 291 MET HB2 H N N 292 MET HB3 H N N 293 MET HG2 H N N 294 MET HG3 H N N 295 MET HE1 H N N 296 MET HE2 H N N 297 MET HE3 H N N 298 MET HXT H N N 299 PHE N N N N 300 PHE CA C N S 301 PHE C C N N 302 PHE O O N N 303 PHE CB C N N 304 PHE CG C Y N 305 PHE CD1 C Y N 306 PHE CD2 C Y N 307 PHE CE1 C Y N 308 PHE CE2 C Y N 309 PHE CZ C Y N 310 PHE OXT O N N 311 PHE H H N N 312 PHE H2 H N N 313 PHE HA H N N 314 PHE HB2 H N N 315 PHE HB3 H N N 316 PHE HD1 H N N 317 PHE HD2 H N N 318 PHE HE1 H N N 319 PHE HE2 H N N 320 PHE HZ H N N 321 PHE HXT H N N 322 PRO N N N N 323 PRO CA C N S 324 PRO C C N N 325 PRO O O N N 326 PRO CB C N N 327 PRO CG C N N 328 PRO CD C N N 329 PRO OXT O N N 330 PRO H H N N 331 PRO HA H N N 332 PRO HB2 H N N 333 PRO HB3 H N N 334 PRO HG2 H N N 335 PRO HG3 H N N 336 PRO HD2 H N N 337 PRO HD3 H N N 338 PRO HXT H N N 339 SER N N N N 340 SER CA C N S 341 SER C C N N 342 SER O O N N 343 SER CB C N N 344 SER OG O N N 345 SER OXT O N N 346 SER H H N N 347 SER H2 H N N 348 SER HA H N N 349 SER HB2 H N N 350 SER HB3 H N N 351 SER HG H N N 352 SER HXT H N N 353 THR N N N N 354 THR CA C N S 355 THR C C N N 356 THR O O N N 357 THR CB C N R 358 THR OG1 O N N 359 THR CG2 C N N 360 THR OXT O N N 361 THR H H N N 362 THR H2 H N N 363 THR HA H N N 364 THR HB H N N 365 THR HG1 H N N 366 THR HG21 H N N 367 THR HG22 H N N 368 THR HG23 H N N 369 THR HXT H N N 370 TRP N N N N 371 TRP CA C N S 372 TRP C C N N 373 TRP O O N N 374 TRP CB C N N 375 TRP CG C Y N 376 TRP CD1 C Y N 377 TRP CD2 C Y N 378 TRP NE1 N Y N 379 TRP CE2 C Y N 380 TRP CE3 C Y N 381 TRP CZ2 C Y N 382 TRP CZ3 C Y N 383 TRP CH2 C Y N 384 TRP OXT O N N 385 TRP H H N N 386 TRP H2 H N N 387 TRP HA H N N 388 TRP HB2 H N N 389 TRP HB3 H N N 390 TRP HD1 H N N 391 TRP HE1 H N N 392 TRP HE3 H N N 393 TRP HZ2 H N N 394 TRP HZ3 H N N 395 TRP HH2 H N N 396 TRP HXT H N N 397 TYR N N N N 398 TYR CA C N S 399 TYR C C N N 400 TYR O O N N 401 TYR CB C N N 402 TYR CG C Y N 403 TYR CD1 C Y N 404 TYR CD2 C Y N 405 TYR CE1 C Y N 406 TYR CE2 C Y N 407 TYR CZ C Y N 408 TYR OH O N N 409 TYR OXT O N N 410 TYR H H N N 411 TYR H2 H N N 412 TYR HA H N N 413 TYR HB2 H N N 414 TYR HB3 H N N 415 TYR HD1 H N N 416 TYR HD2 H N N 417 TYR HE1 H N N 418 TYR HE2 H N N 419 TYR HH H N N 420 TYR HXT H N N 421 VAL N N N N 422 VAL CA C N S 423 VAL C C N N 424 VAL O O N N 425 VAL CB C N N 426 VAL CG1 C N N 427 VAL CG2 C N N 428 VAL OXT O N N 429 VAL H H N N 430 VAL H2 H N N 431 VAL HA H N N 432 VAL HB H N N 433 VAL HG11 H N N 434 VAL HG12 H N N 435 VAL HG13 H N N 436 VAL HG21 H N N 437 VAL HG22 H N N 438 VAL