data_7XAF # _entry.id 7XAF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7XAF pdb_00007xaf 10.2210/pdb7xaf/pdb WWPDB D_1300028392 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7XAF _pdbx_database_status.recvd_initial_deposition_date 2022-03-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Zhang, Z.M.' 1 ? 'Wang, Y.J.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 65 _citation.language ? _citation.page_first 6325 _citation.page_last 6337 _citation.title ;Discovery of the First Highly Selective and Broadly Effective Macrocycle-Based Type II TRK Inhibitors that Overcome Clinically Acquired Resistance. ; _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.2c00308 _citation.pdbx_database_id_PubMed 35426680 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, Z.' 1 ? primary 'Wang, J.' 2 ? primary 'Wang, Y.' 3 ? primary 'Xiang, S.' 4 ? primary 'Song, X.' 5 ? primary 'Tu, Z.' 6 ? primary 'Zhou, Y.' 7 0000-0003-4167-6413 primary 'Zhang, Z.M.' 8 ? primary 'Zhang, Z.' 9 ? primary 'Ding, K.' 10 0000-0001-9016-812X primary 'Lu, X.' 11 0000-0001-7931-6873 # _cell.angle_alpha 90.0 _cell.angle_alpha_esd ? _cell.angle_beta 90.0 _cell.angle_beta_esd ? _cell.angle_gamma 120.0 _cell.angle_gamma_esd ? _cell.entry_id 7XAF _cell.details ? _cell.formula_units_Z ? _cell.length_a 52.1159 _cell.length_a_esd ? _cell.length_b 52.1159 _cell.length_b_esd ? _cell.length_c 228.483 _cell.length_c_esd ? _cell.volume 537433.839538 _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 7XAF _symmetry.cell_setting ? _symmetry.Int_Tables_number 151 _symmetry.space_group_name_Hall 'P 31 2 (x,y,z+1/3)' _symmetry.space_group_name_H-M 'P 31 1 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'High affinity nerve growth factor receptor' 33907.141 1 2.7.10.1 ? ? ? 2 non-polymer syn ;4^6,14-dimethyl-N-(3-(4-methyl-1H-imidazol-1-yl)-5-(trifluoromethyl)phenyl)-10-oxo-5-oxa-11,14-diaza-1(3,6)-imidazo[1,2-b]pyridazina-4(1,3)-benzenacyclo-tetradecaphan-2-yne-45-carboxamide ; 670.684 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Neurotrophic tyrosine kinase receptor type 1,TRK1-transforming tyrosine kinase protein,Tropomyosin-related kinase A,Tyrosine kinase receptor,Tyrosine kinase receptor A,Trk-A,gp140trk,p140-TrkA ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFG VCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCL VGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAI DCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG ; _entity_poly.pdbx_seq_one_letter_code_can ;SDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFG VCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCL VGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAI DCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASP n 1 3 ALA n 1 4 CYS n 1 5 VAL n 1 6 HIS n 1 7 HIS n 1 8 ILE n 1 9 LYS n 1 10 ARG n 1 11 ARG n 1 12 ASP n 1 13 ILE n 1 14 VAL n 1 15 LEU n 1 16 LYS n 1 17 TRP n 1 18 GLU n 1 19 LEU n 1 20 GLY n 1 21 GLU n 1 22 GLY n 1 23 ALA n 1 24 PHE n 1 25 GLY n 1 26 LYS n 1 27 VAL n 1 28 PHE n 1 29 LEU n 1 30 ALA n 1 31 GLU n 1 32 CYS n 1 33 HIS n 1 34 ASN n 1 35 LEU n 1 36 LEU n 1 37 PRO n 1 38 GLU n 1 39 GLN n 1 40 ASP n 1 41 LYS n 1 42 MET n 1 43 LEU n 1 44 VAL n 1 45 ALA n 1 46 VAL n 1 47 LYS n 1 48 ALA n 1 49 LEU n 1 50 LYS n 1 51 GLU n 1 52 ALA n 1 53 SER n 1 54 GLU n 1 55 SER n 1 56 ALA n 1 57 ARG n 1 58 GLN n 1 59 ASP n 1 60 PHE n 1 61 GLN n 1 62 ARG n 1 63 GLU n 1 64 ALA n 1 65 GLU n 1 66 LEU n 1 67 LEU n 1 68 THR n 1 69 MET n 1 70 LEU n 1 71 GLN n 1 72 HIS n 1 73 GLN n 1 74 HIS n 1 75 ILE n 1 76 VAL n 1 77 ARG n 1 78 PHE n 1 79 PHE n 1 80 GLY n 1 81 VAL n 1 82 CYS n 1 83 THR n 1 84 GLU n 1 85 GLY n 1 86 ARG n 1 87 PRO n 1 88 LEU n 1 89 LEU n 1 90 MET n 1 91 VAL n 1 92 PHE n 1 93 GLU n 1 94 TYR n 1 95 MET n 1 96 ARG n 1 97 HIS n 1 98 GLY n 1 99 ASP n 1 100 LEU n 1 101 ASN n 1 102 ARG n 1 103 PHE n 1 104 LEU n 1 105 ARG n 1 106 SER n 1 107 HIS n 1 108 GLY n 1 109 PRO n 1 110 ASP n 1 111 ALA n 1 112 LYS n 1 113 LEU n 1 114 LEU n 1 115 ALA n 1 116 GLY n 1 117 GLY n 1 118 GLU n 1 119 ASP n 1 120 VAL n 1 121 ALA n 1 122 PRO n 1 123 GLY n 1 124 PRO n 1 125 LEU n 1 126 GLY n 1 127 LEU n 1 128 GLY n 1 129 GLN n 1 130 LEU n 1 131 LEU n 1 132 ALA n 1 133 VAL n 1 134 ALA n 1 135 SER n 1 136 GLN n 1 137 VAL n 1 138 ALA n 1 139 ALA n 1 140 GLY n 1 141 MET n 1 142 VAL n 1 143 TYR n 1 144 LEU n 1 145 ALA n 1 146 GLY n 1 147 LEU n 1 148 HIS n 1 149 PHE n 1 150 VAL n 1 151 HIS n 1 152 ARG n 1 153 ASP n 1 154 LEU n 1 155 ALA n 1 156 THR n 1 157 ARG n 1 158 ASN n 1 159 CYS n 1 160 LEU n 1 161 VAL n 1 162 GLY n 1 163 GLN n 1 164 GLY n 1 165 LEU n 1 166 VAL n 1 167 VAL n 1 168 LYS n 1 169 ILE n 1 170 GLY n 1 171 ASP n 1 172 PHE n 1 173 GLY n 1 174 MET n 1 175 SER n 1 176 ARG n 1 177 ASP n 1 178 ILE n 1 179 TYR n 1 180 SER n 1 181 THR n 1 182 ASP n 1 183 TYR n 1 184 TYR n 1 185 ARG n 1 186 VAL n 1 187 GLY n 1 188 GLY n 1 189 ARG n 1 190 THR n 1 191 MET n 1 192 LEU n 1 193 PRO n 1 194 ILE n 1 195 ARG n 1 196 TRP n 1 197 MET n 1 198 PRO n 1 199 PRO n 1 200 GLU n 1 201 SER n 1 202 ILE n 1 203 LEU n 1 204 TYR n 1 205 ARG n 1 206 LYS n 1 207 PHE n 1 208 THR n 1 209 THR n 1 210 GLU n 1 211 SER n 1 212 ASP n 1 213 VAL n 1 214 TRP n 1 215 SER n 1 216 PHE n 1 217 GLY n 1 218 VAL n 1 219 VAL n 1 220 LEU n 1 221 TRP n 1 222 GLU n 1 223 ILE n 1 224 PHE n 1 225 THR n 1 226 TYR n 1 227 GLY n 1 228 LYS n 1 229 GLN n 1 230 PRO n 1 231 TRP n 1 232 TYR n 1 233 GLN n 1 234 LEU n 1 235 SER n 1 236 ASN n 1 237 THR n 1 238 GLU n 1 239 ALA n 1 240 ILE n 1 241 ASP n 1 242 CYS n 1 243 ILE n 1 244 THR n 1 245 GLN n 1 246 GLY n 1 247 ARG n 1 248 GLU n 1 249 LEU n 1 250 GLU n 1 251 ARG n 1 252 PRO n 1 253 ARG n 1 254 ALA n 1 255 CYS n 1 256 PRO n 1 257 PRO n 1 258 GLU n 1 259 VAL n 1 260 TYR n 1 261 ALA n 1 262 ILE n 1 263 MET n 1 264 ARG n 1 265 GLY n 1 266 CYS n 1 267 TRP n 1 268 GLN n 1 269 