data_7XGS # _entry.id 7XGS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.368 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7XGS pdb_00007xgs 10.2210/pdb7xgs/pdb WWPDB D_1300028785 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7XGS _pdbx_database_status.recvd_initial_deposition_date 2022-04-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Liao, Y.-T.' 1 ? 'Wang, H.-C.' 2 0000-0003-2396-717X 'Ko, T.-P.' 3 0000-0003-1794-2638 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;The PHYL1 effector of peanut witches broom (PnWB) phytoplasma alters the miR156/157-mediated squamosa promoter binding protein like regulation and gibberellic acid generation to promote anthocyanin biosynthesis ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pan, Z.-J.' 1 ? primary 'Huang, Y.-C.' 2 ? primary 'Cheng, H.-P.' 3 ? primary 'Lin, C.-P.' 4 ? primary 'Liao, Y.-T.' 5 ? primary 'Ko, T.-P.' 6 ? primary 'Wang, H.-C.' 7 ? primary 'Lin, S.-S.' 8 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7XGS _cell.details ? _cell.formula_units_Z ? _cell.length_a 42.617 _cell.length_a_esd ? _cell.length_b 116.440 _cell.length_b_esd ? _cell.length_c 50.274 _cell.length_c_esd ? _cell.volume 249475.851 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7XGS _symmetry.cell_setting ? _symmetry.Int_Tables_number 21 _symmetry.space_group_name_Hall 'C 2 2' _symmetry.space_group_name_H-M 'C 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'MADS-box protein SVP' 12734.422 1 ? ? ? ? 2 non-polymer nat 1,2-ETHANEDIOL 62.068 2 ? ? ? ? 3 water nat water 18.015 71 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Protein SHORT VEGETATIVE PHASE' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;KNLEKLDQPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELQGLDIEELQQLEKALETGLTRVIETKSDKIMSEISEL QKKGMQLMDENKRLRQQGTQLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;KNLEKLDQPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELQGLDIEELQQLEKALETGLTRVIETKSDKIMSEISEL QKKGMQLMDENKRLRQQGTQLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 LYS n 1 2 ASN n 1 3 LEU n 1 4 GLU n 1 5 LYS n 1 6 LEU n 1 7 ASP n 1 8 GLN n 1 9 PRO n 1 10 SER n 1 11 LEU n 1 12 GLU n 1 13 LEU n 1 14 GLN n 1 15 LEU n 1 16 VAL n 1 17 GLU n 1 18 ASN n 1 19 SER n 1 20 ASP n 1 21 HIS n 1 22 ALA n 1 23 ARG n 1 24 MET n 1 25 SER n 1 26 LYS n 1 27 GLU n 1 28 ILE n 1 29 ALA n 1 30 ASP n 1 31 LYS n 1 32 SER n 1 33 HIS n 1 34 ARG n 1 35 LEU n 1 36 ARG n 1 37 GLN n 1 38 MET n 1 39 ARG n 1 40 GLY n 1 41 GLU n 1 42 GLU n 1 43 LEU n 1 44 GLN n 1 45 GLY n 1 46 LEU n 1 47 ASP n 1 48 ILE n 1 49 GLU n 1 50 GLU n 1 51 LEU n 1 52 GLN n 1 53 GLN n 1 54 LEU n 1 55 GLU n 1 56 LYS n 1 57 ALA n 1 58 LEU n 1 59 GLU n 1 60 THR n 1 61 GLY n 1 62 LEU n 1 63 THR n 1 64 ARG n 1 65 VAL n 1 66 ILE n 1 67 GLU n 1 68 THR n 1 69 LYS n 1 70 SER n 1 71 ASP n 1 72 LYS n 1 73 ILE n 1 74 MET n 1 75 SER n 1 76 GLU n 1 77 ILE n 1 78 SER n 1 79 GLU n 1 80 LEU n 1 81 GLN n 1 82 LYS n 1 83 LYS n 1 84 GLY n 1 85 MET n 1 86 GLN n 1 87 LEU