HG23 H N N 439 VAL HXT H N N 440 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ALY OH CH doub N N 13 ALY CH CH3 sing N N 14 ALY CH NZ sing N N 15 ALY CH3 HH31 sing N N 16 ALY CH3 HH32 sing N N 17 ALY CH3 HH33 sing N N 18 ALY NZ CE sing N N 19 ALY NZ HZ sing N N 20 ALY CE CD sing N N 21 ALY CE HE3 sing N N 22 ALY CE HE2 sing N N 23 ALY CD CG sing N N 24 ALY CD HD3 sing N N 25 ALY CD HD2 sing N N 26 ALY CG CB sing N N 27 ALY CG HG3 sing N N 28 ALY CG HG2 sing N N 29 ALY CB CA sing N N 30 ALY CB HB3 sing N N 31 ALY CB HB2 sing N N 32 ALY CA N sing N N 33 ALY CA C sing N N 34 ALY CA HA sing N N 35 ALY N H sing N N 36 ALY N H2 sing N N 37 ALY C O doub N N 38 ALY C OXT sing N N 39 ALY OXT HXT sing N N 40 ARG N CA sing N N 41 ARG N H sing N N 42 ARG N H2 sing N N 43 ARG CA C sing N N 44 ARG CA CB sing N N 45 ARG CA HA sing N N 46 ARG C O doub N N 47 ARG C OXT sing N N 48 ARG CB CG sing N N 49 ARG CB HB2 sing N N 50 ARG CB HB3 sing N N 51 ARG CG CD sing N N 52 ARG CG HG2 sing N N 53 ARG CG HG3 sing N N 54 ARG CD NE sing N N 55 ARG CD HD2 sing N N 56 ARG CD HD3 sing N N 57 ARG NE CZ sing N N 58 ARG NE HE sing N N 59 ARG CZ NH1 sing N N 60 ARG CZ NH2 doub N N 61 ARG NH1 HH11 sing N N 62 ARG NH1 HH12 sing N N 63 ARG NH2 HH21 sing N N 64 ARG NH2 HH22 sing N N 65 ARG OXT HXT sing N N 66 ASN N CA sing N N 67 ASN N H sing N N 68 ASN N H2 sing N N 69 ASN CA C sing N N 70 ASN CA CB sing N N 71 ASN CA HA sing N N 72 ASN C O doub N N 73 ASN C OXT sing N N 74 ASN CB CG sing N N 75 ASN CB HB2 sing N N 76 ASN CB HB3 sing N N 77 ASN CG OD1 doub N N 78 ASN CG ND2 sing N N 79 ASN ND2 HD21 sing N N 80 ASN ND2 HD22 sing N N 81 ASN OXT HXT sing N N 82 ASP N CA sing N N 83 ASP N H sing N N 84 ASP N H2 sing N N 85 ASP CA C sing N N 86 ASP CA CB sing N N 87 ASP CA HA sing N N 88 ASP C O doub N N 89 ASP C OXT sing N N 90 ASP CB CG sing N N 91 ASP CB HB2 sing N N 92 ASP CB HB3 sing N N 93 ASP CG OD1 doub N N 94 ASP CG OD2 sing N N 95 ASP OD2 HD2 sing N N 96 ASP OXT HXT sing N N 97 CIT C1 O1 doub N N 98 CIT C1 O2 sing N N 99 CIT C1 C2 sing N N 100 CIT O2 HO2 sing N N 101 CIT C2 C3 sing N N 102 CIT C2 H21 sing N N 103 CIT C2 H22 sing N N 104 CIT C3 O7 sing N N 105 CIT C3 C4 sing N N 106 CIT C3 C6 sing N N 107 CIT O7 HO7 sing N N 108 CIT C4 C5 sing N N 109 CIT C4 H41 sing N N 110 CIT C4 H42 sing N N 111 CIT C5 O3 doub N N 112 CIT C5 O4 sing N N 113 CIT O4 HO4 sing N N 114 CIT C6 O5 doub N N 115 CIT C6 O6 sing N N 116 CIT O6 HO6 sing N N 117 CYS N CA sing N N 118 CYS N H sing N N 119 CYS N H2 sing N N 120 CYS CA C sing N N 121 CYS CA CB sing N N 