ARG n 1 270 GLU n 1 271 PRO n 1 272 GLN n 1 273 GLN n 1 274 ARG n 1 275 HIS n 1 276 SER n 1 277 ILE n 1 278 LYS n 1 279 ASP n 1 280 VAL n 1 281 HIS n 1 282 ALA n 1 283 ARG n 1 284 LEU n 1 285 GLN n 1 286 ALA n 1 287 LEU n 1 288 ALA n 1 289 GLN n 1 290 ALA n 1 291 PRO n 1 292 PRO n 1 293 VAL n 1 294 TYR n 1 295 LEU n 1 296 ASP n 1 297 VAL n 1 298 LEU n 1 299 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 299 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'NTRK1, MTC, TRK, TRKA' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Baculovirus expression vector pFastBac1-HM' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 274590 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code NTRK1_HUMAN _struct_ref.pdbx_db_accession P04629 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEASESARQDFQREAELLTMLQHQHIVRFFG VCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCL VGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAI DCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLDVLG ; _struct_ref.pdbx_align_begin 498 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7XAF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 299 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P04629 _struct_ref_seq.db_align_beg 498 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 796 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 498 _struct_ref_seq.pdbx_auth_seq_align_end 796 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FKT non-polymer . ;4^6,14-dimethyl-N-(3-(4-methyl-1H-imidazol-1-yl)-5-(trifluoromethyl)phenyl)-10-oxo-5-oxa-11,14-diaza-1(3,6)-imidazo[1,2-b]pyridazina-4(1,3)-benzenacyclo-tetradecaphan-2-yne-45-carboxamide ; ? 'C35 H33 F3 N8 O3' 670.684 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7XAF _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.64 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.44 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.2 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M Na2HPO4/KH2PO4 (pH 6.2), 2M NaCl' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 104.5 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 200K' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-01-04 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source 'ROTATING ANODE' _diffrn_source.target ? _diffrn_source.type 'RIGAKU FR-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_synchrotron_site ? # _reflns.B_iso_Wilson_estimate 34.0744234139 _reflns.entry_id 7XAF _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.0 _reflns.d_resolution_low 19.42 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 7315 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.7 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 4.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.888 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 3.0 _reflns_shell.d_res_low 3.21 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 2270 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.408 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 21.8050788741 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7XAF _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.00118200625 _refine.ls_d_res_low 19.4139275078 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7314 _refine.ls_number_reflns_R_free 729 _refine.ls_number_reflns_R_work 6585 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.7044534413 _refine.ls_percent_reflns_R_free 9.96718621821 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.249636509057 _refine.ls_R_factor_R_free 0.298970001589 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.244122605039 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36398038186 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5H3Q _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.649245432 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.480076300413 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 3.00118200625 _refine_hist.d_res_low 19.4139275078 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 2262 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2213 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 49 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.00318682516932 ? 2322 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.825945244109 ? 3159 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0276878525387 ? 338 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.00499369499719 ? 405 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.109444435 ? 814 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.0012 3.2319 . . 146 1318 99.863574352 . . . 0.354871020333 . 0.302155565684 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2319 3.5554 . . 137 1311 99.8620689655 . . . 0.314748971398 . 0.282469705321 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5554 4.0657 . . 150 1316 99.2552471225 . . . 0.329787653658 . 0.244529252569 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0657 5.1069 . . 150 1313 98.7846049966 . . . 0.240172357009 . 0.211607165323 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.1069 9.96 . . 146 1327 95.9609120521 . . . 0.294430445063 . 0.215765131783 . . . . . . . . . . . # _struct.entry_id 7XAF _struct.title ;The crystal structure of TrkA kinase in complex with 4^6,14-dimethyl-N-(3-(4-methyl-1H-imidazol-1-yl)-5-(trifluoromethyl)phenyl)-10-oxo-5-oxa-11,14-diaza-1(3,6)-imidazo[1,2-b]pyridazina-4(1,3)-benzenacyclo- tetradecaphan-2-yne-45-carboxamide ; _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7XAF _struct_keywords.text 'TrkA, Transferase Inhibitor, TRANSFERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex' _struct_keywords.pdbx_keywords 'TRANSFERASE/TRANSFERASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ARG A 57 ? LEU A 70 ? ARG A 554 LEU A 567 1 ? 