n 1 88 MET n 1 89 ASP n 1 90 GLU n 1 91 ASN n 1 92 LYS n 1 93 ARG n 1 94 LEU n 1 95 ARG n 1 96 GLN n 1 97 GLN n 1 98 GLY n 1 99 THR n 1 100 GLN n 1 101 LEU n 1 102 GLU n 1 103 HIS n 1 104 HIS n 1 105 HIS n 1 106 HIS n 1 107 HIS n 1 108 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 108 _entity_src_gen.gene_src_common_name 'thale cress' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SVP, At2g22540, F14M13.6' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ;Escherichia coli 'BL21-Gold(DE3)pLysS AG' ; _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 866768 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SVP_ARATH _struct_ref.pdbx_db_accession Q9FVC1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KNLEKLDQPSLELQLVENSDHARMSKEIADKSHRLRQMRGEELQGLDIEELQQLEKALETGLTRVIETKSDKIMSEISEL QKKGMQLMDENKRLRQQGTQL ; _struct_ref.pdbx_align_begin 74 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7XGS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 101 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9FVC1 _struct_ref_seq.db_align_beg 74 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 174 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 5 _struct_ref_seq.pdbx_auth_seq_align_end 105 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7XGS GLU A 102 ? UNP Q9FVC1 ? ? 'expression tag' 106 1 1 7XGS HIS A 103 ? UNP Q9FVC1 ? ? 'expression tag' 107 2 1 7XGS HIS A 104 ? UNP Q9FVC1 ? ? 'expression tag' 108 3 1 7XGS HIS A 105 ? UNP Q9FVC1 ? ? 'expression tag' 109 4 1 7XGS HIS A 106 ? UNP Q9FVC1 ? ? 'expression tag' 110 5 1 7XGS HIS A 107 ? UNP Q9FVC1 ? ? 'expression tag' 111 6 1 7XGS HIS A 108 ? UNP Q9FVC1 ? ? 'expression tag' 112 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 EDO non-polymer . 1,2-ETHANEDIOL 'ETHYLENE GLYCOL' 'C2 H6 O2' 62.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7XGS _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.45 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.77 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Na-citrate, PEG 8000, ethylene glycol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX300-HS' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2018-03-03 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSRRC BEAMLINE TPS 05A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'TPS 05A' _diffrn_source.pdbx_synchrotron_site NSRRC # _reflns.B_iso_Wilson_estimate 26.99 _reflns.entry_id 7XGS _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.2 _reflns.d_resolution_low 20 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6460 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.1 _reflns.pdbx_Rmerge_I_obs 0.039 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 52.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.2 _reflns_shell.d_res_low 2.28 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 5.