122 CYS CA HA sing N N 123 CYS C O doub N N 124 CYS C OXT sing N N 125 CYS CB SG sing N N 126 CYS CB HB2 sing N N 127 CYS CB HB3 sing N N 128 CYS SG HG sing N N 129 CYS OXT HXT sing N N 130 GLN N CA sing N N 131 GLN N H sing N N 132 GLN N H2 sing N N 133 GLN CA C sing N N 134 GLN CA CB sing N N 135 GLN CA HA sing N N 136 GLN C O doub N N 137 GLN C OXT sing N N 138 GLN CB CG sing N N 139 GLN CB HB2 sing N N 140 GLN CB HB3 sing N N 141 GLN CG CD sing N N 142 GLN CG HG2 sing N N 143 GLN CG HG3 sing N N 144 GLN CD OE1 doub N N 145 GLN CD NE2 sing N N 146 GLN NE2 HE21 sing N N 147 GLN NE2 HE22 sing N N 148 GLN OXT HXT sing N N 149 GLU N CA sing N N 150 GLU N H sing N N 151 GLU N H2 sing N N 152 GLU CA C sing N N 153 GLU CA CB sing N N 154 GLU CA HA sing N N 155 GLU C O doub N N 156 GLU C OXT sing N N 157 GLU CB CG sing N N 158 GLU CB HB2 sing N N 159 GLU CB HB3 sing N N 160 GLU CG CD sing N N 161 GLU CG HG2 sing N N 162 GLU CG HG3 sing N N 163 GLU CD OE1 doub N N 164 GLU CD OE2 sing N N 165 GLU OE2 HE2 sing N N 166 GLU OXT HXT sing N N 167 GLY N CA sing N N 168 GLY N H sing N N 169 GLY N H2 sing N N 170 GLY CA C sing N N 171 GLY CA HA2 sing N N 172 GLY CA HA3 sing N N 173 GLY C O doub N N 174 GLY C OXT sing N N 175 GLY OXT HXT sing N N 176 HIS N CA sing N N 177 HIS N H sing N N 178 HIS N H2 sing N N 179 HIS CA C sing N N 180 HIS CA CB sing N N 181 HIS CA HA sing N N 182 HIS C O doub N N 183 HIS C OXT sing N N 184 HIS CB CG sing N N 185 HIS CB HB2 sing N N 186 HIS CB HB3 sing N N 187 HIS CG ND1 sing Y N 188 HIS CG CD2 doub Y N 189 HIS ND1 CE1 doub Y N 190 HIS ND1 HD1 sing N N 191 HIS CD2 NE2 sing Y N 192 HIS CD2 HD2 sing N N 193 HIS CE1 NE2 sing Y N 194 HIS CE1 HE1 sing N N 195 HIS NE2 HE2 sing N N 196 HIS OXT HXT sing N N 197 HOH O H1 sing N N 198 HOH O H2 sing N N 199 ILE N CA sing N N 200 ILE N H sing N N 201 ILE N H2 sing N N 202 ILE CA C sing N N 203 ILE CA CB sing N N 204 ILE CA HA sing N N 205 ILE C O doub N N 206 ILE C OXT sing N N 207 ILE CB CG1 sing N N 208 ILE CB CG2 sing N N 209 ILE CB HB sing N N 210 ILE CG1 CD1 sing N N 211 ILE CG1 HG12 sing N N 212 ILE CG1 HG13 sing N N 213 ILE CG2 HG21 sing N N 214 ILE CG2 HG22 sing N N 215 ILE CG2 HG23 sing N N 216 ILE CD1 HD11 sing N N 217 ILE CD1 HD12 sing N N 218 ILE CD1 HD13 sing N N 219 ILE OXT HXT sing N N 220 LEU N CA sing N N 221 LEU N H sing N N 222 LEU N H2 sing N N 223 LEU CA C sing N N 224 LEU CA CB sing N N 225 LEU CA HA sing N N 226 LEU C O doub N N 227 LEU C OXT sing N N 228 LEU CB CG sing N N 229 LEU CB HB2 sing N N 230 LEU CB HB3 sing N N 231 LEU CG CD1 sing