data_7XCD # _entry.id 7XCD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7XCD pdb_00007xcd 10.2210/pdb7xcd/pdb WWPDB D_1300028530 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-04-26 2 'Structure model' 1 1 2023-11-29 3 'Structure model' 1 2 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' 3 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model 4 3 'Structure model' pdbx_entry_details 5 3 'Structure model' pdbx_modification_feature # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 3 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_pdbx_entry_details.has_protein_modification' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7XCD _pdbx_database_status.recvd_initial_deposition_date 2022-03-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email chenlf@fjnu.edu.cn _pdbx_contact_author.name_first Lifei _pdbx_contact_author.name_last Chen _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-9057-909X # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wu, Y.K.' 1 ? 'Chen, L.F.' 2 ? 'Chen, P.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal Structure of the Disease-Specific Protein of Rice Stripe Virus' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wu, Y.K.' 1 0000-0002-9057-909X primary 'Chen, L.F.' 2 0000-0002-9057-909X # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Disease specific protein' 20850.100 1 ? ? ? ? 2 water nat water 18.015 148 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Non-capsid protein,Putative SP,SP protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)QDVQRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKV HKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFN(MSE)LQPSLGGWITKNFLRHPNR(MSE)SKDQIK(MSE)LLDQIIK (MSE)AKAESSDTEEYEKVWKK(MSE)PTYFESIIQPLLHKT ; _entity_poly.pdbx_seq_one_letter_code_can ;MQDVQRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHI PEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVW KKMPTYFESIIQPLLHKT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 GLN n 1 3 ASP n 1 4 VAL n 1 5 GLN n 1 6 ARG n 1 7 THR n 1 8 ILE n 1 9 GLU n 1 10 VAL n 1 11 SER n 1 12 VAL n 1 13 GLY n 1 14 PRO n 1 15 ILE n 1 16 VAL n 1 17 GLY n 1 18 LEU n 1 19 ASP n 1 20 TYR n 1 21 THR n 1 22 LEU n 1 23 LEU n 1 24 TYR n 1 25 ASP n 1 26 THR n 1 27 LEU n 1 28 PRO n 1 29 GLU n 1 30 THR n 1 31 VAL n 1 32 SER n 1 33 ASP n 1 34 ASN n 1 35 ILE n 1 36 THR n 1 37 LEU n 1 38 PRO n 1 39 ASP n 1 40 LEU n 1 41 LYS n 1 42 ASP n 1 43 PRO n 1 44 GLU n 1 45 ARG n 1 46 VAL n 1 47 THR n 1 48 GLU n 1 49 ASP n 1 50 THR n 1 51 LYS n 1 52 LYS n 1 53 LEU n 1 54 ILE n 1 55 LEU n 1 56 LYS n 1 57 GLY n 1 58 CYS n 1 59 VAL n 1 60 TYR n 1 61 ILE n 1 62 ALA n 1 63 TYR n 1 64 HIS n 1 65 HIS n 1 66 PRO n 1 67 LEU n 1 68 GLU n 1 69 THR n 1 70 ASP n 1 71 THR n 1 72 LEU n 1 73 PHE n 1 74 ILE n 1 75 LYS n 1 76 VAL n 1 77 HIS n 1 78 LYS n 1 79 HIS n 1 80 ILE n 1 81 PRO n 1 82 GLU n 1 83 PHE n 1 84 CYS n 1 85 HIS n 1 86 SER n 1 87 PHE n 1 88 LEU n 1 89 SER n 1 90 HIS n 1 91 LEU n 1 92 LEU n 1 93 GLY n 1 94 GLY n 1 95 GLU n 1 96 ASP n 1 97 ASP n 1 98 ASP n 1 99 ASN n 1 100 ALA n 1 101 LEU n 1 102 ILE n 1 103 ASP n 1 104 ILE n 1 105 GLY n 1 106 LEU n 1 107 PHE n 1 108 PHE n 1 109 ASN n 1 110 MSE n 1 111 LEU n 1 112 GLN n 1 113 PRO n 1 114 SER n 1 115 LEU n 1 116 GLY n 1 117 GLY n 1 118 TRP n 1 119 ILE n 1 120 THR n 1 121 LYS n 1 122 ASN n 1 123 PHE n 1 124 LEU n 1 125 ARG n 1 126 HIS n 1 127 PRO n 1 128 ASN n 1 129 ARG n 1 130 MSE n 1 131 SER n 1 132 LYS n 1 133 ASP n 1 134 GLN n 1 135 ILE n 1 136 LYS n 1 137 MSE n 1 138 LEU n 1 139 LEU n 1 140 ASP n 1 141 GLN n 1 142 ILE n 1 143 ILE n 1 144 LYS n 1 145 MSE n 1 146 ALA n 1 147 LYS n 1 148 ALA n 1 149 GLU n 1 150 SER n 1 151 SER n 1 152 ASP n 1 153 THR n 1 154 GLU n 1 155 GLU n 1 156 TYR n 1 157 GLU n 1 158 LYS n 1 159 VAL n 1 160 TRP n 1 161 LYS n 1 162 LYS n 1 163 MSE n 1 164 PRO n 1 165 THR n 1 166 TYR n 1 167 PHE n 1 168 GLU n 1 169 SER n 1 170 ILE n 1 171 ILE n 1 172 GLN n 1 173 PRO n 1 174 LEU n 1 175 LEU n 1 176 HIS n 1 177 LYS n 1 178 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 178 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SP, sp' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rice stripe tenuivirus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 12331 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 ARG 6 6 6 ARG ARG A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 TYR 24 24 24 TYR TYR A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 THR 30 30 30 THR THR A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 CYS 58 58 58 CYS CYS A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 HIS 64 64 64 HIS HIS A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 THR 71 71 71 THR THR A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 HIS 77 77 77 HIS HIS A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 HIS 79 79 79 HIS HIS A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 PHE 83 83 83 PHE PHE A . n A 1 84 CYS 84 84 84 CYS CYS A . n A 1 85 HIS 85 85 85 HIS HIS A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 HIS 90 90 90 HIS HIS A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 ASN 99 99 99 ASN ASN A . n A 1 100 ALA 100 100 100 ALA ALA A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 ILE 102 102 102 ILE ILE A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 MSE 110 110 110 MSE MSE A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 PRO 113 113 113 PRO PRO A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 TRP 118 118 118 TRP TRP A . n A 1 119 ILE 119 119 119 ILE ILE A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 ASN 122 122 122 ASN ASN A . n A 1 123 PHE 123 123 123 PHE PHE A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 HIS 126 126 126 HIS HIS A . n A 1 127 PRO 127 127 127 PRO PRO A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 ARG 129 129 129 ARG ARG A . n A 1 130 MSE 130 130 130 MSE MSE A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 GLN 134 134 134 GLN GLN A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 MSE 137 137 137 MSE MSE A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 ASP 140 140 140 ASP ASP A . n A 1 141 GLN 141 141 141 GLN GLN A . n A 1 142 ILE 142 142 142 ILE ILE A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 LYS 144 144 144 LYS LYS A . n A 1 145 MSE 145 145 145 MSE MSE A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 LYS 147 147 147 LYS LYS A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 SER 150 150 150 SER SER A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 ASP 152 152 152 ASP ASP A . n A 1 153 THR 153 153 153 THR THR A . n A 1 154 GLU 154 154 154 GLU GLU A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 TYR 156 156 156 TYR TYR A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 VAL 159 159 159 VAL VAL A . n A 1 160 TRP 160 160 160 TRP TRP A . n A 1 161 LYS 161 161 161 LYS LYS A . n A 1 162 LYS 162 162 162 LYS LYS A . n A 1 163 MSE 163 163 163 MSE MSE A . n A 1 164 PRO 164 164 164 PRO PRO A . n A 1 165 THR 165 165 165 THR THR A . n A 1 166 TYR 166 166 166 TYR TYR A . n A 1 167 PHE 167 167 167 PHE PHE A . n A 1 168 GLU 168 168 168 GLU GLU A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 ILE 170 170 170 ILE ILE A . n A 1 171 ILE 171 171 171 ILE ILE A . n A 1 172 GLN 172 172 172 GLN GLN A . n A 1 173 PRO 173 173 173 PRO PRO A . n A 1 174 LEU 174 174 174 LEU LEU A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 HIS 176 176 176 HIS HIS A . n A 1 177 LYS 177 177 177 LYS LYS A . n A 1 178 THR 178 178 178 THR THR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 95 HOH HOH A . B 2 HOH 2 202 41 HOH HOH A . B 2 HOH 3 203 108 HOH HOH A . B 2 HOH 4 204 58 HOH HOH A . B 2 HOH 5 205 43 HOH HOH A . B 2 HOH 6 206 76 HOH HOH A . B 2 HOH 7 207 98 HOH HOH A . B 2 HOH 8 208 123 HOH HOH A . B 2 HOH 9 209 143 HOH HOH A . B 2 HOH 10 210 148 HOH HOH A . B 2 HOH 11 211 21 HOH HOH A . B 2 HOH 12 212 114 HOH HOH A . B 2 HOH 13 213 72 HOH HOH A . B 2 HOH 14 214 6 HOH HOH A . B 2 HOH 15 215 8 HOH HOH A . B 2 HOH 16 216 138 HOH HOH A . B 2 HOH 17 217 4 HOH HOH A . B 2 HOH 18 218 12 HOH HOH A . B 2 HOH 19 219 2 HOH HOH A . B 2 HOH 20 220 119 HOH HOH A . B 2 HOH 21 221 129 HOH HOH A . B 2 HOH 22 222 18 HOH HOH A . B 2 HOH 23 223 1 HOH HOH A . B 2 HOH 24 224 113 HOH HOH A . B 2 HOH 25 225 15 HOH HOH A . B 2 HOH 26 226 27 HOH HOH A . B 2 HOH 27 227 16 HOH HOH A . B 2 HOH 28 228 75 HOH HOH A . B 2 HOH 29 229 89 HOH HOH A . B 2 HOH 30 230 14 HOH HOH A . B 2 HOH 31 231 69 HOH HOH A . B 2 HOH 32 232 52 HOH HOH A . B 2 HOH 33 233 3 HOH HOH A . B 2 HOH 34 234 13 HOH HOH A . B 2 HOH 35 235 31 HOH HOH A . B 2 HOH 36 236 39 HOH HOH A . B 2 HOH 37 237 79 HOH HOH A . B 2 HOH 38 238 38 HOH HOH A . B 2 HOH 39 239 78 HOH HOH A . B 2 HOH 40 240 23 HOH HOH A . B 2 HOH 41 241 53 HOH HOH A . B 2 HOH 42 242 66 HOH HOH A . B 2 HOH 43 243 10 HOH HOH A . B 2 HOH 44 244 112 HOH HOH A . B 2 HOH 45 245 26 HOH HOH A . B 2 HOH 46 246 111 HOH HOH A . B 2 HOH 47 247 57 HOH HOH A . B 2 HOH 48 248 63 HOH HOH A . B 2 HOH 49 249 130 HOH HOH A . B 2 HOH 50 250 25 HOH HOH A . B 2 HOH 51 251 28 HOH HOH A . B 2 HOH 52 252 64 HOH HOH A . B 2 HOH 53 253 126 HOH HOH A . B 2 HOH 54 254 5 HOH HOH A . B 2 HOH 55 255 145 HOH HOH A . B 2 HOH 56 256 17 HOH HOH A . B 2 HOH 57 257 11 HOH HOH A . B 2 HOH 58 258 29 HOH HOH A . B 2 HOH 59 259 20 HOH HOH A . B 2 HOH 60 260 42 HOH HOH A . B 2 HOH 61 261 19 HOH HOH A . B 2 HOH 62 262 92 HOH HOH A . B 2 HOH 63 263 67 HOH HOH A . B 2 HOH 64 264 45 HOH HOH A . B 2 HOH 65 265 61 HOH HOH A . B 2 HOH 66 266 30 HOH HOH A . B 2 HOH 67 267 7 HOH HOH A . B 2 HOH 68 268 40 HOH HOH A . B 2 HOH 69 269 105 HOH HOH A . B 2 HOH 70 270 106 HOH HOH A . B 2 HOH 71 271 55 HOH HOH A . B 2 HOH 72 272 73 HOH HOH A . B 2 HOH 73 273 62 HOH HOH A . B 2 HOH 74 274 102 HOH HOH A . B 2 HOH 75 275 24 HOH HOH A . B 2 HOH 76 276 83 HOH HOH A . B 2 HOH 77 277 68 HOH HOH A . B 2 HOH 78 278 94 HOH HOH A . B 2 HOH 79 279 132 HOH HOH A . B 2 HOH 80 280 59 HOH HOH A . B 2 HOH 81 281 37 HOH HOH A . B 2 HOH 82 282 51 HOH HOH A . B 2 HOH 83 283 71 HOH HOH A . B 2 HOH 84 284 35 HOH HOH A . B 2 HOH 85 285 33 HOH HOH A . B 2 HOH 86 286 56 HOH HOH A . B 2 HOH 87 287 70 HOH HOH A . B 2 HOH 88 288 65 HOH HOH A . B 2 HOH 89 289 36 HOH HOH A . B 2 HOH 90 290 140 HOH HOH A . B 2 HOH 91 291 139 HOH HOH A . B 2 HOH 92 292 110 HOH HOH A . B 2 HOH 93 293 46 HOH HOH A . B 2 HOH 94 294 49 HOH HOH A . B 2 HOH 95 295 54 HOH HOH A . B 2 HOH 96 296 91 HOH HOH A . B 2 HOH 97 297 134 HOH HOH A . B 2 HOH 98 298 118 HOH HOH A . B 2 HOH 99 299 34 HOH HOH A . B 2 HOH 100 300 9 HOH HOH A . B 2 HOH 101 301 101 HOH HOH A . B 2 HOH 102 302 127 HOH HOH A . B 2 HOH 103 303 47 HOH HOH A . B 2 HOH 104 304 84 HOH HOH A . B 2 HOH 105 305 97 HOH HOH A . B 2 HOH 106 306 144 HOH HOH A . B 2 HOH 107 307 100 HOH HOH A . B 2 HOH 108 308 137 HOH HOH A . B 2 HOH 109 309 88 HOH HOH A . B 2 HOH 110 310 125 HOH HOH A . B 2 HOH 111 311 74 HOH HOH A . B 2 HOH 112 312 121 HOH HOH A . B 2 HOH 113 313 50 HOH HOH A . B 2 HOH 114 314 48 HOH HOH A . B 2 HOH 115 315 81 HOH HOH A . B 2 HOH 116 316 60 HOH HOH A . B 2 HOH 117 317 93 HOH HOH A . B 2 HOH 118 318 147 HOH HOH A . B 2 HOH 119 319 124 HOH HOH A . B 2 HOH 120 320 96 HOH HOH A . B 2 HOH 121 321 99 HOH HOH A . B 2 HOH 122 322 104 HOH HOH A . B 2 HOH 123 323 77 HOH HOH A . B 2 HOH 124 324 135 HOH HOH A . B 2 HOH 125 325 136 HOH HOH A . B 2 HOH 126 326 146 HOH HOH A . B 2 HOH 127 327 133 HOH HOH A . B 2 HOH 128 328 122 HOH HOH A . B 2 HOH 129 329 32 HOH HOH A . B 2 HOH 130 330 120 HOH HOH A . B 2 HOH 131 331 116 HOH HOH A . B 2 HOH 132 332 107 HOH HOH A . B 2 HOH 133 333 128 HOH HOH A . B 2 HOH 134 334 109 HOH HOH A . B 2 HOH 135 335 82 HOH HOH A . B 2 HOH 136 336 142 HOH HOH A . B 2 HOH 137 337 141 HOH HOH A . B 2 HOH 138 338 22 HOH HOH A . B 2 HOH 139 339 87 HOH HOH A . B 2 HOH 140 340 80 HOH HOH A . B 2 HOH 141 341 103 HOH HOH A . B 2 HOH 142 342 86 HOH HOH A . B 2 HOH 143 343 85 HOH HOH A . B 2 HOH 144 344 115 HOH HOH A . B 2 HOH 145 345 44 HOH HOH A . B 2 HOH 146 346 117 HOH HOH A . B 2 HOH 147 347 90 HOH HOH A . B 2 HOH 148 348 131 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10.1_2155 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7XCD _cell.details ? _cell.formula_units_Z ? _cell.length_a 45.327 _cell.length_a_esd ? _cell.length_b 81.311 _cell.length_b_esd ? _cell.length_c 122.037 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7XCD _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7XCD _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.73 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.00 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 8000, KCl, Tris' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2016-10-11 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97915 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97915 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7XCD _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.710 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 23810 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 95.600 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.200 _reflns.pdbx_Rmerge_I_obs 0.115 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.400 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 2.346 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.125 _reflns.pdbx_Rpim_I_all 0.047 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 148523 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 1.710 1.740 ? ? ? ? ? ? 927 74.900 ? ? ? ? 1.261 ? ? ? ? ? ? ? ? 3.800 ? 0.904 ? ? 0.99 0.642 ? 1 1 0.279 ? ? ? ? ? ? ? ? ? ? 1.740 1.770 ? ? ? ? ? ? 1153 95.000 ? ? ? ? 1.145 ? ? ? ? ? ? ? ? 4.600 ? 0.945 ? ? 0.99 0.532 ? 2 1 0.496 ? ? ? ? ? ? ? ? ? ? 1.770 1.810 ? ? ? ? ? ? 1190 97.100 ? ? ? ? 0.978 ? ? ? ? ? ? ? ? 5.900 ? 1.009 ? ? 0.99 0.405 ? 3 1 0.668 ? ? ? ? ? ? ? ? ? ? 1.810 1.840 ? ? ? ? ? ? 1212 98.600 ? ? ? ? 0.879 ? ? ? ? ? ? ? ? 6.000 ? 1.125 ? ? 0.953 0.357 ? 4 1 0.709 ? ? ? ? ? ? ? ? ? ? 1.840 1.880 ? ? ? ? ? ? 1208 98.000 ? ? ? ? 0.779 ? ? ? ? ? ? ? ? 6.300 ? 1.172 ? ? 0.845 0.317 ? 5 1 0.662 ? ? ? ? ? ? ? ? ? ? 1.880 1.930 ? ? ? ? ? ? 1202 98.600 ? ? ? ? 0.716 ? ? ? ? ? ? ? ? 6.400 ? 1.304 ? ? 0.777 0.293 ? 6 1 0.764 ? ? ? ? ? ? ? ? ? ? 1.930 1.970 ? ? ? ? ? ? 1218 98.100 ? ? ? ? 0.547 ? ? ? ? ? ? ? ? 6.400 ? 1.415 ? ? 0.593 0.223 ? 7 1 0.871 ? ? ? ? ? ? ? ? ? ? 1.970 2.030 ? ? ? ? ? ? 1209 98.500 ? ? ? ? 0.493 ? ? ? ? ? ? ? ? 6.500 ? 1.569 ? ? 0.536 0.204 ? 8 1 0.845 ? ? ? ? ? ? ? ? ? ? 2.030 2.090 ? ? ? ? ? ? 1209 98.500 ? ? ? ? 0.395 ? ? ? ? ? ? ? ? 6.400 ? 1.712 ? ? 0.429 0.163 ? 9 1 0.910 ? ? ? ? ? ? ? ? ? ? 2.090 2.150 ? ? ? ? ? ? 1199 98.000 ? ? ? ? 0.303 ? ? ? ? ? ? ? ? 6.600 ? 2.018 ? ? 0.328 0.122 ? 10 1 0.959 ? ? ? ? ? ? ? ? ? ? 2.150 2.230 ? ? ? ? ? ? 1214 98.000 ? ? ? ? 0.275 ? ? ? ? ? ? ? ? 6.600 ? 2.195 ? ? 0.297 0.111 ? 11 1 0.971 ? ? ? ? ? ? ? ? ? ? 2.230 2.320 ? ? ? ? ? ? 1228 98.100 ? ? ? ? 0.238 ? ? ? ? ? ? ? ? 6.600 ? 2.255 ? ? 0.258 0.097 ? 12 1 0.965 ? ? ? ? ? ? ? ? ? ? 2.320 2.430 ? ? ? ? ? ? 1199 98.000 ? ? ? ? 0.198 ? ? ? ? ? ? ? ? 6.700 ? 2.461 ? ? 0.214 0.080 ? 13 1 0.979 ? ? ? ? ? ? ? ? ? ? 2.430 2.550 ? ? ? ? ? ? 1215 96.700 ? ? ? ? 0.173 ? ? ? ? ? ? ? ? 6.700 ? 2.643 ? ? 0.188 0.069 ? 14 1 0.984 ? ? ? ? ? ? ? ? ? ? 2.550 2.710 ? ? ? ? ? ? 1207 97.000 ? ? ? ? 0.168 ? ? ? ? ? ? ? ? 6.700 ? 2.759 ? ? 0.182 0.068 ? 15 1 0.987 ? ? ? ? ? ? ? ? ? ? 2.710 2.920 ? ? ? ? ? ? 1205 96.100 ? ? ? ? 0.136 ? ? ? ? ? ? ? ? 6.700 ? 3.118 ? ? 0.147 0.054 ? 16 1 0.991 ? ? ? ? ? ? ? ? ? ? 2.920 3.220 ? ? ? ? ? ? 1193 95.700 ? ? ? ? 0.119 ? ? ? ? ? ? ? ? 6.500 ? 3.632 ? ? 0.130 0.049 ? 17 1 0.992 ? ? ? ? ? ? ? ? ? ? 3.220 3.680 ? ? ? ? ? ? 1196 94.900 ? ? ? ? 0.092 ? ? ? ? ? ? ? ? 6.200 ? 4.170 ? ? 0.101 0.039 ? 18 1 0.992 ? ? ? ? ? ? ? ? ? ? 3.680 4.640 ? ? ? ? ? ? 1216 93.100 ? ? ? ? 0.077 ? ? ? ? ? ? ? ? 6.100 ? 4.784 ? ? 0.084 0.033 ? 19 1 0.993 ? ? ? ? ? ? ? ? ? ? 4.640 10.0 ? ? ? ? ? ? 1210 89.400 ? ? ? ? 0.071 ? ? ? ? ? ? ? ? 6.500 ? 4.205 ? ? 0.077 0.029 ? 20 1 0.996 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 98.160 _refine.B_iso_mean 35.5252 _refine.B_iso_min 14.100 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7XCD _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.7100 _refine.ls_d_res_low 39.5910 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 22209 _refine.ls_number_reflns_R_free 1881 _refine.ls_number_reflns_R_work 20328 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 89.3700 _refine.ls_percent_reflns_R_free 8.4700 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1815 _refine.ls_R_factor_R_free 0.1958 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1802 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7XCC _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.2700 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1800 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.7100 _refine_hist.d_res_low 39.5910 _refine_hist.number_atoms_solvent 148 _refine_hist.number_atoms_total 1592 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 178 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent 44.97 _refine_hist.pdbx_number_atoms_protein 1444 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 1478 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.827 ? 2003 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.052 ? 229 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 252 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 14.733 ? 898 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.74 1.7557 . . 97 1114 65.0000 . . . 0.3045 0.0000 0.2966 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7557 1.8074 . . 132 1395 81.0000 . . . 0.3277 0.0000 0.2558 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8074 1.8657 . . 144 1473 86.0000 . . . 0.2805 0.0000 0.2388 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8657 1.9324 . . 137 1513 87.0000 . . . 0.2272 0.0000 0.2193 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9324 2.0098 . . 149 1560 91.0000 . . . 0.2632 0.0000 0.1976 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0098 2.1012 . . 151 1617 93.0000 . . . 0.2131 0.0000 0.1920 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1012 2.2120 . . 152 1630 94.0000 . . . 0.2002 0.0000 0.1725 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2120 2.3506 . . 152 1641 95.0000 . . . 0.2040 0.0000 0.1787 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3506 2.5320 . . 150 1661 95.0000 . . . 0.1794 0.0000 0.179 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5320 2.7868 . . 156 1658 95.0000 . . . 0.2330 0.0000 0.1888 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7868 3.1899 . . 152 1685 95.0000 . . . 0.1929 0.0000 0.1853 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1899 4.0183 . . 156 1682 94.0000 . . . 0.1605 0.0000 0.16 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0183 10.0 . . 153 1699 91.0000 . . . 0.1817 0.0000 0.1664 . . . . . . . . . . . # _struct.entry_id 7XCD _struct.title 'Crystal Structure of the Disease-Specific Protein of Rice Stripe Virus' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7XCD _struct_keywords.text 'Rice Stripe Virus, VIRUS, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q705B3_9VIRU _struct_ref.pdbx_db_accession Q705B3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MQDVQRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHI PEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVW KKMPTYFESIIQPLLHKT ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7XCD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 178 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q705B3 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 178 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 178 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 7 ? VAL A 12 ? THR A 7 VAL A 12 5 ? 6 HELX_P HELX_P2 AA2 ASP A 19 ? LEU A 27 ? ASP A 19 LEU A 27 1 ? 9 HELX_P HELX_P3 AA3 PRO A 28 ? ASP A 33 ? PRO A 28 ASP A 33 1 ? 6 HELX_P HELX_P4 AA4 THR A 36 ? LYS A 41 ? THR A 36 LYS A 41 1 ? 6 HELX_P HELX_P5 AA5 ASP A 42 ? VAL A 46 ? ASP A 42 VAL A 46 5 ? 5 HELX_P HELX_P6 AA6 THR A 47 ? HIS A 64 ? THR A 47 HIS A 64 1 ? 18 HELX_P HELX_P7 AA7 ASP A 70 ? VAL A 76 ? ASP A 70 VAL A 76 1 ? 7 HELX_P HELX_P8 AA8 HIS A 79 ? LEU A 92 ? HIS A 79 LEU A 92 1 ? 14 HELX_P HELX_P9 AA9 ASP A 103 ? LEU A 111 ? ASP A 103 LEU A 111 1 ? 9 HELX_P HELX_P10 AB1 LEU A 111 ? GLY A 116 ? LEU A 111 GLY A 116 1 ? 6 HELX_P HELX_P11 AB2 THR A 120 ? HIS A 126 ? THR A 120 HIS A 126 1 ? 7 HELX_P HELX_P12 AB3 PRO A 127 ? MSE A 130 ? PRO A 127 MSE A 130 5 ? 4 HELX_P HELX_P13 AB4 SER A 131 ? ALA A 146 ? SER A 131 ALA A 146 1 ? 16 HELX_P HELX_P14 AB5 ASP A 152 ? VAL A 159 ? ASP A 152 VAL A 159 1 ? 8 HELX_P HELX_P15 AB6 LYS A 162 ? LEU A 175 ? LYS A 162 LEU A 175 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A MSE 1 C ? ? ? 1_555 A GLN 2 N ? ? A MSE 1 A GLN 2 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale2 covale both ? A ASN 109 C ? ? ? 1_555 A MSE 110 N ? ? A ASN 109 A MSE 110 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale3 covale both ? A MSE 110 C ? ? ? 1_555 A LEU 111 N ? ? A MSE 110 A LEU 111 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale4 covale both ? A ARG 129 C ? ? ? 1_555 A MSE 130 N ? ? A ARG 129 A MSE 130 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale5 covale both ? A MSE 130 C ? ? ? 1_555 A SER 131 N ? ? A MSE 130 A SER 131 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale6 covale both ? A LYS 136 C ? ? ? 1_555 A MSE 137 N ? ? A LYS 136 A MSE 137 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale7 covale both ? A MSE 137 C ? ? ? 1_555 A LEU 138 N ? ? A MSE 137 A LEU 138 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale8 covale both ? A LYS 144 C ? ? ? 1_555 A MSE 145 N ? ? A LYS 144 A MSE 145 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale9 covale both ? A MSE 145 C ? ? ? 1_555 A ALA 146 N ? ? A MSE 145 A ALA 146 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale10 covale both ? A LYS 162 C ? ? ? 1_555 A MSE 163 N ? ? A LYS 162 A MSE 163 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale11 covale both ? A MSE 163 C ? ? ? 1_555 A PRO 164 N ? ? A MSE 163 A PRO 164 1_555 ? ? ? ? ? ? ? 1.352 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 1 ? . . . . MSE A 1 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 110 ? . . . . MSE A 110 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 130 ? . . . . MSE A 130 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 MSE A 137 ? . . . . MSE A 137 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 5 MSE A 145 ? . . . . MSE A 145 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 6 MSE A 163 ? . . . . MSE A 163 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # _pdbx_entry_details.entry_id 7XCD _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLU 68 ? ? O A HOH 201 ? ? 1.90 2 1 O A HOH 268 ? ? O A HOH 316 ? ? 1.97 3 1 O A HOH 278 ? ? O A HOH 332 ? ? 1.97 4 1 O A HOH 318 ? ? O A HOH 327 ? ? 1.98 5 1 O A HOH 298 ? ? O A HOH 333 ? ? 1.99 6 1 O A HOH 221 ? ? O A HOH 255 ? ? 1.99 7 1 O A HOH 216 ? ? O A HOH 291 ? ? 2.06 8 1 OE2 A GLU 155 ? ? O A HOH 202 ? ? 2.06 9 1 O A HOH 208 ? ? O A HOH 289 ? ? 2.12 10 1 O A HOH 265 ? ? O A HOH 311 ? ? 2.18 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 212 ? ? 1_555 O A HOH 330 ? ? 3_757 1.98 2 1 O A HOH 306 ? ? 1_555 O A HOH 340 ? ? 8_577 2.02 3 1 O A HOH 206 ? ? 1_555 O A HOH 313 ? ? 8_577 2.11 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 3 ? ? 61.58 62.87 2 1 HIS A 64 ? ? -94.43 52.65 3 1 VAL A 76 ? ? -125.46 -73.19 4 1 VAL A 159 ? ? -125.24 -59.77 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET 'modified residue' 2 A MSE 110 A MSE 110 ? MET 'modified residue' 3 A MSE 130 A MSE 130 ? MET 'modified residue' 4 A MSE 137 A MSE 137 ? MET 'modified residue' 5 A MSE 145 A MSE 145 ? MET 'modified residue' 6 A MSE 163 A MSE 163 ? MET 'modified residue' # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 223 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MSE N N N N 230 MSE CA C N S 231 MSE C C N N 232 MSE O O N N 233 MSE OXT O N N 234 MSE CB C N N 235 MSE CG C N N 236 MSE SE SE N N 237 MSE CE C N N 238 MSE H H N N 239 MSE H2 H N N 240 MSE HA H N N 241 MSE HXT H N N 242 MSE HB2 H N N 243 MSE HB3 H N N 244 MSE HG2 H N N 245 MSE HG3 H N N 246 MSE HE1 H N N 247 MSE HE2 H N N 248 MSE HE3 H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MSE N CA sing N N 218 MSE N H sing N N 219 MSE N H2 sing N N 220 MSE CA C sing N N 221 MSE CA CB sing N N 222 MSE CA HA sing N N 223 MSE C O doub N N 224 MSE C OXT sing N N 225 MSE OXT HXT sing N N 226 MSE CB CG sing N N 227 MSE CB HB2 sing N N 228 MSE CB HB3 sing N N 229 MSE CG SE sing N N 230 MSE CG HG2 sing N N 231 MSE CG HG3 sing N N 232 MSE SE CE sing N N 233 MSE CE HE1 sing N N 234 MSE CE HE2 sing N N 235 MSE CE HE3 sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'National Science Foundation (NSF, China)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 'National Natural Science Foundation of China (32002049)' _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7XCC _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7XCD _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.022062 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012298 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008194 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S SE # loop_