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 598 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.285 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.7 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 52.86 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7XGS _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.21 _refine.ls_d_res_low 20.0 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6367 _refine.ls_number_reflns_R_free 318 _refine.ls_number_reflns_R_work 8574 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 74.50 _refine.ls_percent_reflns_R_free 5.01 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1904 _refine.ls_R_factor_R_free 0.2332 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1881 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 25.0079 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1772 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.21 _refine_hist.d_res_low 20.0 _refine_hist.number_atoms_solvent 71 _refine_hist.number_atoms_total 643 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 564 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 8 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0025 ? 571 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.5313 ? 751 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.0311 ? 84 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.0059 ? 97 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 22.7374 ? 371 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.21 2.29 . . 25 513 42 . . . 0.321 . 0.247 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.53 3.18 . . 152 2905 75.99 . . . 0.2586 . 0.2141 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.18 20.0 . . 202 3818 99.31 . . . 0.2226 . 0.1729 . . . . . . . . . . . # _struct.entry_id 7XGS _struct.title 'Short vegetative phase protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7XGS _struct_keywords.text 'helix-loop-helix, RNA, plant phenotype, GENE REGULATION' _struct_keywords.pdbx_keywords 'GENE REGULATION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 21 ? ARG A 39 ? HIS A 25 ARG A 43 1 ? 19 HELX_P HELX_P2 AA2 ASP A 47 ? GLU A 90 ? ASP A 51 GLU A 94 1 ? 44 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 7XGS _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.023465 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008588 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019891 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 25.62398 1.50364 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 19.97189 1.75589 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 15.80542 1.70748 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 1.23737 29.19336 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 LYS 1 5 ? ? ? A . n A 1 2 ASN 2 6 ? ? ? A . n A 1 3 LEU 3 7 ? ? ? A . n A 1 4 GLU 4 8 ? ? ? A . n A 1 5 LYS 5 9 ? ? ? A . n A 1 6 LEU 6 10 ? ? ? A . n A 1 7 ASP 7 11 ? ? ? A . n A 1 8 GLN 8 12 ? ? ? A . n A 1 9 PRO 9 13 ? ? ? A . n A 1 10 SER 10 14 ? ? ? A . n A 1 11 LEU 11 15 ? ? ? A . n A 1 12 GLU 12 16 ? ? ? A . n A 1 13 LEU 13 17 ? ? ? A . n A 1 14 GLN 14 18 ? ? ? A . n A 1 15 LEU 15 19 ? ? ? A . n A 1 16 VAL 16 20 ? ? ? A . n A 1 17 GLU 17 21 ? ? ? A . n A 1 18 ASN 18 22 ? ? ? A . n A 1 19 SER 19 23 ? ? ? A . n A 1 20 ASP 20 24 ? ? ? A . n A 1 21 HIS 21 25 25 HIS HIS A . n A 1 22 ALA 22 26 26 ALA ALA A . n A 1 23 ARG 23 27 27 ARG ARG A . n A 1 24 MET 24 28 28 MET MET A . n A 1 25 SER 25 29 29 SER SER A . n A 1 26 LYS 26 30 30 LYS LYS A . n A 1 27 GLU 27 31 31 GLU GLU A . n A 1 28 ILE 28 32 32 ILE ILE A . n A 1 29 ALA 29 33 33 ALA ALA A . n A 1 30 ASP 30 34 34 ASP ASP A . n A 1 31 LYS 31 35 35 LYS LYS A . n A 1 32 SER 32 36 36 SER SER A . n A 1 33 HIS 33 37 37 HIS HIS A . n A 1 34 ARG 34 38 38 ARG ARG A . n A 1 35 LEU 35 39 39 LEU LEU A . n A 1 36 ARG 36 40 40 ARG ARG A . n A 1 37 GLN 37 41 41 GLN GLN A . n A 1 38 MET 38 42 42 MET MET A . n A 1 39 ARG 39 43 43 ARG ARG A . n A 1 40 GLY 40 44 44 GLY GLY A . n A 1 41 GLU 41 45 45 GLU GLU A . n A 1 42 GLU 42 46 46 GLU GLU A . n A 1 43 LEU 43 47 47 LEU LEU A . n A 1 44 GLN 44 48 48 GLN GLN A . n A 1 45 GLY 45 49 49 GLY GLY A . n A 1 46 LEU 46 50 50 LEU LEU A . n A 1 47 ASP 47 51 51 ASP ASP A . n A 1 48 ILE 48 52 52 ILE ILE A . n A 1 49 GLU 49 53 53 GLU GLU A . n A 1 50 GLU 50 54 54 GLU GLU A . n A 1 51 LEU 51 55 55 LEU LEU A . n A 1 52 GLN 52 56 56 GLN GLN A . n A 1 53 GLN 53 57 57 GLN GLN A . n A 1 54 LEU 54 58 58 LEU LEU A . n A 1 55 GLU 55 59 59 GLU GLU A . n A 1 56 LYS 56 60 60 LYS LYS A . n A 1 57 ALA 57 61 61 ALA ALA A . n A 1 58 LEU 58 62 62 LEU LEU A . n A 1 59 GLU 59 63 63 GLU GLU A . n A 1 60 THR 60 64 64 THR THR A . n A 1 61 GLY 61 65 65 GLY GLY A . n A 1 62 LEU 62 66 66 LEU LEU A . n A 1 63 THR 63 67 67 THR THR A . n A 1 64 ARG 64 68 68 ARG ARG A . n A 1 65 VAL 65 69 69 VAL VAL A . n A 1 66 ILE 66 70 70 ILE ILE A . n A 1 67 GLU 67 71 71 GLU GLU A . n A 1 68 THR 68 72 72 THR THR A . n A 1 69 LYS 69 73 73 LYS LYS A . n A 1 70 SER 70 74 74 SER SER A . n A 1 71 ASP 71 75 75 ASP ASP A . n A 1 72 LYS 72 76 76 LYS LYS A . n A 1 73 ILE 73 77 77 ILE ILE A . n A 1 74 MET 74 78 78 MET MET A . n A 1 75 SER 75 79 79 SER SER A . n A 1 76 GLU 76 80 80 GLU GLU A . n A 1 77 ILE 77 81 81 ILE ILE A . n A 1 78 SER 78 82 82 SER SER A . n A 1 79 GLU 79 83 83 GLU GLU A . n A 1 80 LEU 80 84 84 LEU LEU A . n A 1 81 GLN 81 85 85 GLN GLN A . n A 1 82 LYS 82 86 86 LYS LYS A . n A 1 83 LYS 83 87 87 LYS LYS A . n A 1 84 GLY 84 88 88 GLY GLY A . n A 1 85 MET 85 89 89 MET MET A . n A 1 86 GLN 86 90 90 GLN GLN A . n A 1 87 LEU 87 91 91 LEU LEU A . n A 1 88 MET 88 92 92 MET MET A . n A 1 89 ASP 89 93 93 ASP ASP A . n A 1 90 GLU 90 94 94 GLU GLU A . n A 1 91 ASN 91 95 ? ? ? A . n A 1 92 LYS 92 96 ? ? ? A . n A 1 93 ARG 93 97 ? ? ? A . n A 1 94 LEU 94 98 ? ? ? A . n A 1 95 ARG 95 99 ? ? ? A . n A 1 96 GLN 96 100 ? ? ? A . n A 1 97 GLN 97 101 ? ? ? A . n A 1 98 GLY 98 102 ? ? ? A . n A 1 99 THR 99 103 ? ? ? A . n A 1 100 GLN 100 104 ? ? ? A . n A 1 101 LEU 101 105 ? ? ? A . n A 1 102 GLU 102 106 ? ? ? A . n A 1 103 HIS 103 107 ? ? ? A . n A 1 104 HIS 104 108 ? ? ? A . n A 1 105 HIS 105 109 ? ? ? A . n A 1 106 HIS 106 110 ? ? ? A . n A 1 107 HIS 107 111 ? ? ? A . n A 1 108 HIS 108 112 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email wanghc@tmu.edu.tw _pdbx_contact_author.name_first Hao-Ching _pdbx_contact_author.name_last Wang _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2396-717X # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 EDO 1 201 201 EDO EDO A . C 2 EDO 1 202 202 EDO EDO A . D 3 HOH 1 301 7 HOH HOH A . D 3 HOH 2 302 40 HOH HOH A . D 3 HOH 3 303 18 HOH HOH A . D 3 HOH 4 304 4 HOH HOH A . D 3 HOH 5 305 3 HOH HOH A . D 3 HOH 6 306 38 HOH HOH A . D 3 HOH 7 307 41 HOH HOH A . D 3 HOH 8 308 46 HOH HOH A . D 3 HOH 9 309 43 HOH HOH A . D 3 HOH 10 310 31 HOH HOH A . D 3 HOH 11 311 48 HOH HOH A . D 3 HOH 12 312 52 HOH HOH A . D 3 HOH 13 313 14 HOH HOH A . D 3 HOH 14 314 11 HOH HOH A . D 3 HOH 15 315 58 HOH HOH A . D 3 HOH 16 316 16 HOH HOH A . D 3 HOH 17 317 22 HOH HOH A . D 3 HOH 18 318 19 HOH HOH A . D 3 HOH 19 319 64 HOH HOH A . D 3 HOH 20 320 32 HOH HOH A . D 3 HOH 21 321 1 HOH HOH A . D 3 HOH 22 322 12 HOH HOH A . D 3 HOH 23 323 20 HOH HOH A . D 3 HOH 24 324 25 HOH HOH A . D 3 HOH 25 325 66 HOH HOH A . D 3 HOH 26 326 9 HOH HOH A . D 3 HOH 27 327 6 HOH HOH A . D 3 HOH 28 328 23 HOH HOH A . D 3 HOH 29 329 2 HOH HOH A . D 3 HOH 30 330 13 HOH HOH A . D 3 HOH 31 331 17 HOH HOH A . D 3 HOH 32 332 47 HOH HOH A . D 3 HOH 33 333 71 HOH HOH A . D 3 HOH 34 334 8 HOH HOH A . D 3 HOH 35 335 28 HOH HOH A . D 3 HOH 36 336 55 HOH HOH A . D 3 HOH 37 337 68 HOH HOH A . D 3 HOH 38 338 60 HOH HOH A . D 3 HOH 39 339 57 HOH HOH A . D 3 HOH 40 340 27 HOH HOH A . D 3 HOH 41 341 15 HOH HOH A . D 3 HOH 42 342 51 HOH HOH A . D 3 HOH 43 343 63 HOH HOH A . D 3 HOH 44 344 33 HOH HOH A . D 3 HOH 45 345 29 HOH HOH A . D 3 HOH 46 346 36 HOH HOH A . D 3 HOH 47 347 54 HOH HOH A . D 3 HOH 48 348 50 HOH HOH A . D 3 HOH 49 349 35 HOH HOH A . D 3 HOH 50 350 37 HOH HOH A . D 3 HOH 51 351 34 HOH HOH A . D 3 HOH 52 352 30 HOH HOH A . D 3 HOH 53 353 5 HOH HOH A . D 3 HOH 54 354 39 HOH HOH A . D 3 HOH 55 355 26 HOH HOH A . D 3 HOH 56 356 65 HOH HOH A . D 3 HOH 57 357 10 HOH HOH A . D 3 HOH 58 358 67 HOH HOH A . D 3 HOH 59 359 44 HOH HOH A . D 3 HOH 60 360 59 HOH HOH A . D 3 HOH 61 361 61 HOH HOH A . D 3 HOH 62 362 56 HOH HOH A . D 3 HOH 63 363 70 HOH HOH A . D 3 HOH 64 364 42 HOH HOH A . D 3 HOH 65 365 45 HOH HOH A . D 3 HOH 66 366 49 HOH HOH A . D 3 HOH 67 367 21 HOH HOH A . D 3 HOH 68 368 53 HOH HOH A . D 3 HOH 69 369 69 HOH HOH A . D 3 HOH 70 370 24 HOH HOH A . D 3 HOH 71 371 62 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3590 ? 1 MORE -25 ? 1 'SSA (A^2)' 10410 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_555 -x+1/2,-y+1/2,z -1.0000000000 0.0000000000 0.0000000000 21.3085000000 0.0000000000 -1.0000000000 0.0000000000 58.2200000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A EDO 202 ? C EDO . 2 1 A EDO 202 ? C EDO . 3 1 A HOH 337 ? D HOH . # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-04-12 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 x,-y,-z 3 -x,y,-z 4 -x,-y,z 5 x+1/2,y+1/2,z 6 x+1/2,-y+1/2,-z 7 -x+1/2,y+1/2,-z 8 -x+1/2,-y+1/2,z # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 6.66248734573 34.3933174863 52.1791297233 0.306347113664 ? 0.166803899715 ? 0.201560840017 ? 0.627696650777 ? -0.125328624387 ? 0.134149454628 ? 0.989707747757 ? 0.0325825256522 ? -0.389555132666 ? 1.87352625613 ? -1.60522140887 ? 5.39809478145 ? -0.499044565842 ? -1.44699244876 ? 0.746017032539 ? 1.04830984504 ? 0.368722113992 ? 0.287311082831 ? -0.967138803516 ? 0.0308617530788 ? -0.0609675587633 ? 2 'X-RAY DIFFRACTION' ? refined 19.8058087216 17.9849687769 33.8043896607 0.245594647272 ? 0.0842711535811 ? -0.0247765707311 ? 0.280365662934 ? -0.0373102749855 ? 0.188932376055 ? 3.25540087838 ? -2.52110762626 ? -1.17656791874 ? 8.06181753454 ? 2.07866445308 ? 1.04023079747 ? 0.29018600521 ? 0.256694005731 ? 0.228663907664 ? -0.411064607207 ? 0.0067946049875 ? -1.25488418285 ? -0.106198541615 ? 0.431573519212 ? -0.0926307779098 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 25 through 51 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 52 through 94 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.13_2998 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? BUCCANEER ? ? ? . 4 # _pdbx_entry_details.entry_id 7XGS _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 370 ? 6.09 . 2 1 O ? A HOH 371 ? 7.16 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LYS 5 ? A LYS 1 2 1 Y 1 A ASN 6 ? A ASN 2 3 1 Y 1 A LEU 7 ? A LEU 3 4 1 Y 1 A GLU 8 ? A GLU 4 5 1 Y 1 A LYS 9 ? A LYS 5 6 1 Y 1 A LEU 10 ? A LEU 6 7 1 Y 1 A ASP 11 ? A ASP 7 8 1 Y 1 A GLN 12 ? A GLN 8 9 1 Y 1 A PRO 13 ? A PRO 9 10 1 Y 1 A SER 14 ? A SER 10 11 1 Y 1 A LEU 15 ? A LEU 11 12 1 Y 1 A GLU 16 ? A GLU 12 13 1 Y 1 A LEU 17 ? A LEU 13 14 1 Y 1 A GLN 18 ? A GLN 14 15 1 Y 1 A LEU 19 ? A LEU 15 16 1 Y 1 A VAL 20 ? A VAL 16 17 1 Y 1 A GLU 21 ? A GLU 17 18 1 Y 1 A ASN 22 ? A ASN 18 19 1 Y 1 A SER 23 ? A SER 19 20 1 Y 1 A ASP 24 ? A ASP 20 21 1 Y 1 A ASN 95 ? A ASN 91 22 1 Y 1 A LYS 96 ? A LYS 92 23 1 Y 1 A ARG 97 ? A ARG 93 24 1 Y 1 A LEU 98 ? A LEU 94 25 1 Y 1 A ARG 99 ? A ARG 95 26 1 Y 1 A GLN 100 ? A GLN 96 27 1 Y 1 A GLN 101 ? A GLN 97 28 1 Y 1 A GLY 102 ? A GLY 98 29 1 Y 1 A THR 103 ? A THR 99 30 1 Y 1 A GLN 104 ? A GLN 100 31 1 Y 1 A LEU 105 ? A LEU 101 32 1 Y 1 A GLU 106 ? A GLU 102 33 1 Y 1 A HIS 107 ? A HIS 103 34 1 Y 1 A HIS 108 ? A HIS 104 35 1 Y 1 A HIS 109 ? A HIS 105 36 1 Y 1 A HIS 110 ? A HIS 106 37 1 Y 1 A HIS 111 ? A HIS 107 38 1 Y 1 A HIS 112 ? A HIS 108 # _pdbx_audit_support.funding_organization 'Ministry of Science and Technology (MoST, Taiwan)' _pdbx_audit_support.country Taiwan _pdbx_audit_support.grant_number 110-2313-B-002-042 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 1,2-ETHANEDIOL EDO 3 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _space_group.name_H-M_alt 'C 2 2 2' _space_group.name_Hall 'C 2 2' _space_group.IT_number 21 _space_group.crystal_system orthorhombic _space_group.id 1 #