14 HELX_P HELX_P2 AA2 ASP A 99 ? SER A 106 ? ASP A 596 SER A 603 1 ? 8 HELX_P HELX_P3 AA3 GLY A 126 ? LEU A 147 ? GLY A 623 LEU A 644 1 ? 22 HELX_P HELX_P4 AA4 ALA A 155 ? CYS A 159 ? ALA A 652 CYS A 656 5 ? 5 HELX_P HELX_P5 AA5 MET A 174 ? TYR A 179 ? MET A 671 TYR A 676 1 ? 6 HELX_P HELX_P6 AA6 SER A 180 ? TYR A 183 ? SER A 677 TYR A 680 5 ? 4 HELX_P HELX_P7 AA7 PRO A 193 ? MET A 197 ? PRO A 690 MET A 694 5 ? 5 HELX_P HELX_P8 AA8 PRO A 198 ? LEU A 203 ? PRO A 695 LEU A 700 1 ? 6 HELX_P HELX_P9 AA9 THR A 209 ? PHE A 224 ? THR A 706 PHE A 721 1 ? 16 HELX_P HELX_P10 AB1 SER A 235 ? GLN A 245 ? SER A 732 GLN A 742 1 ? 11 HELX_P HELX_P11 AB2 PRO A 256 ? GLY A 265 ? PRO A 753 GLY A 762 1 ? 10 HELX_P HELX_P12 AB3 SER A 276 ? GLN A 289 ? SER A 773 GLN A 786 1 ? 14 HELX_P HELX_P13 AB4 PRO A 291 ? LEU A 298 ? PRO A 788 LEU A 795 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ARG 86 A . ? ARG 583 A PRO 87 A ? PRO 584 A 1 0.85 2 ALA 111 A . ? ALA 608 A LYS 112 A ? LYS 609 A 1 3.25 3 GLY 123 A . ? GLY 620 A PRO 124 A ? PRO 621 A 1 -4.06 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 14 ? GLU A 21 ? VAL A 511 GLU A 518 AA1 2 GLY A 25 ? GLU A 31 ? GLY A 522 GLU A 528 AA1 3 LEU A 43 ? LEU A 49 ? LEU A 540 LEU A 546 AA1 4 LEU A 89 ? GLU A 93 ? LEU A 586 GLU A 590 AA1 5 PHE A 78 ? CYS A 82 ? PHE A 575 CYS A 579 AA2 1 LEU A 160 ? VAL A 161 ? LEU A 657 VAL A 658 AA2 2 VAL A 167 ? LYS A 168 ? VAL A 664 LYS A 665 AA3 1 TYR A 184 ? ARG A 185 ? TYR A 681 ARG A 682 AA3 2 MET A 191 ? LEU A 192 ? MET A 688 LEU A 689 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 19 ? N LEU A 516 O VAL A 27 ? O VAL A 524 AA1 2 3 N ALA A 30 ? N ALA A 527 O VAL A 44 ? O VAL A 541 AA1 3 4 N ALA A 45 ? N ALA A 542 O PHE A 92 ? O PHE A 589 AA1 4 5 O VAL A 91 ? O VAL A 588 N GLY A 80 ? N GLY A 577 AA2 1 2 N LEU A 160 ? N LEU A 657 O LYS A 168 ? O LYS A 665 AA3 1 2 N TYR A 184 ? N TYR A 681 O LEU A 192 ? O LEU A 689 # _atom_sites.entry_id 7XAF _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.019188 _atom_sites.fract_transf_matrix[1][2] 0.011078 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022156 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004377 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 25.62398 1.50364 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? F ? ? 8.95735 ? 7.27484 ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 6.96715 ? 11.43723 ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 7.96527 ? 9.05267 ? 0.0 ;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 1.23737 29.19336 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 498 498 SER SER A . n A 1 2 ASP 2 499 499 ASP ASP A . n A 1 3 ALA 3 500 500 ALA ALA A . n A 1 4 CYS 4 501 501 CYS CYS A . n A 1 5 VAL 5 502 502 VAL VAL A . n A 1 6 HIS 6 503 503 HIS HIS A . n A 1 7 HIS 7 504 504 HIS HIS A . n A 1 8 ILE 8 505 505 ILE ILE A . n A 1 9 LYS 9 506 506 LYS LYS A . n A 1 10 ARG 10 507 507 ARG ARG A . n A 1 11 ARG 11 508 508 ARG ARG A . n A 1 12 ASP 12 509 509 ASP ASP A . n A 1 13 ILE 13 510 510 ILE ILE A . n A 1 14 VAL 14 511 511 VAL VAL A . n A 1 15 LEU 15 512 512 LEU LEU A . n A 1 16 LYS 16 513 513 LYS LYS A . n A 1 17 TRP 17 514 514 TRP TRP A . n A 1 18 GLU 18 515 515 GLU GLU A . n A 1 19 LEU 19 516 516 LEU LEU A . n A 1 20 GLY 20 517 517 GLY GLY A . n A 1 21 GLU 21 518 518 GLU GLU A . n A 1 22 GLY 22 519 519 GLY GLY A . n A 1 23 ALA 23 520 520 ALA ALA A . n A 1 24 PHE 24 521 521 PHE PHE A . n A 1 25 GLY 25 522 522 GLY GLY A . n A 1 26 LYS 26 523 523 LYS LYS A . n A 1 27 VAL 27 524 524 VAL VAL A . n A 1 28 PHE 28 525 525 PHE PHE A . n A 1 29 LEU 29 526 526 LEU LEU A . n A 1 30 ALA 30 527 527 ALA ALA A . n A 1 31 GLU 31 528 528 GLU GLU A . n A 1 32 CYS 32 529 529 CYS CYS A . n A 1 33 HIS 33 530 530 HIS HIS A . n A 1 34 ASN 34 531 531 ASN ASN A . n A 1 35 LEU 35 532 ? ? ? A . n A 1 36 LEU 36 533 ? ? ? A . n A 1 37 PRO 37 534 ? ? ? A . n A 1 38 GLU 38 535 ? ? ? A . n A 1 39 GLN 39 536 ? ? ? A . n A 1 40 ASP 40 537 ? ? ? A . n A 1 41 LYS 41 538 538 LYS LYS A . n A 1 42 MET 42 539 539 MET MET A . n A 1 43 LEU 43 540 540 LEU LEU A . n A 1 44 VAL 44 541 541 VAL VAL A . n A 1 45 ALA 45 542 542 ALA ALA A . n A 1 46 VAL 46 543 543 VAL VAL A . n A 1 47 LYS 47 544 544 LYS LYS A . n A 1 48 ALA 48 545 545 ALA ALA A . n A 1 49 LEU 49 546 546 LEU LEU A . n A 1 50 LYS 50 547 547 LYS LYS A . n A 1 51 GLU 51 548 548 GLU GLU A . n A 1 52 ALA 52 549 ? ? ? A . n A 1 53 SER 53 550 ? ? ? A . n A 1 54 GLU 54 551 ? ? ? A . n A 1 55 SER 55 552 ? ? ? A . n A 1 56 ALA 56 553 553 ALA ALA A . n A 1 57 ARG 57 554 554 ARG ARG A . n A 1 58 GLN 58 555 555 GLN GLN A . n A 1 59 ASP 59 556 556 ASP ASP A . n A 1 60 PHE 60 557 557 PHE PHE A . n A 1 61 GLN 61 558 558 GLN GLN A . n A 1 62 ARG 62 559 559 ARG ARG A . n A 1 63 GLU 63 560 560 GLU GLU A . n A 1 64 ALA 64 561 561 ALA ALA A . n A 1 65 GLU 65 562 562 GLU GLU A . n A 1 66 LEU 66 563 563 LEU LEU A . n A 1 67 LEU 67 564 564 LEU LEU A . n A 1 68 THR 68 565 565 THR THR A . n A 1 69 MET 69 566 566 MET MET A . n A 1 70 LEU 70 567 567 LEU LEU A . n A 1 71 GLN 71 568 568 GLN GLN A . n A 1 72 HIS 72 569 569 HIS HIS A . n A 1 73 GLN 73 570 570 GLN GLN A . n A 1 74 HIS 74 571 571 HIS HIS A . n A 1 75 ILE 75 572 572 ILE ILE A . n A 1 76 VAL 76 573 573 VAL VAL A . n A 1 77 ARG 77 574 574 ARG ARG A . n A 1 78 PHE 78 575 575 PHE PHE A . n A 1 79 PHE 79 576 576 PHE PHE A . n A 1 80 GLY 80 577 577 GLY GLY A . n A 1 81 VAL 81 578 578 VAL VAL A . n A 1 82 CYS 82 579 579 CYS CYS A . n A 1 83 THR 83 580 580 THR THR A . n A 1 84 GLU 84 581 581 GLU GLU A . n A 1 85 GLY 85 582 582 GLY GLY A . n A 1 86 ARG 86 583 583 ARG ARG A . n A 1 87 PRO 87 584 584 PRO PRO A . n A 1 88 LEU 88 585 585 LEU LEU A . n A 1 89 LEU 89 586 586 LEU LEU A . n A 1 90 MET 90 587 587 MET MET A . n A 1 91 VAL 91 588 588 VAL VAL A . n A 1 92 PHE 92 589 589 PHE PHE A . n A 1 93 GLU 93 590 590 GLU GLU A . n A 1 94 TYR 94 591 591 TYR TYR A . n A 1 95 MET 95 592 592 MET MET A . n A 1 96 ARG 96 593 593 ARG ARG A . n A 1 97 HIS 97 594 594 HIS HIS A . n A 1 98 GLY 98 595 595 GLY GLY A . n A 1 99 ASP 99 596 596 ASP ASP A . n A 1 100 LEU 100 597 597 LEU LEU A . n A 1 101 ASN 101 598 598 ASN ASN A . n A 1 102 ARG 102 599 599 ARG ARG A . n A 1 103 PHE 103 600 600 PHE PHE A . n A 1 104 LEU 104 601 601 LEU LEU A . n A 1 105 ARG 105 602 602 ARG ARG A . n A 1 106 SER 106 603 603 SER SER A . n A 1 107 HIS 107 604 604 HIS HIS A . n A 1 108 GLY 108 605 605 GLY GLY A . n A 1 109 PRO 109 606 606 PRO PRO A . n A 1 110 ASP 110 607 607 ASP ASP A . n A 1 111 ALA 111 608 608 ALA ALA A . n A 1 112 LYS 112 609 609 LYS LYS A . n A 1 113 LEU 113 610 ? ? ? A . n A 1 114 LEU 114 611 ? ? ? A . n A 1 115 ALA 115 612 612 ALA ALA A . n A 1 116 GLY 116 613 613 GLY GLY A . n A 1 117 GLY 117 614 614 GLY GLY A . n A 1 118 GLU 118 615 615 GLU GLU A . n A 1 119 ASP 119 616 616 ASP ASP A . n A 1 120 VAL 120 617 617 VAL VAL A . n A 1 121 ALA 121 618 618 ALA ALA A . n A 1 122 PRO 122 619 619 PRO PRO A . n A 1 123 GLY 123 620 620 GLY GLY A . n A 1 124 PRO 124 621 621 PRO PRO A . n A 1 125 LEU 125 622 622 LEU LEU A . n A 1 126 GLY 126 623 623 GLY GLY A . n A 1 127 LEU 127 624 624 LEU LEU A . n A 1 128 GLY 128 625 625 GLY GLY A . n A 1 129 GLN 129 626 626 GLN GLN A . n A 1 130 LEU 130 627 627 LEU LEU A . n A 1 131 LEU 131 628 628 LEU LEU A . n A 1 132 ALA 132 629 629 ALA ALA A . n A 1 133 VAL 133 630 630 VAL VAL A . n A 1 134 ALA 134 631 631 ALA ALA A . n A 1 135 SER 135 632 632 SER SER A . n A 1 136 GLN 136 633 633 GLN GLN A . n A 1 137 VAL 137 634 634 VAL VAL A . n A 1 138 ALA 138 635 635 ALA ALA A . n A 1 139 ALA 139 636 636 ALA ALA A . n A 1 140 GLY 140 637 637 GLY GLY A . n A 1 141 MET 141 638 638 MET MET A . n A 1 142 VAL 142 639 639 VAL VAL A . n A 1 143 TYR 143 640 640 TYR TYR A . n A 1 144 LEU 144 641 641 LEU LEU A . n A 1 145 ALA 145 642 642 ALA ALA A . n A 1 146 GLY 146 643 643 GLY GLY A . n A 1 147 LEU 147 644 644 LEU LEU A . n A 1 148 HIS 148 645 645 HIS HIS A . n A 1 149 PHE 149 646 646 PHE PHE A . n A 1 150 VAL 150 647 647 VAL VAL A . n A 1 151 HIS 151 648 648 HIS HIS A . n A 1 152 ARG 152 649 649 ARG ARG A . n A 1 153 ASP 153 650 650 ASP ASP A . n A 1 154 LEU 154 651 651 LEU LEU A . n A 1 155 ALA 155 652 652 ALA ALA A . n A 1 156 THR 156 653 653 THR THR A . n A 1 157 ARG 157 654 654 ARG ARG A . n A 1 158 ASN 158 655 655 ASN ASN A . n A 1 159 CYS 159 656 656 CYS CYS A . n A 1 160 LEU 160 657 657 LEU LEU A . n A 1 161 VAL 161 658 658 VAL VAL A . n A 1 162 GLY 162 659 659 GLY GLY A . n A 1 163 GLN 163 660 660 GLN GLN A . n A 1 164 GLY 164 661 661 GLY GLY A . n A 1 165 LEU 165 662 662 LEU LEU A . n A 1 166 VAL 166 663 663 VAL VAL A . n A 1 167 VAL 167 664 664 VAL VAL A . n A 1 168 LYS 168 665 665 LYS LYS A . n A 1 169 ILE 169 666 666 ILE ILE A . n A 1 170 GLY 170 667 667 GLY GLY A . n A 1 171 ASP 171 668 668 ASP ASP A . n A 1 172 PHE 172 669 669 PHE PHE A . n A 1 173 GLY 173 670 670 GLY GLY A . n A 1 174 MET 174 671 671 MET MET A . n A 1 175 SER 175 672 672 SER SER A . n A 1 176 ARG 176 673 673 ARG ARG A . n A 1 177 ASP 177 674 674 ASP ASP A . n A 1 178 ILE 178 675 675 ILE ILE A . n A 1 179 TYR 179 676 676 TYR TYR A . n A 1 180 SER 180 677 677 SER SER A . n A 1 181 THR 181 678 678 THR THR A . n A 1 182 ASP 182 679 679 ASP ASP A . n A 1 183 TYR 183 680 680 TYR TYR A . n A 1 184 TYR 184 681 681 TYR TYR A . n A 1 185 ARG 185 682 682 ARG ARG A . n A 1 186 VAL 186 683 683 VAL VAL A . n A 1 187 GLY 187 684 684 GLY GLY A . n A 1 188 GLY 188 685 685 GLY GLY A . n A 1 189 ARG 189 686 686 ARG ARG A . n A 1 190 THR 190 687 687 THR THR A . n A 1 191 MET 191 688 688 MET MET A . n A 1 192 LEU 192 689 689 LEU LEU A . n A 1 193 PRO 193 690 690 PRO PRO A . n A 1 194 ILE 194 691 691 ILE ILE A . n A 1 195 ARG 195 692 692 ARG ARG A . n A 1 196 TRP 196 693 693 TRP TRP A . n A 1 197 MET 197 694 694 MET MET A . n A 1 198 PRO 198 695 695 PRO PRO A . n A 1 199 PRO 199 696 696 PRO PRO A . n A 1 200 GLU 200 697 697 GLU GLU A . n A 1 201 SER 201 698 698 SER SER A . n A 1 202 ILE 202 699 699 ILE ILE A . n A 1 203 LEU 203 700 700 LEU LEU A . n A 1 204 TYR 204 701 701 TYR TYR A . n A 1 205 ARG 205 702 702 ARG ARG A . n A 1 206 LYS 206 703 703 LYS LYS A . n A 1 207 PHE 207 704 704 PHE PHE A . n A 1 208 THR 208 705 705 THR THR A . n A 1 209 THR 209 706 706 THR THR A . n A 1 210 GLU 210 707 707 GLU GLU A . n A 1 211 SER 211 708 708 SER SER A . n A 1 212 ASP 212 709 709 ASP ASP A . n A 1 213 VAL 213 710 710 VAL VAL A . n A 1 214 TRP 214 711 711 TRP TRP A . n A 1 215 SER 215 712 712 SER SER A . n A 1 216 PHE 216 713 713 PHE PHE A . n A 1 217 GLY 217 714 714 GLY GLY A . n A 1 218 VAL 218 715 715 VAL VAL A . n A 1 219 VAL 219 716 716 VAL VAL A . n A 1 220 LEU 220 717 717 LEU LEU A . n A 1 221 TRP 221 718 718 TRP TRP A . n A 1 222 GLU 222 719 719 GLU GLU A . n A 1 223 ILE 223 720 720 ILE ILE A . n A 1 224 PHE 224 721 721 PHE PHE A . n A 1 225 THR 225 722 722 THR THR A . n A 1 226 TYR 226 723 723 TYR TYR A . n A 1 227 GLY 227 724 724 GLY GLY A . n A 1 228 LYS 228 725 725 LYS LYS A . n A 1 229 GLN 229 726 726 GLN GLN A . n A 1 230 PRO 230 727 727 PRO PRO A . n A 1 231 TRP 231 728 728 TRP TRP A . n A 1 232 TYR 232 729 729 TYR TYR A . n A 1 233 GLN 233 730 730 GLN GLN A . n A 1 234 LEU 234 731 731 LEU LEU A . n A 1 235 SER 235 732 732 SER SER A . n A 1 236 ASN 236 733 733 ASN ASN A . n A 1 237 THR 237 734 734 THR THR A . n A 1 238 GLU 238 735 735 GLU GLU A . n A 1 239 ALA 239 736 736 ALA ALA A . n A 1 240 ILE 240 737 737 ILE ILE A . n A 1 241 ASP 241 738 738 ASP ASP A . n A 1 242 CYS 242 739 739 CYS CYS A . n A 1 243 ILE 243 740 740 ILE ILE A . n A 1 244 THR 244 741 741 THR THR A . n A 1 245 GLN 245 742 742 GLN GLN A . n A 1 246 GLY 246 743 743 GLY GLY A . n A 1 247 ARG 247 744 744 ARG ARG A . n A 1 248 GLU 248 745 745 GLU GLU A . n A 1 249 LEU 249 746 746 LEU LEU A . n A 1 250 GLU 250 747 747 GLU GLU A . n A 1 251 ARG 251 748 748 ARG ARG A . n A 1 252 PRO 252 749 749 PRO PRO A . n A 1 253 ARG 253 750 750 ARG ARG A . n A 1 254 ALA 254 751 751 ALA ALA A . n A 1 255 CYS 255 752 752 CYS CYS A . n A 1 256 PRO 256 753 753 PRO PRO A . n A 1 257 PRO 257 754 754 PRO PRO A . n A 1 258 GLU 258 755 755 GLU GLU A . n A 1 259 VAL 259 756 756 VAL VAL A . n A 1 260 TYR 260 757 757 TYR TYR A . n A 1 261 ALA 261 758 758 ALA ALA A . n A 1 262 ILE 262 759 759 ILE ILE A . n A 1 263 MET 263 760 760 MET MET A . n A 1 264 ARG 264 761 761 ARG ARG A . n A 1 265 GLY 265 762 762 GLY GLY A . n A 1 266 CYS 266 763 763 CYS CYS A . n A 1 267 TRP 267 764 764 TRP TRP A . n A 1 268 GLN 268 765 765 GLN GLN A . n A 1 269 ARG 269 766 766 ARG ARG A . n A 1 270 GLU 270 767 767 GLU GLU A . n A 1 271 PRO 271 768 768 PRO PRO A . n A 1 272 GLN 272 769 769 GLN GLN A . n A 1 273 GLN 273 770 770 GLN GLN A . n A 1 274 ARG 274 771 771 ARG ARG A . n A 1 275 HIS 275 772 772 HIS HIS A . n A 1 276 SER 276 773 773 SER SER A . n A 1 277 ILE 277 774 774 ILE ILE A . n A 1 278 LYS 278 775 775 LYS LYS A . n A 1 279 ASP 279 776 776 ASP ASP A . n A 1 280 VAL 280 777 777 VAL VAL A . n A 1 281 HIS 281 778 778 HIS HIS A . n A 1 282 ALA 282 779 779 ALA ALA A . n A 1 283 ARG 283 780 780 ARG ARG A . n A 1 284 LEU 284 781 781 LEU LEU A . n A 1 285 GLN 285 782 782 GLN GLN A . n A 1 286 ALA 286 783 783 ALA ALA A . n A 1 287 LEU 287 784 784 LEU LEU A . n A 1 288 ALA 288 785 785 ALA ALA A . n A 1 289 GLN 289 786 786 GLN GLN A . n A 1 290 ALA 290 787 787 ALA ALA A . n A 1 291 PRO 291 788 788 PRO PRO A . n A 1 292 PRO 292 789 789 PRO PRO A . n A 1 293 VAL 293 790 790 VAL VAL A . n A 1 294 TYR 294 791 791 TYR TYR A . n A 1 295 LEU 295 792 792 LEU LEU A . n A 1 296 ASP 296 793 793 ASP ASP A . n A 1 297 VAL 297 794 794 VAL VAL A . n A 1 298 LEU 298 795 795 LEU LEU A . n A 1 299 GLY 299 796 796 GLY GLY A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email 13632107756@163.com _pdbx_contact_author.name_first Zhi-Min _pdbx_contact_author.name_last Zhang _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-5088-5869 # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id FKT _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 801 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id FKT _pdbx_nonpoly_scheme.auth_mon_id LIG _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 13870 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-06-01 2 'Structure model' 1 1 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y,x-y,z+1/3 3 -x+y,-x,z+2/3 4 -y,-x,-z+2/3 5 -x+y,y,-z+1/3 6 x,x-y,-z # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692+SVN 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? CrysalisPro ? ? ? 1.9_1692+SVN 2 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? CrysalisPro ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 7XAF _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 513 ? ? -93.05 -63.43 2 1 LYS A 547 ? ? -105.37 77.53 3 1 GLU A 581 ? ? -94.80 44.10 4 1 ASN A 655 ? ? -99.77 32.66 5 1 ASP A 668 ? ? 74.79 177.08 6 1 PHE A 669 ? ? 49.53 -82.18 7 1 THR A 687 ? ? 123.99 130.13 8 1 LEU A 700 ? ? -79.42 -72.91 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 ASP _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 668 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 PHE _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 669 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -31.70 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 506 ? CG ? A LYS 9 CG 2 1 Y 1 A LYS 506 ? CD ? A LYS 9 CD 3 1 Y 1 A LYS 506 ? CE ? A LYS 9 CE 4 1 Y 1 A LYS 506 ? NZ ? A LYS 9 NZ 5 1 Y 1 A ARG 507 ? CG ? A ARG 10 CG 6 1 Y 1 A ARG 507 ? CD ? A ARG 10 CD 7 1 Y 1 A ARG 507 ? NE ? A ARG 10 NE 8 1 Y 1 A ARG 507 ? CZ ? A ARG 10 CZ 9 1 Y 1 A ARG 507 ? NH1 ? A ARG 10 NH1 10 1 Y 1 A ARG 507 ? NH2 ? A ARG 10 NH2 11 1 Y 1 A ARG 508 ? CG ? A ARG 11 CG 12 1 Y 1 A ARG 508 ? CD ? A ARG 11 CD 13 1 Y 1 A ARG 508 ? NE ? A ARG 11 NE 14 1 Y 1 A ARG 508 ? CZ ? A ARG 11 CZ 15 1 Y 1 A ARG 508 ? NH1 ? A ARG 11 NH1 16 1 Y 1 A ARG 508 ? NH2 ? A ARG 11 NH2 17 1 Y 1 A LYS 547 ? CG ? A LYS 50 CG 18 1 Y 1 A LYS 547 ? CD ? A LYS 50 CD 19 1 Y 1 A LYS 547 ? CE ? A LYS 50 CE 20 1 Y 1 A LYS 547 ? NZ ? A LYS 50 NZ 21 1 Y 1 A ARG 554 ? CG ? A ARG 57 CG 22 1 Y 1 A ARG 554 ? CD ? A ARG 57 CD 23 1 Y 1 A ARG 554 ? NE ? A ARG 57 NE 24 1 Y 1 A ARG 554 ? CZ ? A ARG 57 CZ 25 1 Y 1 A ARG 554 ? NH1 ? A ARG 57 NH1 26 1 Y 1 A ARG 554 ? NH2 ? A ARG 57 NH2 27 1 Y 1 A GLN 558 ? CG ? A GLN 61 CG 28 1 Y 1 A GLN 558 ? CD ? A GLN 61 CD 29 1 Y 1 A GLN 558 ? OE1 ? A GLN 61 OE1 30 1 Y 1 A GLN 558 ? NE2 ? A GLN 61 NE2 31 1 Y 1 A ARG 559 ? CG ? A ARG 62 CG 32 1 Y 1 A ARG 559 ? CD ? A ARG 62 CD 33 1 Y 1 A ARG 559 ? NE ? A ARG 62 NE 34 1 Y 1 A ARG 559 ? CZ ? A ARG 62 CZ 35 1 Y 1 A ARG 559 ? NH1 ? A ARG 62 NH1 36 1 Y 1 A ARG 559 ? NH2 ? A ARG 62 NH2 37 1 Y 1 A GLN 568 ? CG ? A GLN 71 CG 38 1 Y 1 A GLN 568 ? CD ? A GLN 71 CD 39 1 Y 1 A GLN 568 ? OE1 ? A GLN 71 OE1 40 1 Y 1 A GLN 568 ? NE2 ? A GLN 71 NE2 41 1 Y 1 A ARG 593 ? CZ ? A ARG 96 CZ 42 1 Y 1 A ARG 593 ? NH1 ? A ARG 96 NH1 43 1 Y 1 A ARG 593 ? NH2 ? A ARG 96 NH2 44 1 Y 1 A LYS 609 ? CG ? A LYS 112 CG 45 1 Y 1 A LYS 609 ? CD ? A LYS 112 CD 46 1 Y 1 A LYS 609 ? CE ? A LYS 112 CE 47 1 Y 1 A LYS 609 ? NZ ? A LYS 112 NZ 48 1 Y 1 A ASP 668 ? CG ? A ASP 171 CG 49 1 Y 1 A ASP 668 ? OD1 ? A ASP 171 OD1 50 1 Y 1 A ASP 668 ? OD2 ? A ASP 171 OD2 51 1 Y 1 A MET 671 ? CG ? A MET 174 CG 52 1 Y 1 A MET 671 ? SD ? A MET 174 SD 53 1 Y 1 A MET 671 ? CE ? A MET 174 CE 54 1 Y 1 A ARG 702 ? CG ? A ARG 205 CG 55 1 Y 1 A ARG 702 ? CD ? A ARG 205 CD 56 1 Y 1 A ARG 702 ? NE ? A ARG 205 NE 57 1 Y 1 A ARG 702 ? CZ ? A ARG 205 CZ 58 1 Y 1 A ARG 702 ? NH1 ? A ARG 205 NH1 59 1 Y 1 A ARG 702 ? NH2 ? A ARG 205 NH2 60 1 Y 1 A LYS 703 ? CG ? A LYS 206 CG 61 1 Y 1 A LYS 703 ? CD ? A LYS 206 CD 62 1 Y 1 A LYS 703 ? CE ? A LYS 206 CE 63 1 Y 1 A LYS 703 ? NZ ? A LYS 206 NZ 64 1 Y 1 A GLU 767 ? CG ? A GLU 270 CG 65 1 Y 1 A GLU 767 ? CD ? A GLU 270 CD 66 1 Y 1 A GLU 767 ? OE1 ? A GLU 270 OE1 67 1 Y 1 A GLU 767 ? OE2 ? A GLU 270 OE2 68 1 Y 1 A GLN 770 ? CG ? A GLN 273 CG 69 1 Y 1 A GLN 770 ? CD ? A GLN 273 CD 70 1 Y 1 A GLN 770 ? OE1 ? A GLN 273 OE1 71 1 Y 1 A GLN 770 ? NE2 ? A GLN 273 NE2 72 1 Y 1 A LYS 775 ? CG ? A LYS 278 CG 73 1 Y 1 A LYS 775 ? CD ? A LYS 278 CD 74 1 Y 1 A LYS 775 ? CE ? A LYS 278 CE 75 1 Y 1 A LYS 775 ? NZ ? A LYS 278 NZ 76 1 Y 1 A GLY 796 ? CA ? A GLY 299 CA 77 1 Y 1 A GLY 796 ? C ? A GLY 299 C 78 1 Y 1 A GLY 796 ? O ? A GLY 299 O # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 532 ? A LEU 35 2 1 Y 1 A LEU 533 ? A LEU 36 3 1 Y 1 A PRO 534 ? A PRO 37 4 1 Y 1 A GLU 535 ? A GLU 38 5 1 Y 1 A GLN 536 ? A GLN 39 6 1 Y 1 A ASP 537 ? A ASP 40 7 1 Y 1 A ALA 549 ? A ALA 52 8 1 Y 1 A SER 550 ? A SER 53 9 1 Y 1 A GLU 551 ? A GLU 54 10 1 Y 1 A SER 552 ? A SER 55 11 1 Y 1 A LEU 610 ? A LEU 113 12 1 Y 1 A LEU 611 ? A LEU 114 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FKT C13 C Y N 88 FKT C15 C Y N 89 FKT C17 C Y N 90 FKT C20 C N N 91 FKT C21 C N N 92 FKT C22 C N N 93 FKT C24 C N N 94 FKT C26 C N N 95 FKT C28 C N N 96 FKT C01 C N N 97 FKT N02 N N N 98 FKT N03 N Y N 99 FKT C04 C Y N 100 FKT C05 C N N 101 FKT C06 C N N 102 FKT C07 C Y N 103 FKT C08 C Y N 104 FKT N09 N Y N 105 FKT N10 N N N 106 FKT C11 C N N 107 FKT C12 C N N 108 FKT C14 C Y N 109 FKT C16 C Y N 110 FKT C18 C Y N 111 FKT O19 O N N 112 FKT C23 C N N 113 FKT N25 N N N 114 FKT C27 C N N 115 FKT C29 C N N 116 FKT O30 O N N 117 FKT C31 C N N 118 FKT N32 N N N 119 FKT O33 O N N 120 FKT C34 C Y N 121 FKT C35 C Y N 122 FKT C36 C Y N 123 FKT C37 C Y N 124 FKT C38 C Y N 125 FKT C39 C Y N 126 FKT N40 N Y N 127 FKT C41 C Y N 128 FKT C42 C Y N 129 FKT N43 N Y N 130 FKT C44 C Y N 131 FKT C45 C N N 132 FKT C46 C N N 133 FKT F47 F N N 134 FKT F48 F N N 135 FKT F49 F N N 136 FKT H1 H N N 137 FKT H2 H N N 138 FKT H3 H N N 139 FKT H4 H N N 140 FKT H5 H N N 141 FKT H6 H N N 142 FKT H7 H N N 143 FKT H8 H N N 144 FKT H9 H N N 145 FKT H10 H N N 146 FKT H11 H N N 147 FKT H12 H N N 148 FKT H13 H N N 149 FKT H14 H N N 150 FKT H15 H N N 151 FKT H16 H N N 152 FKT H17 H N N 153 FKT H18 H N N 154 FKT H19 H N N 155 FKT H20 H N N 156 FKT H21 H N N 157 FKT H22 H N N 158 FKT H23 H N N 159 FKT H24 H N N 160 FKT H25 H N N 161 FKT H26 H N N 162 FKT H27 H N N 163 FKT H28 H N N 164 FKT H29 H N N 165 FKT H30 H N N 166 FKT H31 H N N 167 FKT H32 H N N 168 FKT H33 H N N 169 GLN N N N N 170 GLN CA C N S 171 GLN C C N N 172 GLN O O N N 173 GLN CB C N N 174 GLN CG C N N 175 GLN CD C N N 176 GLN OE1 O N N 177 GLN NE2 N N N 178 GLN OXT O N N 179 GLN H H N N 180 GLN H2 H N N 181 GLN HA H N N 182 GLN HB2 H N N 183 GLN HB3 H N N 184 GLN HG2 H N N 185 GLN HG3 H N N 186 GLN HE21 H N N 187 GLN HE22 H N N 188 GLN HXT H N N 189 GLU N N N N 190 GLU CA C N S 191 GLU C C N N 192 GLU O O N N 193 GLU CB C N N 194 GLU CG C N N 195 GLU CD C N N 196 GLU OE1 O N N 197 GLU OE2 O N N 198 GLU OXT O N N 199 GLU H H N N 200 GLU H2 H N N 201 GLU HA H N N 202 GLU HB2 H N N 203 GLU HB3 H N N 204 GLU HG2 H N N 205 GLU HG3 H N N 206 GLU HE2 H N N 207 GLU HXT H N N 208 GLY N N N N 209 GLY CA C N N 210 GLY C C N N 211 GLY O O N N 212 GLY OXT O N N 213 GLY H H N N 214 GLY H2 H N N 215 GLY HA2 H N N 216 GLY HA3 H N N 217 GLY HXT H N N 218 HIS N N N N 219 HIS CA C N S 220 HIS C C N N 221 HIS O O N N 222 HIS CB C N N 223 HIS CG C Y N 224 HIS ND1 N Y N 225 HIS CD2 C Y N 226 HIS CE1 C Y N 227 HIS NE2 N Y N 228 HIS OXT O N N 229 HIS H H N N 230 HIS H2 H N N 231 HIS HA H N N 232 HIS HB2 H N N 233 HIS HB3 H N N 234 HIS HD1 H N N 235 HIS HD2 H N N 236 HIS HE1 H N N 237 HIS HE2 H N N 238 HIS HXT H N N 239 ILE N N N N 240 ILE CA C N S 241 ILE C C N N 242 ILE O O N N 243 ILE CB C N S 244 ILE CG1 C N N 245 ILE CG2 C N N 246 ILE CD1 C N N 247 ILE OXT O N N 248 ILE H H N N 249 ILE H2 H N N 250 ILE HA H N N 251 ILE HB H N N 252 ILE HG12 H N N 253 ILE HG13 H N N 254 ILE HG21 H N N 255 ILE HG22 H N N 256 ILE HG23 H N N 257 ILE HD11 H N N 258 ILE HD12 H N N 259 ILE HD13 H N N 260 ILE HXT H N N 261 LEU N N N N 262 LEU CA C N S 263 LEU C C N N 264 LEU O O N N 265 LEU CB C N N 266 LEU CG C N N 267 LEU CD1 C N N 268 LEU CD2 C N N 269 LEU OXT O N N 270 LEU H H N N 271 LEU H2 H N N 272 LEU HA H N N 273 LEU HB2 H N N 274 LEU HB3 H N N 275 LEU HG H N N 276 LEU HD11 H N N 277 LEU HD12 H N N 278 LEU HD13 H N N 279 LEU HD21 H N N 280 LEU HD22 H N N 281 LEU HD23 H N N 282 LEU HXT H N N 283 LYS N N N N 284 LYS CA C N S 285 LYS C C N N 286 LYS O O N N 287 LYS CB C N N 288 LYS CG C N N 289 LYS CD C N N 290 LYS CE C N N 291 LYS NZ N N N 292 LYS OXT O N N 293 LYS H H N N 294 LYS H2 H N N 295 LYS HA H N N 296 LYS HB2 H N N 297 LYS HB3 H N N 298 LYS HG2 H N N 299 LYS HG3 H N N 300 LYS HD2 H N N 301 LYS HD3 H N N 302 LYS HE2 H N N 303 LYS HE3 H N N 304 LYS HZ1 H N N 305 LYS HZ2 H N N 306 LYS HZ3 H N N 307 LYS HXT H N N 308 MET N N N N 309 MET CA C N S 310 MET C C N N 311 MET O O N N 312 MET CB C N N 313 MET CG C N N 314 MET SD S N N 315 MET CE C N N 316 MET OXT O N N 317 MET H H N N 318 MET H2 H N N 319 MET HA H N N 320 MET HB2 H N N 321 MET HB3 H N N 322 MET HG2 H N N 323 MET HG3 H N N 324 MET HE1 H N N 325 MET HE2 H N N 326 MET HE3 H N N 327 MET HXT H N N 328 PHE N N N N 329 PHE CA C N S 330 PHE C C N N 331 PHE O O N N 332 PHE CB C N N 333 PHE CG C Y N 334 PHE CD1 C Y N 335 PHE CD2 C Y N 336 PHE CE1 C Y N 337 PHE CE2 C Y N 338 PHE CZ C Y N 339 PHE OXT O N N 340 PHE H H N N 341 PHE H2 H N N 342 PHE HA H N N 343 PHE HB2 H N N 344 PHE HB3 H N N 345 PHE HD1 H N N 346 PHE HD2 H N N 347 PHE HE1 H N N 348 PHE HE2 H N N 349 PHE HZ H N N 350 PHE HXT H N N 351 PRO N N N N 352 PRO CA C N S 353 PRO C C N N 354 PRO O O N N 355 PRO CB C N N 356 PRO CG C N N 357 PRO CD C N N 358 PRO OXT O N N 359 PRO H H N N 360 PRO HA H N N 361 PRO HB2 H N N 362 PRO HB3 H N N 363 PRO HG2 H N N 364 PRO HG3 H N N 365 PRO HD2 H N N 366 PRO HD3 H N N 367 PRO HXT H N N 368 SER N N N N 369 SER CA C N S 370 SER C C N N 371 SER O O N N 372 SER CB C N N 373 SER OG O N N 374 SER OXT O N N 375 SER H H N N 376 SER H2 H N N 377 SER HA H N N 378 SER HB2 H N N 379 SER HB3 H N N 380 SER HG H N N 381 SER HXT H N N 382 THR N N N N 383 THR CA C N S 384 THR C C N N 385 THR O O N N 386 THR CB C N R 387 THR OG1 O N N 388 THR CG2 C N N 389 THR OXT O N N 390 THR H H N N 391 THR H2 H N N 392 THR HA H N N 393 THR HB H N N 394 THR HG1 H N N 395 THR HG21 H N N 396 THR HG22 H N N 397 THR HG23 H N N 398 THR HXT H N N 399 TRP N N N N 400 TRP CA C N S 401 TRP C C N N 402 TRP O O N N 403 TRP CB C N N 404 TRP CG C Y N 405 TRP CD1 C Y N 406 TRP CD2 C Y N 407 TRP NE1 N Y N 408 TRP CE2 C Y N 409 TRP CE3 C Y N 410 TRP CZ2 C Y N 411 TRP CZ3 C Y N 412 TRP CH2 C Y N 413 TRP OXT O N N 414 TRP H H N N 415 TRP H2 H N N 416 TRP HA H N N 417 TRP HB2 H N N 418 TRP HB3 H N N 419 TRP HD1 H N N 420 TRP HE1 H N N 421 TRP HE3 H N N 422 TRP HZ2 H N N 423 TRP HZ3 H N N 424 TRP HH2 H N N 425 TRP HXT H N N 426 TYR N N N N 427 TYR CA C N S 428 TYR C C N N 429 TYR O O N N 430 TYR CB C N N 431 TYR CG C Y N 432 TYR CD1 C Y N 433 TYR CD2 C Y N 434 TYR CE1 C Y N 435 TYR CE2 C Y N 436 TYR CZ C Y N 437 TYR OH O N N 438 TYR OXT O N N 439 TYR H H N N 440 TYR H2 H N N 441 TYR HA H N N 442 TYR HB2 H N N 443 TYR HB3 H N N 444 TYR HD1 H N N 445 TYR HD2 H N N 446 TYR HE1 H N N 447 TYR HE2 H N N 448 TYR HH H N N 449 TYR HXT H N N 450 VAL N N N N 451 VAL CA C N S 452 VAL C C N N 453 VAL O O N N 454 VAL CB C N N 455 VAL CG1 C N N 456 VAL CG2 C N N 457 VAL OXT O N N 458 VAL H H N N 459 VAL H2 H N N 460 VAL HA H N N 461 VAL HB H N N 462 VAL HG11 H N N 463 VAL HG12 H N N 464 VAL HG13 H N N 465 VAL HG21 H N N 466 VAL HG22 H N N 467 VAL HG23 H N N 468 VAL HXT H N N 469 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 FKT C45 C42 sing N N 83 FKT C42 N43 sing Y N 84 FKT C42 C41 doub Y N 85 FKT N43 C44 doub Y N 86 FKT C41 N40 sing Y N 87 FKT C44 N40 sing Y N 88 FKT N40 C36 sing N N 89 FKT C36 C37 doub Y N 90 FKT C36 C35 sing Y N 91 FKT C37 C38 sing Y N 92 FKT F48 C46 sing N N 93 FKT C35 C34 doub Y N 94 FKT F49 C46 sing N N 95 FKT C38 C46 sing N N 96 FKT C38 C39 doub Y N 97 FKT C46 F47 sing N N 98 FKT C34 C39 sing Y N 99 FKT C34 N32 sing N N 100 FKT N32 C22 sing N N 101 FKT C22 O33 doub N N 102 FKT C22 C17 sing N N 103 FKT C16 C17 doub Y N 104 FKT C16 C15 sing Y N 105 FKT C17 C18 sing Y N 106 FKT O19 C15 sing N N 107 FKT O19 C20 sing N N 108 FKT C15 C14 doub Y N 109 FKT C26 C20 sing N N 110 FKT C26 C27 sing N N 111 FKT C18 C21 sing N N 112 FKT C18 C13 doub Y N 113 FKT C27 C28 sing N N 114 FKT C14 C13 sing Y N 115 FKT C13 C12 sing N N 116 FKT C28 C29 sing N N 117 FKT O30 C29 doub N N 118 FKT C12 C11 trip N N 119 FKT C29 N25 sing N N 120 FKT C11 C07 sing N N 121 FKT N25 C23 sing N N 122 FKT C23 C24 sing N N 123 FKT C07 C08 doub Y N 124 FKT C07 N03 sing Y N 125 FKT C24 N10 sing N N 126 FKT N02 N03 sing N N 127 FKT N02 C01 doub N N 128 FKT C08 N09 sing Y N 129 FKT N03 C04 sing Y N 130 FKT N10 C31 sing N N 131 FKT N10 C01 sing N N 132 FKT C01 C06 sing N N 133 FKT N09 C04 doub Y N 134 FKT C04 C05 sing N N 135 FKT C06 C05 doub N N 136 FKT C20 H1 sing N N 137 FKT C20 H2 sing N N 138 FKT C21 H3 sing N N 139 FKT C21 H4 sing N N 140 FKT C21 H5 sing N N 141 FKT C24 H6 sing N N 142 FKT C24 H7 sing N N 143 FKT C26 H8 sing N N 144 FKT C26 H9 sing N N 145 FKT C28 H10 sing N N 146 FKT C28 H11 sing N N 147 FKT C05 H12 sing N N 148 FKT C06 H13 sing N N 149 FKT C08 H14 sing N N 150 FKT C14 H15 sing N N 151 FKT C16 H16 sing N N 152 FKT C23 H17 sing N N 153 FKT C23 H18 sing N N 154 FKT N25 H19 sing N N 155 FKT C27 H20 sing N N 156 FKT C27 H21 sing N N 157 FKT C31 H22 sing N N 158 FKT C31 H23 sing N N 159 FKT C31 H24 sing N N 160 FKT N32 H25 sing N N 161 FKT C35 H26 sing N N 162 FKT C37 H27 sing N N 163 FKT C39 H28 sing N N 164 FKT C41 H29 sing N N 165 FKT C44 H30 sing N N 166 FKT C45 H31 sing N N 167 FKT C45 H32 sing N N 168 FKT C45 H33 sing N N 169 GLN N CA sing N N 170 GLN N H sing N N 171 GLN N H2 sing N N 172 GLN CA C sing N N 173 GLN CA CB sing N N 174 GLN CA HA sing N N 175 GLN C O doub N N 176 GLN C OXT sing N N 177 GLN CB CG sing N N 178 GLN CB HB2 sing N N 179 GLN CB HB3 sing N N 180 GLN CG CD sing N N 181 GLN CG HG2 sing N N 182 GLN CG HG3 sing N N 183 GLN CD OE1 doub N N 184 GLN CD NE2 sing N N 185 GLN NE2 HE21 sing N N 186 GLN NE2 HE22 sing N N 187 GLN OXT HXT sing N N 188 GLU N CA sing N N 189 GLU N H sing N N 190 GLU N H2 sing N N 191 GLU CA C sing N N 192 GLU CA CB sing N N 193 GLU CA HA sing N N 194 GLU C O doub N N 195 GLU C OXT sing N N 196 GLU CB CG sing N N 197 GLU CB HB2 sing N N 198 GLU CB HB3 sing N N 199 GLU CG CD sing N N 200 GLU CG HG2 sing N N 201 GLU CG HG3 sing N N 202 GLU CD OE1 doub N N 203 GLU CD OE2 sing N N 204 GLU OE2 HE2 sing N N 205 GLU OXT HXT sing N N 206 GLY N CA sing N N 207 GLY N H sing N N 208 GLY N H2 sing N N 209 GLY CA C sing N N 210 GLY CA HA2 sing N N 211 GLY CA HA3 sing N N 212 GLY C O doub N N 213 GLY C OXT sing N N 214 GLY OXT HXT sing N N 215 HIS N CA sing N N 216 HIS N H sing N N 217 HIS N H2 sing N N 218 HIS CA C sing N N 219 HIS CA CB sing N N 220 HIS CA HA sing N N 221 HIS C O doub N N 222 HIS C OXT sing N N 223 HIS CB CG sing N N 224 HIS CB HB2 sing N N 225 HIS CB HB3 sing N N 226 HIS CG ND1 sing Y N 227 HIS CG CD2 doub Y N 228 HIS ND1 CE1 doub Y N 229 HIS ND1 HD1 sing N N 230 HIS CD2 NE2 sing Y N 231 HIS CD2 HD2 sing N N 232 HIS CE1 NE2 sing Y N 233 HIS CE1 HE1 sing N N 234 HIS NE2 HE2 sing N N 235 HIS OXT HXT sing N N 236 ILE N CA sing N N 237 ILE N H sing N N 238 ILE N H2 sing N N 239 ILE CA C sing N N 240 ILE CA CB sing N N 241 ILE CA HA sing N N 242 ILE C O doub N N 243 ILE C OXT sing N N 244 ILE CB CG1 sing N N 245 ILE CB CG2 sing N N 246 ILE CB HB sing N N 247 ILE CG1 CD1 sing N N 248 ILE CG1 HG12 sing N N 249 ILE CG1 HG13 sing N N 250 ILE CG2 HG21 sing N N 251 ILE CG2 HG22 sing N N 252 ILE CG2 HG23 sing N N 253 ILE CD1 HD11 sing N N 254 ILE CD1 HD12 sing N N 255 ILE CD1 HD13 sing N N 256 ILE OXT HXT sing N N 257 LEU N CA sing N N 258 LEU N H sing N N 259 LEU N H2 sing N N 260 LEU CA C sing N N 261 LEU CA CB sing N N 262 LEU CA HA sing N N 263 LEU C O doub N N 264 LEU C OXT sing N N 265 LEU CB CG sing N N 266 LEU CB HB2 sing N N 267 LEU CB HB3 sing N N 268 LEU CG CD1 sing N N 269 LEU CG CD2 sing N N 270 LEU CG HG sing N N 271 LEU CD1 HD11 sing N N 272 LEU CD1 HD12 sing N N 273 LEU CD1 HD13 sing N N 274 LEU CD2 HD21 sing N N 275 LEU CD2 HD22 sing N N 276 LEU CD2 HD23 sing N N 277 LEU OXT HXT sing N N 278 LYS N CA sing N N 279 LYS N H sing N N 280 LYS N H2 sing N N 281 LYS CA C sing N N 282 LYS CA CB sing N N 283 LYS CA HA sing N N 284 LYS C O doub N N 285 LYS C OXT sing N N 286 LYS CB CG sing N N 287 LYS CB HB2 sing N N 288 LYS CB HB3 sing N N 289 LYS CG CD sing N N 290 LYS CG HG2 sing N N 291 LYS CG HG3 sing N N 292 LYS CD CE sing N N 293 LYS CD HD2 sing N N 294 LYS CD HD3 sing N N 295 LYS CE NZ sing N N 296 LYS CE HE2 sing N N 297 LYS CE HE3 sing N N 298 LYS NZ HZ1 sing N N 299 LYS NZ HZ2 sing N N 300 LYS NZ HZ3 sing N N 301 LYS OXT HXT sing N N 302 MET N CA sing N N 303 MET N H sing N N 304 MET N H2 sing N N 305 MET CA C sing N N 306 MET CA CB sing N N 307 MET CA HA sing N N 308 MET C O doub N N 309 MET C OXT sing N N 310 MET CB CG sing N N 311 MET CB HB2 sing N N 312 MET CB HB3 sing N N 313 MET CG SD sing N N 314 MET CG HG2 sing N N 315 MET CG HG3 sing N N 316 MET SD CE sing N N 317 MET CE HE1 sing N N 318 MET CE HE2 sing N N 319 MET CE HE3 sing N N 320 MET OXT HXT sing N N 321 PHE N CA sing N N 322 PHE N H sing N N 323 PHE N H2 sing N N 324 PHE CA C sing N N 325 PHE CA CB sing N N 326 PHE CA HA sing N N 327 PHE C O doub N N 328 PHE C OXT sing N N 329 PHE CB CG sing N N 330 PHE CB HB2 sing N N 331 PHE CB HB3 sing N N 332 PHE CG CD1 doub Y N 333 PHE CG CD2 sing Y N 334 PHE CD1 CE1 sing Y N 335 PHE CD1 HD1 sing N N 336 PHE CD2 CE2 doub Y N 337 PHE CD2 HD2 sing N N 338 PHE CE1 CZ doub Y N 339 PHE CE1 HE1 sing N N 340 PHE CE2 CZ sing Y N 341 PHE CE2 HE2 sing N N 342 PHE CZ HZ sing N N 343 PHE OXT HXT sing N N 344 PRO N CA sing N N 345 PRO N CD sing N N 346 PRO N H sing N N 347 PRO CA C sing N N 348 PRO CA CB sing N N 349 PRO CA HA sing N N 350 PRO C O doub N N 351 PRO C OXT sing N N 352 PRO CB CG sing N N 353 PRO CB HB2 sing N N 354 PRO CB HB3 sing N N 355 PRO CG CD sing N N 356 PRO CG HG2 sing N N 357 PRO CG HG3 sing N N 358 PRO CD HD2 sing N N 359 PRO CD HD3 sing N N 360 PRO OXT HXT sing N N 361 SER N CA sing N N 362 SER N H sing N N 363 SER N H2 sing N N 364 SER CA C sing N N 365 SER CA CB sing N N 366 SER CA HA sing N N 367 SER C O doub N N 368 SER C OXT sing N N 369 SER CB OG sing N N 370 SER CB HB2 sing N N 371 SER CB HB3 sing N N 372 SER OG HG sing N N 373 SER OXT HXT sing N N 374 THR N CA sing N N 375 THR N H sing N N 376 THR N H2 sing N N 377 THR CA C sing N N 378 THR CA CB sing N N 379 THR CA HA sing N N 380 THR C O doub N N 381 THR C OXT sing N N 382 THR CB OG1 sing N N 383 THR CB CG2 sing N N 384 THR CB HB sing N N 385 THR OG1 HG1 sing N N 386 THR CG2 HG21 sing N N 387 THR CG2 HG22 sing N N 388 THR CG2 HG23 sing N N 389 THR OXT HXT sing N N 390 TRP N CA sing N N 391 TRP N H sing N N 392 TRP N H2 sing N N 393 TRP CA C sing N N 394 TRP CA CB sing N N 395 TRP CA HA sing N N 396 TRP C O doub N N 397 TRP C OXT sing N N 398 TRP CB CG sing N N 399 TRP CB HB2 sing N N 400 TRP CB HB3 sing N N 401 TRP CG CD1 doub Y N 402 TRP CG CD2 sing Y N 403 TRP CD1 NE1 sing Y N 404 TRP CD1 HD1 sing N N 405 TRP CD2 CE2 doub Y N 406 TRP CD2 CE3 sing Y N 407 TRP NE1 CE2 sing Y N 408 TRP NE1 HE1 sing N N 409 TRP CE2 CZ2 sing Y N 410 TRP CE3 CZ3 doub Y N 411 TRP CE3 HE3 sing N N 412 TRP CZ2 CH2 doub Y N 413 TRP CZ2 HZ2 sing N N 414 TRP CZ3 CH2 sing Y N 415 TRP CZ3 HZ3 sing N N 416 TRP CH2 HH2 sing N N 417 TRP OXT HXT sing N N 418 TYR N CA sing N N 419 TYR N H sing N N 420 TYR N H2 sing N N 421 TYR CA C sing N N 422 TYR CA CB sing N N 423 TYR CA HA sing N N 424 TYR C O doub N N 425 TYR C OXT sing N N 426 TYR CB CG sing N N 427 TYR CB HB2 sing N N 428 TYR CB HB3 sing N N 429 TYR CG CD1 doub Y N 430 TYR CG CD2 sing Y N 431 TYR CD1 CE1 sing Y N 432 TYR CD1 HD1 sing N N 433 TYR CD2 CE2 doub Y N 434 TYR CD2 HD2 sing N N 435 TYR CE1 CZ doub Y N 436 TYR CE1 HE1 sing N N 437 TYR CE2 CZ sing Y N 438 TYR CE2 HE2 sing N N 439 TYR CZ OH sing N N 440 TYR OH HH sing N N 441 TYR OXT HXT sing N N 442 VAL N CA sing N N 443 VAL N H sing N N 444 VAL N H2 sing N N 445 VAL CA C sing N N 446 VAL CA CB sing N N 447 VAL CA HA sing N N 448 VAL C O doub N N 449 VAL C OXT sing N N 450 VAL CB CG1 sing N N 451 VAL CB CG2 sing N N 452 VAL CB HB sing N N 453 VAL CG1 HG11 sing N N 454 VAL CG1 HG12 sing N N 455 VAL CG1 HG13 sing N N 456 VAL CG2 HG21 sing N N 457 VAL CG2 HG22 sing N N 458 VAL CG2 HG23 sing N N 459 VAL OXT HXT sing N N 460 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id FKT _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id FKT _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name ;4^6,14-dimethyl-N-(3-(4-methyl-1H-imidazol-1-yl)-5-(trifluoromethyl)phenyl)-10-oxo-5-oxa-11,14-diaza-1(3,6)-imidazo[1,2-b]pyridazina-4(1,3)-benzenacyclo-tetradecaphan-2-yne-45-carboxamide ; _pdbx_entity_nonpoly.comp_id FKT # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5H3Q _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'P 31 1 2' _space_group.name_Hall 'P 31 2 (x,y,z+1/3)' _space_group.IT_number 151 _space_group.crystal_system trigonal _space_group.id 1 #