N N 232 LEU CG CD2 sing N N 233 LEU CG HG sing N N 234 LEU CD1 HD11 sing N N 235 LEU CD1 HD12 sing N N 236 LEU CD1 HD13 sing N N 237 LEU CD2 HD21 sing N N 238 LEU CD2 HD22 sing N N 239 LEU CD2 HD23 sing N N 240 LEU OXT HXT sing N N 241 LYS N CA sing N N 242 LYS N H sing N N 243 LYS N H2 sing N N 244 LYS CA C sing N N 245 LYS CA CB sing N N 246 LYS CA HA sing N N 247 LYS C O doub N N 248 LYS C OXT sing N N 249 LYS CB CG sing N N 250 LYS CB HB2 sing N N 251 LYS CB HB3 sing N N 252 LYS CG CD sing N N 253 LYS CG HG2 sing N N 254 LYS CG HG3 sing N N 255 LYS CD CE sing N N 256 LYS CD HD2 sing N N 257 LYS CD HD3 sing N N 258 LYS CE NZ sing N N 259 LYS CE HE2 sing N N 260 LYS CE HE3 sing N N 261 LYS NZ HZ1 sing N N 262 LYS NZ HZ2 sing N N 263 LYS NZ HZ3 sing N N 264 LYS OXT HXT sing N N 265 MET N CA sing N N 266 MET N H sing N N 267 MET N H2 sing N N 268 MET CA C sing N N 269 MET CA CB sing N N 270 MET CA HA sing N N 271 MET C O doub N N 272 MET C OXT sing N N 273 MET CB CG sing N N 274 MET CB HB2 sing N N 275 MET CB HB3 sing N N 276 MET CG SD sing N N 277 MET CG HG2 sing N N 278 MET CG HG3 sing N N 279 MET SD CE sing N N 280 MET CE HE1 sing N N 281 MET CE HE2 sing N N 282 MET CE HE3 sing N N 283 MET OXT HXT sing N N 284 PHE N CA sing N N 285 PHE N H sing N N 286 PHE N H2 sing N N 287 PHE CA C sing N N 288 PHE CA CB sing N N 289 PHE CA HA sing N N 290 PHE C O doub N N 291 PHE C OXT sing N N 292 PHE CB CG sing N N 293 PHE CB HB2 sing N N 294 PHE CB HB3 sing N N 295 PHE CG CD1 doub Y N 296 PHE CG CD2 sing Y N 297 PHE CD1 CE1 sing Y N 298 PHE CD1 HD1 sing N N 299 PHE CD2 CE2 doub Y N 300 PHE CD2 HD2 sing N N 301 PHE CE1 CZ doub Y N 302 PHE CE1 HE1 sing N N 303 PHE CE2 CZ sing Y N 304 PHE CE2 HE2 sing N N 305 PHE CZ HZ sing N N 306 PHE OXT HXT sing N N 307 PRO N CA sing N N 308 PRO N CD sing N N 309 PRO N H sing N N 310 PRO CA C sing N N 311 PRO CA CB sing N N 312 PRO CA HA sing N N 313 PRO C O doub N N 314 PRO C OXT sing N N 315 PRO CB CG sing N N 316 PRO CB HB2 sing N N 317 PRO CB HB3 sing N N 318 PRO CG CD sing N N 319 PRO CG HG2 sing N N 320 PRO CG HG3 sing N N 321 PRO CD HD2 sing N N 322 PRO CD HD3 sing N N 323 PRO OXT HXT sing N N 324 SER N CA sing N N 325 SER N H sing N N 326 SER N H2 sing N N 327 SER CA C sing N N 328 SER CA CB sing N N 329 SER CA HA sing N N 330 SER C O doub N N 331 SER C OXT sing N N 332 SER CB OG sing N N 333 SER CB HB2 sing N N 334 SER CB HB3 sing N N 335 SER OG HG sing N N 336 SER OXT HXT sing N N 337 THR N CA sing N N 338 THR N H sing N N 339 THR N H2 sing N N 340 THR CA C sing N N 341 THR CA CB sing N N 342 THR CA HA sing N N 343 THR C O doub N N 344 THR C OXT sing N N 345 THR CB OG1 sing N N 346 THR CB CG2 sing N N 347 THR CB HB sing N N 348 THR OG1 HG1 sing N N 349 THR CG2 HG21 sing N N 350 THR CG2 HG22 sing N N 351 THR CG2 HG23 sing N N 352 THR OXT HXT sing N N 353 TRP N CA sing N N 354 TRP N H sing N N 355 TRP N H2 sing N N 356 TRP CA C sing N N 357 TRP CA CB sing N N 358 TRP CA HA sing N N 359 TRP C O doub N N 360 TRP C OXT sing N N 361 TRP CB CG sing N N 362 TRP CB HB2 sing N N 363 TRP CB HB3 sing N N 364 TRP CG CD1 doub Y N 365 TRP CG CD2 sing Y N 366 TRP CD1 NE1 sing Y N 367 TRP CD1 HD1 sing N N 368 TRP CD2 CE2 doub Y N 369 TRP CD2 CE3 sing Y N 370 TRP NE1 CE2 sing Y N 371 TRP NE1 HE1 sing N N 372 TRP CE2 CZ2 sing Y N 373 TRP CE3 CZ3 doub Y N 374 TRP CE3 HE3 sing N N 375 TRP CZ2 CH2 doub Y N 376 TRP CZ2 HZ2 sing N N 377 TRP CZ3 CH2 sing Y N 378 TRP CZ3 HZ3 sing N N 379 TRP CH2 HH2 sing N N 380 TRP OXT HXT sing N N 381 TYR N CA sing N N 382 TYR N H sing N N 383 TYR N H2 sing N N 384 TYR CA C sing N N 385 TYR CA CB sing N N 386 TYR CA HA sing N N 387 TYR C O doub N N 388 TYR C OXT sing N N 389 TYR CB CG sing N N 390 TYR CB HB2 sing N N 391 TYR CB HB3 sing N N 392 TYR CG CD1 doub Y N 393 TYR CG CD2 sing Y N 394 TYR CD1 CE1 sing Y N 395 TYR CD1 HD1 sing N N 396 TYR CD2 CE2 doub Y N 397 TYR CD2 HD2 sing N N 398 TYR CE1 CZ doub Y N 399 TYR CE1 HE1 sing N N 400 TYR CE2 CZ sing Y N 401 TYR CE2 HE2 sing N N 402 TYR CZ OH sing N N 403 TYR OH HH sing N N 404 TYR OXT HXT sing N N 405 VAL N CA sing N N 406 VAL N H sing N N 407 VAL N H2 sing N N 408 VAL CA C sing N N 409 VAL CA CB sing N N 410 VAL CA HA sing N N 411 VAL C O doub N N 412 VAL C OXT sing N N 413 VAL CB CG1 sing N N 414 VAL CB CG2 sing N N 415 VAL CB HB sing N N 416 VAL CG1 HG11 sing N N 417 VAL CG1 HG12 sing N N 418 VAL CG1 HG13 sing N N 419 VAL CG2 HG21 sing N N 420 VAL CG2 HG22 sing N N 421 VAL CG2 HG23 sing N N 422 VAL OXT HXT sing N N 423 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Natural Science Foundation of China (NSFC)' China 91753230 1 'National Natural Science Foundation of China (NSFC)' China 31725014 2 'National Natural Science Foundation of China (NSFC)' China 31871283 3 'National Natural Science Foundation of China (NSFC)' China 31922016 4 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 ALY ? ? ALY ? ? 'SUBJECT OF INVESTIGATION' ? 2 CIT ? ? CIT ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'CITRIC ACID' CIT 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5J9S _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #