data_7XJB # _entry.id 7XJB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7XJB pdb_00007xjb 10.2210/pdb7xjb/pdb WWPDB D_1300028622 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7XJB _pdbx_database_status.recvd_initial_deposition_date 2022-04-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Takebe, K.' 1 ? 'Iijima, H.' 2 ? 'Suzuki, M.' 3 ? 'Kuwada-Kusunose, T.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Chem.Inf.Model. _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1549-960X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 63 _citation.language ? _citation.page_first 4468 _citation.page_last 4476 _citation.title ;Structural and Computational Analyses of the Unique Interactions of Opicapone in the Binding Pocket of Catechol O -Methyltransferase: A Crystallographic Study and Fragment Molecular Orbital Analyses. ; _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jcim.3c00331 _citation.pdbx_database_id_PubMed 37436881 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Takebe, K.' 1 ? primary 'Suzuki, M.' 2 ? primary 'Kuwada-Kusunose, T.' 3 ? primary 'Shirai, S.' 4 ? primary 'Fukuzawa, K.' 5 0000-0001-5357-8250 primary 'Takamiya, T.' 6 ? primary 'Uzawa, N.' 7 ? primary 'Iijima, H.' 8 0000-0001-8402-0292 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7XJB _cell.details ? _cell.formula_units_Z ? _cell.length_a 166.158 _cell.length_a_esd ? _cell.length_b 166.158 _cell.length_b_esd ? _cell.length_c 125.931 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 32 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 7XJB _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Catechol O-methyltransferase' 24916.531 4 2.1.1.6 ? ? ? 2 non-polymer syn S-ADENOSYLMETHIONINE 398.437 4 ? ? ? ? 3 non-polymer syn Opicapone 413.169 4 ? ? ? ? 4 non-polymer syn 'MAGNESIUM ION' 24.305 4 ? ? ? ? 5 non-polymer syn 'CHLORIDE ION' 35.453 5 ? ? ? ? 6 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 7 water nat water 18.015 221 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSMGDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMAR LLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCG LLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDKS ; _entity_poly.pdbx_seq_one_letter_code_can ;GSMGDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMAR LLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCG LLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDKS ; _entity_poly.pdbx_strand_id A,B,C,D _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 MET n 1 4 GLY n 1 5 ASP n 1 6 THR n 1 7 LYS n 1 8 GLU n 1 9 GLN n 1 10 ARG n 1 11 ILE n 1 12 LEU n 1 13 ARG n 1 14 TYR n 1 15 VAL n 1 16 GLN n 1 17 GLN n 1 18 ASN n 1 19 ALA n 1 20 LYS n 1 21 PRO n 1 22 GLY n 1 23 ASP n 1 24 PRO n 1 25 GLN n 1 26 SER n 1 27 VAL n 1 28 LEU n 1 29 GLU n 1 30 ALA n 1 31 ILE n 1 32 ASP n 1 33 THR n 1 34 TYR n 1 35 CYS n 1 36 THR n 1 37 GLN n 1 38 LYS n 1 39 GLU n 1 40 TRP n 1 41 ALA n 1 42 MET n 1 43 ASN n 1 44 VAL n 1 45 GLY n 1 46 ASP n 1 47 ALA n 1 48 LYS n 1 49 GLY n 1 50 GLN n 1 51 ILE n 1 52 MET n 1 53 ASP n 1 54 ALA n 1 55 VAL n 1 56 ILE n 1 57 ARG n 1 58 GLU n 1 59 TYR n 1 60 SER n 1 61 PRO n 1 62 SER n 1 63 LEU n 1 64 VAL n 1 65 LEU n 1 66 GLU n 1 67 LEU n 1 68 GLY n 1 69 ALA n 1 70 TYR n 1 71 CYS n 1 72 GLY n 1 73 TYR n 1 74 SER n 1 75 ALA n 1 76 VAL n 1 77 ARG n 1 78 MET n 1 79 ALA n 1 80 ARG n 1 81 LEU n 1 82 LEU n 1 83 GLN n 1 84 PRO n 1 85 GLY n 1 86 ALA n 1 87 ARG n 1 88 LEU n 1 89 LEU n 1 90 THR n 1 91 MET n 1 92 GLU n 1 93 MET n 1 94 ASN n 1 95 PRO n 1 96 ASP n 1 97 TYR n 1 98 ALA n 1 99 ALA n 1 100 ILE n 1 101 THR n 1 102 GLN n 1 103 GLN n 1 104 MET n 1 105 LEU n 1 106 ASN n 1 107 PHE n 1 108 ALA n 1 109 GLY n 1 110 LEU n 1 111 GLN n 1 112 ASP n 1 113 LYS n 1 114 VAL n 1 115 THR n 1 116 ILE n 1 117 LEU n 1 118 ASN n 1 119 GLY n 1 120 ALA n 1 121 SER n 1 122 GLN n 1 123 ASP n 1 124 LEU n 1 125 ILE n 1 126 PRO n 1 127 GLN n 1 128 LEU n 1 129 LYS n 1 130 LYS n 1 131 LYS n 1 132 TYR n 1 133 ASP n 1 134 VAL n 1 135 ASP n 1 136 THR n 1 137 LEU n 1 138 ASP n 1 139 MET n 1 140 VAL n 1 141 PHE n 1 142 LEU n 1 143 ASP n 1 144 HIS n 1 145 TRP n 1 146 LYS n 1 147 ASP n 1 148 ARG n 1 149 TYR n 1 150 LEU n 1 151 PRO n 1 152 ASP n 1 153 THR n 1 154 LEU n 1 155 LEU n 1 156 LEU n 1 157 GLU n 1 158 LYS n 1 159 CYS n 1 160 GLY n 1 161 LEU n 1 162 LEU n 1 163 ARG n 1 164 LYS n 1 165 GLY n 1 166 THR n 1 167 VAL n 1 168 LEU n 1 169 LEU n 1 170 ALA n 1 171 ASP n 1 172 ASN n 1 173 VAL n 1 174 ILE n 1 175 VAL n 1 176 PRO n 1 177 GLY n 1 178 THR n 1 179 PRO n 1 180 ASP n 1 181 PHE n 1 182 LEU n 1 183 ALA n 1 184 TYR n 1 185 VAL n 1 186 ARG n 1 187 GLY n 1 188 SER n 1 189 SER n 1 190 SER n 1 191 PHE n 1 192 GLU n 1 193 CYS n 1 194 THR n 1 195 HIS n 1 196 TYR n 1 197 SER n 1 198 SER n 1 199 TYR n 1 200 LEU n 1 201 GLU n 1 202 TYR n 1 203 MET n 1 204 LYS n 1 205 VAL n 1 206 VAL n 1 207 ASP n 1 208 GLY n 1 209 LEU n 1 210 GLU n 1 211 LYS n 1 212 ALA n 1 213 ILE n 1 214 TYR n 1 215 GLN n 1 216 GLY n 1 217 PRO n 1 218 SER n 1 219 SER n 1 220 PRO n 1 221 ASP n 1 222 LYS n 1 223 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 223 _entity_src_gen.gene_src_common_name 'Norway rat' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Comt _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code COMT_RAT _struct_ref.pdbx_db_accession P22734 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MGDTKEQRILRYVQQNAKPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMARLL QPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEKCGLL RKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSYLEYMKVVDGLEKAIYQGPSSPDKS ; _struct_ref.pdbx_align_begin 44 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7XJB A 3 ? 223 ? P22734 44 ? 264 ? 1 221 2 1 7XJB B 3 ? 223 ? P22734 44 ? 264 ? 1 221 3 1 7XJB C 3 ? 223 ? P22734 44 ? 264 ? 1 221 4 1 7XJB D 3 ? 223 ? P22734 44 ? 264 ? 1 221 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7XJB GLY A 1 ? UNP P22734 ? ? 'expression tag' -1 1 1 7XJB SER A 2 ? UNP P22734 ? ? 'expression tag' 0 2 2 7XJB GLY B 1 ? UNP P22734 ? ? 'expression tag' -1 3 2 7XJB SER B 2 ? UNP P22734 ? ? 'expression tag' 0 4 3 7XJB GLY C 1 ? UNP P22734 ? ? 'expression tag' -1 5 3 7XJB SER C 2 ? UNP P22734 ? ? 'expression tag' 0 6 4 7XJB GLY D 1 ? UNP P22734 ? ? 'expression tag' -1 7 4 7XJB SER D 2 ? UNP P22734 ? ? 'expression tag' 0 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DNI non-polymer . Opicapone '5-[3-[2,5-bis(chloranyl)-4,6-dimethyl-1-oxidanidyl-pyridin-1-ium-3-yl]-1,2,4-oxadiazol-5-yl]-3-nitro-benzene-1,2-diol' 'C15 H10 Cl2 N4 O6' 413.169 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SAM non-polymer . S-ADENOSYLMETHIONINE ? 'C15 H22 N6 O5 S' 398.437 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7XJB _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.35 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 71.72 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;PEG 4000 Litium sulfate ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-07-08 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL41XU' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL41XU _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7XJB _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.60 _reflns.d_resolution_low 12.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 54691 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 16.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 2.60 _reflns_shell.d_res_low 2.68 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 4433 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.774 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 102.320 _refine.B_iso_mean 43.7435 _refine.B_iso_min 22.440 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7XJB _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.6000 _refine.ls_d_res_low 11.9960 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 53977 _refine.ls_number_reflns_R_free 2747 _refine.ls_number_reflns_R_work 51230 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.9900 _refine.ls_percent_reflns_R_free 5.0900 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1641 _refine.ls_R_factor_R_free 0.1944 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1624 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.340 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6LFE _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 18.7300 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2200 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.6000 _refine_hist.d_res_low 11.9960 _refine_hist.number_atoms_solvent 221 _refine_hist.number_atoms_total 7134 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 860 _refine_hist.pdbx_B_iso_mean_ligand 41.58 _refine_hist.pdbx_B_iso_mean_solvent 42.54 _refine_hist.pdbx_number_atoms_protein 6687 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 226 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 2528 3.571 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 2528 3.571 ? 1 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 3 TORSIONAL ? C 2528 3.571 ? 1 'X-RAY DIFFRACTION' 4 ? ? ? ? ? 4 TORSIONAL ? D 2528 3.571 ? 1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.6000 2.6444 . . 133 2519 100.0000 . . . 0.2975 0.0000 0.2350 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6444 2.6919 . . 128 2553 100.0000 . . . 0.2605 0.0000 0.2162 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6919 2.7431 . . 147 2506 100.0000 . . . 0.2323 0.0000 0.2176 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7431 2.7984 . . 134 2533 100.0000 . . . 0.2194 0.0000 0.2099 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7984 2.8584 . . 135 2527 100.0000 . . . 0.2616 0.0000 0.2120 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8584 2.9240 . . 126 2535 100.0000 . . . 0.2569 0.0000 0.2031 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9240 2.9960 . . 146 2526 100.0000 . . . 0.2303 0.0000 0.1868 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9960 3.0757 . . 133 2540 100.0000 . . . 0.2477 0.0000 0.1891 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0757 3.1646 . . 141 2527 100.0000 . . . 0.2053 0.0000 0.1841 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1646 3.2648 . . 130 2555 100.0000 . . . 0.2214 0.0000 0.1716 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2648 3.3789 . . 123 2559 100.0000 . . . 0.2086 0.0000 0.1711 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3789 3.5110 . . 139 2557 100.0000 . . . 0.1706 0.0000 0.1537 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5110 3.6664 . . 155 2534 100.0000 . . . 0.1910 0.0000 0.1473 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6664 3.8536 . . 132 2562 100.0000 . . . 0.1932 0.0000 0.1462 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.8536 4.0861 . . 116 2603 100.0000 . . . 0.1825 0.0000 0.1390 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0861 4.3872 . . 153 2551 100.0000 . . . 0.1421 0.0000 0.1321 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.3872 4.8028 . . 131 2594 100.0000 . . . 0.1498 0.0000 0.1238 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.8028 5.4402 . . 141 2611 100.0000 . . . 0.1707 0.0000 0.1450 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.4402 6.6535 . . 139 2651 100.0000 . . . 0.2007 0.0000 0.1805 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.6535 11.996 . . 165 2687 100.0000 . . . 0.1885 0.0000 0.1533 . . . . . . . . . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and (resid 3 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or (resid 36 and (name N or name CA or name C or name O or name CB )) or resid 37 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 189 or (resid 190 and (name N or name CA or name C or name O or name CB )) or resid 191 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB or name CG )) or resid 203 through 215)) ; 1 2 ;(chain B and (resid 3 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or (resid 36 and (name N or name CA or name C or name O or name CB )) or resid 37 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 189 or (resid 190 and (name N or name CA or name C or name O or name CB )) or resid 191 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB or name CG )) or resid 203 through 215)) ; 1 3 ;(chain C and (resid 3 through 22 or resid 24 through 34 or (resid 36 and (name N or name CA or name C or name O or name CB )) or resid 37 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 189 or (resid 190 and (name N or name CA or name C or name O or name CB )) or resid 191 through 215)) ; 1 4 ;(chain D and (resid 3 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or resid 36 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 215)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A ASP 5 . A LEU 12 . A ASP 3 A LEU 10 ? ;(chain A and (resid 3 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or (resid 36 and (name N or name CA or name C or name O or name CB )) or resid 37 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 189 or (resid 190 and (name N or name CA or name C or name O or name CB )) or resid 191 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB or name CG )) or resid 203 through 215)) ; 1 1 2 A ARG 13 . A ARG 13 . A ARG 11 A ARG 11 ? ;(chain A and (resid 3 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or (resid 36 and (name N or name CA or name C or name O or name CB )) or resid 37 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 189 or (resid 190 and (name N or name CA or name C or name O or name CB )) or resid 191 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB or name CG )) or resid 203 through 215)) ; 1 1 3 A SER 2 . A SER 218 . A SER 0 A SER 216 ? ;(chain A and (resid 3 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or (resid 36 and (name N or name CA or name C or name O or name CB )) or resid 37 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 189 or (resid 190 and (name N or name CA or name C or name O or name CB )) or resid 191 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB or name CG )) or resid 203 through 215)) ; 1 1 4 A SER 2 . A SER 218 . A SER 0 A SER 216 ? ;(chain A and (resid 3 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or (resid 36 and (name N or name CA or name C or name O or name CB )) or resid 37 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 189 or (resid 190 and (name N or name CA or name C or name O or name CB )) or resid 191 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB or name CG )) or resid 203 through 215)) ; 1 1 5 A SER 2 . A SER 218 . A SER 0 A SER 216 ? ;(chain A and (resid 3 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or (resid 36 and (name N or name CA or name C or name O or name CB )) or resid 37 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 189 or (resid 190 and (name N or name CA or name C or name O or name CB )) or resid 191 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB or name CG )) or resid 203 through 215)) ; 1 1 6 A SER 2 . A SER 218 . A SER 0 A SER 216 ? ;(chain A and (resid 3 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or (resid 36 and (name N or name CA or name C or name O or name CB )) or resid 37 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 189 or (resid 190 and (name N or name CA or name C or name O or name CB )) or resid 191 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB or name CG )) or resid 203 through 215)) ; 1 2 1 B ASP 5 . B LEU 12 . B ASP 3 B LEU 10 ? ;(chain B and (resid 3 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or (resid 36 and (name N or name CA or name C or name O or name CB )) or resid 37 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 189 or (resid 190 and (name N or name CA or name C or name O or name CB )) or resid 191 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB or name CG )) or resid 203 through 215)) ; 1 2 2 B ARG 13 . B ARG 13 . B ARG 11 B ARG 11 ? ;(chain B and (resid 3 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or (resid 36 and (name N or name CA or name C or name O or name CB )) or resid 37 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 189 or (resid 190 and (name N or name CA or name C or name O or name CB )) or resid 191 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB or name CG )) or resid 203 through 215)) ; 1 2 3 B SER 2 . B SER 218 . B SER 0 B SER 216 ? ;(chain B and (resid 3 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or (resid 36 and (name N or name CA or name C or name O or name CB )) or resid 37 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 189 or (resid 190 and (name N or name CA or name C or name O or name CB )) or resid 191 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB or name CG )) or resid 203 through 215)) ; 1 2 4 B SER 2 . B SER 218 . B SER 0 B SER 216 ? ;(chain B and (resid 3 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or (resid 36 and (name N or name CA or name C or name O or name CB )) or resid 37 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 189 or (resid 190 and (name N or name CA or name C or name O or name CB )) or resid 191 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB or name CG )) or resid 203 through 215)) ; 1 2 5 B SER 2 . B SER 218 . B SER 0 B SER 216 ? ;(chain B and (resid 3 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or (resid 36 and (name N or name CA or name C or name O or name CB )) or resid 37 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 189 or (resid 190 and (name N or name CA or name C or name O or name CB )) or resid 191 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB or name CG )) or resid 203 through 215)) ; 1 2 6 B SER 2 . B SER 218 . B SER 0 B SER 216 ? ;(chain B and (resid 3 through 10 or (resid 11 and (name N or name CA or name C or name O or name CB )) or resid 12 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or (resid 36 and (name N or name CA or name C or name O or name CB )) or resid 37 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 127 or (resid 128 through 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 189 or (resid 190 and (name N or name CA or name C or name O or name CB )) or resid 191 through 201 or (resid 202 and (name N or name CA or name C or name O or name CB or name CG )) or resid 203 through 215)) ; 1 3 1 C ASP 5 . C PRO 24 . C ASP 3 C PRO 22 ? ;(chain C and (resid 3 through 22 or resid 24 through 34 or (resid 36 and (name N or name CA or name C or name O or name CB )) or resid 37 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 189 or (resid 190 and (name N or name CA or name C or name O or name CB )) or resid 191 through 215)) ; 1 3 2 C SER 26 . C THR 36 . C SER 24 C THR 34 ? ;(chain C and (resid 3 through 22 or resid 24 through 34 or (resid 36 and (name N or name CA or name C or name O or name CB )) or resid 37 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 189 or (resid 190 and (name N or name CA or name C or name O or name CB )) or resid 191 through 215)) ; 1 3 3 C LYS 38 . C LYS 38 . C LYS 36 C LYS 36 ? ;(chain C and (resid 3 through 22 or resid 24 through 34 or (resid 36 and (name N or name CA or name C or name O or name CB )) or resid 37 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 189 or (resid 190 and (name N or name CA or name C or name O or name CB )) or resid 191 through 215)) ; 1 3 4 C ASP 5 . C PRO 217 . C ASP 3 C PRO 215 ? ;(chain C and (resid 3 through 22 or resid 24 through 34 or (resid 36 and (name N or name CA or name C or name O or name CB )) or resid 37 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 189 or (resid 190 and (name N or name CA or name C or name O or name CB )) or resid 191 through 215)) ; 1 3 5 C GLU 39 . C GLU 39 . C GLU 37 C GLU 37 ? ;(chain C and (resid 3 through 22 or resid 24 through 34 or (resid 36 and (name N or name CA or name C or name O or name CB )) or resid 37 through 80 or (resid 81 and (name N or name CA or name C or name O or name CB )) or resid 82 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 189 or (resid 190 and (name N or name CA or name C or name O or name CB )) or resid 191 through 215)) ; 1 4 1 D ASP 5 . D ALA 19 . D ASP 3 D ALA 17 ? ;(chain D and (resid 3 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or resid 36 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 215)) ; 1 4 2 D LYS 20 . D LYS 20 . D LYS 18 D LYS 18 ? ;(chain D and (resid 3 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or resid 36 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 215)) ; 1 4 3 D PRO 21 . D PRO 24 . D PRO 19 D PRO 22 ? ;(chain D and (resid 3 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or resid 36 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 215)) ; 1 4 4 D SER 26 . D THR 36 . D SER 24 D THR 34 ? ;(chain D and (resid 3 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or resid 36 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 215)) ; 1 4 5 D LYS 38 . D THR 101 . D LYS 36 D THR 99 ? ;(chain D and (resid 3 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or resid 36 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 215)) ; 1 4 6 D GLN 102 . D GLN 102 . D GLN 100 D GLN 100 ? ;(chain D and (resid 3 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or resid 36 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 215)) ; 1 4 7 D GLN 103 . D LEU 110 . D GLN 101 D LEU 108 ? ;(chain D and (resid 3 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or resid 36 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 215)) ; 1 4 8 D GLN 111 . D GLN 111 . D GLN 109 D GLN 109 ? ;(chain D and (resid 3 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or resid 36 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 215)) ; 1 4 9 D ASP 112 . D LYS 130 . D ASP 110 D LYS 128 ? ;(chain D and (resid 3 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or resid 36 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 215)) ; 1 4 10 D LYS 131 . D LYS 131 . D LYS 129 D LYS 129 ? ;(chain D and (resid 3 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or resid 36 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 215)) ; 1 4 11 D TYR 132 . D GLU 157 . D TYR 130 D GLU 155 ? ;(chain D and (resid 3 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or resid 36 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 215)) ; 1 4 12 D LYS 158 . D LYS 158 . D LYS 156 D LYS 156 ? ;(chain D and (resid 3 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or resid 36 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 215)) ; 1 4 13 D CYS 159 . D ARG 163 . D CYS 157 D ARG 161 ? ;(chain D and (resid 3 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or resid 36 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 215)) ; 1 4 14 D LYS 164 . D LYS 164 . D LYS 162 D LYS 162 ? ;(chain D and (resid 3 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or resid 36 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 215)) ; 1 4 15 D GLY 165 . D PRO 217 . D GLY 163 D PRO 215 ? ;(chain D and (resid 3 through 17 or (resid 18 and (name N or name CA or name C or name O or name CB )) or resid 19 through 22 or resid 24 through 34 or resid 36 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 101 through 108 or (resid 109 and (name N or name CA or name C or name O or name CB )) or resid 110 through 128 or (resid 129 and (name N or name CA or name C or name O or name CB )) or resid 130 through 155 or (resid 156 and (name N or name CA or name C or name O or name CB )) or resid 157 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 215)) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 7XJB _struct.title 'Rat-COMT, opicapone,SAM and Mg bond' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7XJB _struct_keywords.text 'Enzyme S-adenosylmethionone catechol, catecholamine, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 2 ? F N N 3 ? G N N 4 ? H N N 5 ? I N N 6 ? J N N 2 ? K N N 3 ? L N N 4 ? M N N 5 ? N N N 2 ? O N N 3 ? P N N 4 ? Q N N 5 ? R N N 2 ? S N N 3 ? T N N 4 ? U N N 5 ? V N N 5 ? W N N 7 ? X N N 7 ? Y N N 7 ? Z N N 7 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 6 ? ALA A 19 ? THR A 4 ALA A 17 1 ? 14 HELX_P HELX_P2 AA2 ASP A 23 ? LYS A 38 ? ASP A 21 LYS A 36 1 ? 16 HELX_P HELX_P3 AA3 VAL A 44 ? SER A 60 ? VAL A 42 SER A 58 1 ? 17 HELX_P HELX_P4 AA4 GLY A 72 ? ARG A 80 ? GLY A 70 ARG A 78 1 ? 9 HELX_P HELX_P5 AA5 ASN A 94 ? GLY A 109 ? ASN A 92 GLY A 107 1 ? 16 HELX_P HELX_P6 AA6 ALA A 120 ? ILE A 125 ? ALA A 118 ILE A 123 1 ? 6 HELX_P HELX_P7 AA7 GLN A 127 ? TYR A 132 ? GLN A 125 TYR A 130 1 ? 6 HELX_P HELX_P8 AA8 TRP A 145 ? ASP A 147 ? TRP A 143 ASP A 145 5 ? 3 HELX_P HELX_P9 AA9 ARG A 148 ? CYS A 159 ? ARG A 146 CYS A 157 1 ? 12 HELX_P HELX_P10 AB1 THR A 178 ? SER A 188 ? THR A 176 SER A 186 1 ? 11 HELX_P HELX_P11 AB2 THR B 6 ? ALA B 19 ? THR B 4 ALA B 17 1 ? 14 HELX_P HELX_P12 AB3 ASP B 23 ? LYS B 38 ? ASP B 21 LYS B 36 1 ? 16 HELX_P HELX_P13 AB4 VAL B 44 ? SER B 60 ? VAL B 42 SER B 58 1 ? 17 HELX_P HELX_P14 AB5 GLY B 72 ? ARG B 80 ? GLY B 70 ARG B 78 1 ? 9 HELX_P HELX_P15 AB6 ASN B 94 ? GLY B 109 ? ASN B 92 GLY B 107 1 ? 16 HELX_P HELX_P16 AB7 ALA B 120 ? ILE B 125 ? ALA B 118 ILE B 123 1 ? 6 HELX_P HELX_P17 AB8 GLN B 127 ? TYR B 132 ? GLN B 125 TYR B 130 1 ? 6 HELX_P HELX_P18 AB9 TRP B 145 ? ASP B 147 ? TRP B 143 ASP B 145 5 ? 3 HELX_P HELX_P19 AC1 ARG B 148 ? CYS B 159 ? ARG B 146 CYS B 157 1 ? 12 HELX_P HELX_P20 AC2 THR B 178 ? SER B 188 ? THR B 176 SER B 186 1 ? 11 HELX_P HELX_P21 AC3 THR C 6 ? ALA C 19 ? THR C 4 ALA C 17 1 ? 14 HELX_P HELX_P22 AC4 ASP C 23 ? LYS C 38 ? ASP C 21 LYS C 36 1 ? 16 HELX_P HELX_P23 AC5 VAL C 44 ? SER C 60 ? VAL C 42 SER C 58 1 ? 17 HELX_P HELX_P24 AC6 GLY C 72 ? ARG C 80 ? GLY C 70 ARG C 78 1 ? 9 HELX_P HELX_P25 AC7 ASN C 94 ? GLY C 109 ? ASN C 92 GLY C 107 1 ? 16 HELX_P HELX_P26 AC8 LEU C 110 ? ASP C 112 ? LEU C 108 ASP C 110 5 ? 3 HELX_P HELX_P27 AC9 ALA C 120 ? ILE C 125 ? ALA C 118 ILE C 123 1 ? 6 HELX_P HELX_P28 AD1 GLN C 127 ? TYR C 132 ? GLN C 125 TYR C 130 1 ? 6 HELX_P HELX_P29 AD2 TRP C 145 ? ASP C 147 ? TRP C 143 ASP C 145 5 ? 3 HELX_P HELX_P30 AD3 ARG C 148 ? CYS C 159 ? ARG C 146 CYS C 157 1 ? 12 HELX_P HELX_P31 AD4 THR C 178 ? SER C 188 ? THR C 176 SER C 186 1 ? 11 HELX_P HELX_P32 AD5 THR D 6 ? ALA D 19 ? THR D 4 ALA D 17 1 ? 14 HELX_P HELX_P33 AD6 ASP D 23 ? LYS D 38 ? ASP D 21 LYS D 36 1 ? 16 HELX_P HELX_P34 AD7 VAL D 44 ? SER D 60 ? VAL D 42 SER D 58 1 ? 17 HELX_P HELX_P35 AD8 GLY D 72 ? ARG D 80 ? GLY D 70 ARG D 78 1 ? 9 HELX_P HELX_P36 AD9 ASN D 94 ? GLY D 109 ? ASN D 92 GLY D 107 1 ? 16 HELX_P HELX_P37 AE1 ALA D 120 ? ILE D 125 ? ALA D 118 ILE D 123 1 ? 6 HELX_P HELX_P38 AE2 GLN D 127 ? TYR D 132 ? GLN D 125 TYR D 130 1 ? 6 HELX_P HELX_P39 AE3 TRP D 145 ? ASP D 147 ? TRP D 143 ASP D 145 5 ? 3 HELX_P HELX_P40 AE4 ARG D 148 ? CYS D 159 ? ARG D 146 CYS D 157 1 ? 12 HELX_P HELX_P41 AE5 THR D 178 ? SER D 188 ? THR D 176 SER D 186 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 143 OD1 ? ? ? 1_555 G MG . MG ? ? A ASP 141 A MG 303 1_555 ? ? ? ? ? ? ? 2.075 ? ? metalc2 metalc ? ? A ASP 171 OD2 ? ? ? 1_555 G MG . MG ? ? A ASP 169 A MG 303 1_555 ? ? ? ? ? ? ? 1.943 ? ? metalc3 metalc ? ? A ASN 172 OD1 ? ? ? 1_555 G MG . MG ? ? A ASN 170 A MG 303 1_555 ? ? ? ? ? ? ? 2.069 ? ? metalc4 metalc ? ? F DNI . O23 ? ? ? 1_555 G MG . MG ? ? A DNI 302 A MG 303 1_555 ? ? ? ? ? ? ? 2.027 ? ? metalc5 metalc ? ? F DNI . O24 ? ? ? 1_555 G MG . MG ? ? A DNI 302 A MG 303 1_555 ? ? ? ? ? ? ? 2.045 ? ? metalc6 metalc ? ? G MG . MG ? ? ? 1_555 W HOH . O ? ? A MG 303 A HOH 411 1_555 ? ? ? ? ? ? ? 1.958 ? ? metalc7 metalc ? ? B ASP 143 OD1 ? ? ? 1_555 L MG . MG ? ? B ASP 141 B MG 303 1_555 ? ? ? ? ? ? ? 2.072 ? ? metalc8 metalc ? ? B ASP 171 OD2 ? ? ? 1_555 L MG . MG ? ? B ASP 169 B MG 303 1_555 ? ? ? ? ? ? ? 2.006 ? ? metalc9 metalc ? ? B ASN 172 OD1 ? ? ? 1_555 L MG . MG ? ? B ASN 170 B MG 303 1_555 ? ? ? ? ? ? ? 2.098 ? ? metalc10 metalc ? ? K DNI . O23 ? ? ? 1_555 L MG . MG ? ? B DNI 302 B MG 303 1_555 ? ? ? ? ? ? ? 2.087 ? ? metalc11 metalc ? ? K DNI . O24 ? ? ? 1_555 L MG . MG ? ? B DNI 302 B MG 303 1_555 ? ? ? ? ? ? ? 1.972 ? ? metalc12 metalc ? ? L MG . MG ? ? ? 1_555 X HOH . O ? ? B MG 303 B HOH 404 1_555 ? ? ? ? ? ? ? 2.052 ? ? metalc13 metalc ? ? C ASP 143 OD1 ? ? ? 1_555 P MG . MG ? ? C ASP 141 C MG 303 1_555 ? ? ? ? ? ? ? 2.004 ? ? metalc14 metalc ? ? C ASP 171 OD2 ? ? ? 1_555 P MG . MG ? ? C ASP 169 C MG 303 1_555 ? ? ? ? ? ? ? 2.041 ? ? metalc15 metalc ? ? C ASN 172 OD1 ? ? ? 1_555 P MG . MG ? ? C ASN 170 C MG 303 1_555 ? ? ? ? ? ? ? 2.060 ? ? metalc16 metalc ? ? O DNI . O23 ? ? ? 1_555 P MG . MG ? ? C DNI 302 C MG 303 1_555 ? ? ? ? ? ? ? 2.158 ? ? metalc17 metalc ? ? O DNI . O24 ? ? ? 1_555 P MG . MG ? ? C DNI 302 C MG 303 1_555 ? ? ? ? ? ? ? 1.916 ? ? metalc18 metalc ? ? P MG . MG ? ? ? 1_555 Y HOH . O ? ? C MG 303 C HOH 402 1_555 ? ? ? ? ? ? ? 2.006 ? ? metalc19 metalc ? ? D ASP 143 OD1 ? ? ? 1_555 T MG . MG ? ? D ASP 141 D MG 303 1_555 ? ? ? ? ? ? ? 2.038 ? ? metalc20 metalc ? ? D ASP 143 OD2 ? ? ? 1_555 T MG . MG ? ? D ASP 141 D MG 303 1_555 ? ? ? ? ? ? ? 2.996 ? ? metalc21 metalc ? ? D ASP 171 OD2 ? ? ? 1_555 T MG . MG ? ? D ASP 169 D MG 303 1_555 ? ? ? ? ? ? ? 1.993 ? ? metalc22 metalc ? ? D ASN 172 OD1 ? ? ? 1_555 T MG . MG ? ? D ASN 170 D MG 303 1_555 ? ? ? ? ? ? ? 2.023 ? ? metalc23 metalc ? ? S DNI . O23 ? ? ? 1_555 T MG . MG ? ? D DNI 302 D MG 303 1_555 ? ? ? ? ? ? ? 2.197 ? ? metalc24 metalc ? ? S DNI . O24 ? ? ? 1_555 T MG . MG ? ? D DNI 302 D MG 303 1_555 ? ? ? ? ? ? ? 1.975 ? ? metalc25 metalc ? ? T MG . MG ? ? ? 1_555 Z HOH . O ? ? D MG 303 D HOH 403 1_555 ? ? ? ? ? ? ? 2.100 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 VAL 175 A . ? VAL 173 A PRO 176 A ? PRO 174 A 1 -3.51 2 VAL 175 B . ? VAL 173 B PRO 176 B ? PRO 174 B 1 -4.02 3 VAL 175 C . ? VAL 173 C PRO 176 C ? PRO 174 C 1 -3.12 4 VAL 175 D . ? VAL 173 D PRO 176 D ? PRO 174 D 1 -2.66 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 7 ? AA3 ? 7 ? AA4 ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel AA2 4 5 ? parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? parallel AA3 3 4 ? parallel AA3 4 5 ? parallel AA3 5 6 ? anti-parallel AA3 6 7 ? anti-parallel AA4 1 2 ? parallel AA4 2 3 ? parallel AA4 3 4 ? parallel AA4 4 5 ? parallel AA4 5 6 ? anti-parallel AA4 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 114 ? ASN A 118 ? VAL A 112 ASN A 116 AA1 2 ARG A 87 ? GLU A 92 ? ARG A 85 GLU A 90 AA1 3 LEU A 63 ? LEU A 67 ? LEU A 61 LEU A 65 AA1 4 LEU A 137 ? LEU A 142 ? LEU A 135 LEU A 140 AA1 5 LEU A 162 ? ALA A 170 ? LEU A 160 ALA A 168 AA1 6 VAL A 206 ? TYR A 214 ? VAL A 204 TYR A 212 AA1 7 PHE A 191 ? TYR A 199 ? PHE A 189 TYR A 197 AA2 1 VAL B 114 ? ASN B 118 ? VAL B 112 ASN B 116 AA2 2 ARG B 87 ? GLU B 92 ? ARG B 85 GLU B 90 AA2 3 LEU B 63 ? LEU B 67 ? LEU B 61 LEU B 65 AA2 4 LEU B 137 ? LEU B 142 ? LEU B 135 LEU B 140 AA2 5 LEU B 162 ? ALA B 170 ? LEU B 160 ALA B 168 AA2 6 VAL B 206 ? TYR B 214 ? VAL B 204 TYR B 212 AA2 7 PHE B 191 ? TYR B 199 ? PHE B 189 TYR B 197 AA3 1 VAL C 114 ? ASN C 118 ? VAL C 112 ASN C 116 AA3 2 ARG C 87 ? GLU C 92 ? ARG C 85 GLU C 90 AA3 3 LEU C 63 ? LEU C 67 ? LEU C 61 LEU C 65 AA3 4 MET C 139 ? LEU C 142 ? MET C 137 LEU C 140 AA3 5 VAL C 167 ? ALA C 170 ? VAL C 165 ALA C 168 AA3 6 VAL C 206 ? TYR C 214 ? VAL C 204 TYR C 212 AA3 7 PHE C 191 ? TYR C 199 ? PHE C 189 TYR C 197 AA4 1 VAL D 114 ? ASN D 118 ? VAL D 112 ASN D 116 AA4 2 ARG D 87 ? GLU D 92 ? ARG D 85 GLU D 90 AA4 3 LEU D 63 ? LEU D 67 ? LEU D 61 LEU D 65 AA4 4 MET D 139 ? LEU D 142 ? MET D 137 LEU D 140 AA4 5 VAL D 167 ? ALA D 170 ? VAL D 165 ALA D 168 AA4 6 VAL D 206 ? TYR D 214 ? VAL D 204 TYR D 212 AA4 7 PHE D 191 ? TYR D 199 ? PHE D 189 TYR D 197 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O LEU A 117 ? O LEU A 115 N THR A 90 ? N THR A 88 AA1 2 3 O LEU A 89 ? O LEU A 87 N VAL A 64 ? N VAL A 62 AA1 3 4 N LEU A 67 ? N LEU A 65 O PHE A 141 ? O PHE A 139 AA1 4 5 N VAL A 140 ? N VAL A 138 O LEU A 169 ? O LEU A 167 AA1 5 6 N LEU A 168 ? N LEU A 166 O ALA A 212 ? O ALA A 210 AA1 6 7 O LEU A 209 ? O LEU A 207 N TYR A 196 ? N TYR A 194 AA2 1 2 O LEU B 117 ? O LEU B 115 N THR B 90 ? N THR B 88 AA2 2 3 O LEU B 89 ? O LEU B 87 N VAL B 64 ? N VAL B 62 AA2 3 4 N LEU B 67 ? N LEU B 65 O PHE B 141 ? O PHE B 139 AA2 4 5 N VAL B 140 ? N VAL B 138 O VAL B 167 ? O VAL B 165 AA2 5 6 N LEU B 168 ? N LEU B 166 O ALA B 212 ? O ALA B 210 AA2 6 7 O LYS B 211 ? O LYS B 209 N THR B 194 ? N THR B 192 AA3 1 2 O LEU C 117 ? O LEU C 115 N THR C 90 ? N THR C 88 AA3 2 3 O LEU C 89 ? O LEU C 87 N GLU C 66 ? N GLU C 64 AA3 3 4 N LEU C 65 ? N LEU C 63 O PHE C 141 ? O PHE C 139 AA3 4 5 N VAL C 140 ? N VAL C 138 O LEU C 169 ? O LEU C 167 AA3 5 6 N LEU C 168 ? N LEU C 166 O ALA C 212 ? O ALA C 210 AA3 6 7 O ASP C 207 ? O ASP C 205 N SER C 198 ? N SER C 196 AA4 1 2 O LEU D 117 ? O LEU D 115 N THR D 90 ? N THR D 88 AA4 2 3 O LEU D 89 ? O LEU D 87 N VAL D 64 ? N VAL D 62 AA4 3 4 N LEU D 67 ? N LEU D 65 O PHE D 141 ? O PHE D 139 AA4 4 5 N VAL D 140 ? N VAL D 138 O LEU D 169 ? O LEU D 167 AA4 5 6 N LEU D 168 ? N LEU D 166 O ALA D 212 ? O ALA D 210 AA4 6 7 O ASP D 207 ? O ASP D 205 N SER D 198 ? N SER D 196 # _atom_sites.entry_id 7XJB _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.006018 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006018 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007941 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL MG N NA O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 ? ? ? A . n A 1 2 SER 2 0 0 SER ALA A . n A 1 3 MET 3 1 1 MET MET A . n A 1 4 GLY 4 2 2 GLY GLY A . n A 1 5 ASP 5 3 3 ASP ASP A . n A 1 6 THR 6 4 4 THR THR A . n A 1 7 LYS 7 5 5 LYS LYS A . n A 1 8 GLU 8 6 6 GLU GLU A . n A 1 9 GLN 9 7 7 GLN GLN A . n A 1 10 ARG 10 8 8 ARG ARG A . n A 1 11 ILE 11 9 9 ILE ILE A . n A 1 12 LEU 12 10 10 LEU LEU A . n A 1 13 ARG 13 11 11 ARG ARG A . n A 1 14 TYR 14 12 12 TYR TYR A . n A 1 15 VAL 15 13 13 VAL VAL A . n A 1 16 GLN 16 14 14 GLN GLN A . n A 1 17 GLN 17 15 15 GLN GLN A . n A 1 18 ASN 18 16 16 ASN ASN A . n A 1 19 ALA 19 17 17 ALA ALA A . n A 1 20 LYS 20 18 18 LYS LYS A . n A 1 21 PRO 21 19 19 PRO PRO A . n A 1 22 GLY 22 20 20 GLY GLY A . n A 1 23 ASP 23 21 21 ASP ASP A . n A 1 24 PRO 24 22 22 PRO PRO A . n A 1 25 GLN 25 23 23 GLN GLN A . n A 1 26 SER 26 24 24 SER SER A . n A 1 27 VAL 27 25 25 VAL VAL A . n A 1 28 LEU 28 26 26 LEU LEU A . n A 1 29 GLU 29 27 27 GLU GLU A . n A 1 30 ALA 30 28 28 ALA ALA A . n A 1 31 ILE 31 29 29 ILE ILE A . n A 1 32 ASP 32 30 30 ASP ASP A . n A 1 33 THR 33 31 31 THR THR A . n A 1 34 TYR 34 32 32 TYR TYR A . n A 1 35 CYS 35 33 33 CYS CYS A . n A 1 36 THR 36 34 34 THR THR A . n A 1 37 GLN 37 35 35 GLN GLN A . n A 1 38 LYS 38 36 36 LYS LYS A . n A 1 39 GLU 39 37 37 GLU GLU A . n A 1 40 TRP 40 38 38 TRP TRP A . n A 1 41 ALA 41 39 39 ALA ALA A . n A 1 42 MET 42 40 40 MET MET A . n A 1 43 ASN 43 41 41 ASN ASN A . n A 1 44 VAL 44 42 42 VAL VAL A . n A 1 45 GLY 45 43 43 GLY GLY A . n A 1 46 ASP 46 44 44 ASP ASP A . n A 1 47 ALA 47 45 45 ALA ALA A . n A 1 48 LYS 48 46 46 LYS LYS A . n A 1 49 GLY 49 47 47 GLY GLY A . n A 1 50 GLN 50 48 48 GLN GLN A . n A 1 51 ILE 51 49 49 ILE ILE A . n A 1 52 MET 52 50 50 MET MET A . n A 1 53 ASP 53 51 51 ASP ASP A . n A 1 54 ALA 54 52 52 ALA ALA A . n A 1 55 VAL 55 53 53 VAL VAL A . n A 1 56 ILE 56 54 54 ILE ILE A . n A 1 57 ARG 57 55 55 ARG ARG A . n A 1 58 GLU 58 56 56 GLU GLU A . n A 1 59 TYR 59 57 57 TYR TYR A . n A 1 60 SER 60 58 58 SER SER A . n A 1 61 PRO 61 59 59 PRO PRO A . n A 1 62 SER 62 60 60 SER SER A . n A 1 63 LEU 63 61 61 LEU LEU A . n A 1 64 VAL 64 62 62 VAL VAL A . n A 1 65 LEU 65 63 63 LEU LEU A . n A 1 66 GLU 66 64 64 GLU GLU A . n A 1 67 LEU 67 65 65 LEU LEU A . n A 1 68 GLY 68 66 66 GLY GLY A . n A 1 69 ALA 69 67 67 ALA ALA A . n A 1 70 TYR 70 68 68 TYR TYR A . n A 1 71 CYS 71 69 69 CYS CYS A . n A 1 72 GLY 72 70 70 GLY GLY A . n A 1 73 TYR 73 71 71 TYR TYR A . n A 1 74 SER 74 72 72 SER SER A . n A 1 75 ALA 75 73 73 ALA ALA A . n A 1 76 VAL 76 74 74 VAL VAL A . n A 1 77 ARG 77 75 75 ARG ARG A . n A 1 78 MET 78 76 76 MET MET A . n A 1 79 ALA 79 77 77 ALA ALA A . n A 1 80 ARG 80 78 78 ARG ARG A . n A 1 81 LEU 81 79 79 LEU LEU A . n A 1 82 LEU 82 80 80 LEU LEU A . n A 1 83 GLN 83 81 81 GLN GLN A . n A 1 84 PRO 84 82 82 PRO PRO A . n A 1 85 GLY 85 83 83 GLY GLY A . n A 1 86 ALA 86 84 84 ALA ALA A . n A 1 87 ARG 87 85 85 ARG ARG A . n A 1 88 LEU 88 86 86 LEU LEU A . n A 1 89 LEU 89 87 87 LEU LEU A . n A 1 90 THR 90 88 88 THR THR A . n A 1 91 MET 91 89 89 MET MET A . n A 1 92 GLU 92 90 90 GLU GLU A . n A 1 93 MET 93 91 91 MET MET A . n A 1 94 ASN 94 92 92 ASN ASN A . n A 1 95 PRO 95 93 93 PRO PRO A . n A 1 96 ASP 96 94 94 ASP ASP A . n A 1 97 TYR 97 95 95 TYR TYR A . n A 1 98 ALA 98 96 96 ALA ALA A . n A 1 99 ALA 99 97 97 ALA ALA A . n A 1 100 ILE 100 98 98 ILE ILE A . n A 1 101 THR 101 99 99 THR THR A . n A 1 102 GLN 102 100 100 GLN GLN A . n A 1 103 GLN 103 101 101 GLN GLN A . n A 1 104 MET 104 102 102 MET MET A . n A 1 105 LEU 105 103 103 LEU LEU A . n A 1 106 ASN 106 104 104 ASN ASN A . n A 1 107 PHE 107 105 105 PHE PHE A . n A 1 108 ALA 108 106 106 ALA ALA A . n A 1 109 GLY 109 107 107 GLY GLY A . n A 1 110 LEU 110 108 108 LEU LEU A . n A 1 111 GLN 111 109 109 GLN GLN A . n A 1 112 ASP 112 110 110 ASP ASP A . n A 1 113 LYS 113 111 111 LYS LYS A . n A 1 114 VAL 114 112 112 VAL VAL A . n A 1 115 THR 115 113 113 THR THR A . n A 1 116 ILE 116 114 114 ILE ILE A . n A 1 117 LEU 117 115 115 LEU LEU A . n A 1 118 ASN 118 116 116 ASN ASN A . n A 1 119 GLY 119 117 117 GLY GLY A . n A 1 120 ALA 120 118 118 ALA ALA A . n A 1 121 SER 121 119 119 SER SER A . n A 1 122 GLN 122 120 120 GLN GLN A . n A 1 123 ASP 123 121 121 ASP ASP A . n A 1 124 LEU 124 122 122 LEU LEU A . n A 1 125 ILE 125 123 123 ILE ILE A . n A 1 126 PRO 126 124 124 PRO PRO A . n A 1 127 GLN 127 125 125 GLN GLN A . n A 1 128 LEU 128 126 126 LEU LEU A . n A 1 129 LYS 129 127 127 LYS LYS A . n A 1 130 LYS 130 128 128 LYS LYS A . n A 1 131 LYS 131 129 129 LYS LYS A . n A 1 132 TYR 132 130 130 TYR TYR A . n A 1 133 ASP 133 131 131 ASP ASP A . n A 1 134 VAL 134 132 132 VAL VAL A . n A 1 135 ASP 135 133 133 ASP ASP A . n A 1 136 THR 136 134 134 THR THR A . n A 1 137 LEU 137 135 135 LEU LEU A . n A 1 138 ASP 138 136 136 ASP ASP A . n A 1 139 MET 139 137 137 MET MET A . n A 1 140 VAL 140 138 138 VAL VAL A . n A 1 141 PHE 141 139 139 PHE PHE A . n A 1 142 LEU 142 140 140 LEU LEU A . n A 1 143 ASP 143 141 141 ASP ASP A . n A 1 144 HIS 144 142 142 HIS HIS A . n A 1 145 TRP 145 143 143 TRP TRP A . n A 1 146 LYS 146 144 144 LYS LYS A . n A 1 147 ASP 147 145 145 ASP ASP A . n A 1 148 ARG 148 146 146 ARG ARG A . n A 1 149 TYR 149 147 147 TYR TYR A . n A 1 150 LEU 150 148 148 LEU LEU A . n A 1 151 PRO 151 149 149 PRO PRO A . n A 1 152 ASP 152 150 150 ASP ASP A . n A 1 153 THR 153 151 151 THR THR A . n A 1 154 LEU 154 152 152 LEU LEU A . n A 1 155 LEU 155 153 153 LEU LEU A . n A 1 156 LEU 156 154 154 LEU LEU A . n A 1 157 GLU 157 155 155 GLU GLU A . n A 1 158 LYS 158 156 156 LYS LYS A . n A 1 159 CYS 159 157 157 CYS CYS A . n A 1 160 GLY 160 158 158 GLY GLY A . n A 1 161 LEU 161 159 159 LEU LEU A . n A 1 162 LEU 162 160 160 LEU LEU A . n A 1 163 ARG 163 161 161 ARG ARG A . n A 1 164 LYS 164 162 162 LYS LYS A . n A 1 165 GLY 165 163 163 GLY GLY A . n A 1 166 THR 166 164 164 THR THR A . n A 1 167 VAL 167 165 165 VAL VAL A . n A 1 168 LEU 168 166 166 LEU LEU A . n A 1 169 LEU 169 167 167 LEU LEU A . n A 1 170 ALA 170 168 168 ALA ALA A . n A 1 171 ASP 171 169 169 ASP ASP A . n A 1 172 ASN 172 170 170 ASN ASN A . n A 1 173 VAL 173 171 171 VAL VAL A . n A 1 174 ILE 174 172 172 ILE ILE A . n A 1 175 VAL 175 173 173 VAL VAL A . n A 1 176 PRO 176 174 174 PRO PRO A . n A 1 177 GLY 177 175 175 GLY GLY A . n A 1 178 THR 178 176 176 THR THR A . n A 1 179 PRO 179 177 177 PRO PRO A . n A 1 180 ASP 180 178 178 ASP ASP A . n A 1 181 PHE 181 179 179 PHE PHE A . n A 1 182 LEU 182 180 180 LEU LEU A . n A 1 183 ALA 183 181 181 ALA ALA A . n A 1 184 TYR 184 182 182 TYR TYR A . n A 1 185 VAL 185 183 183 VAL VAL A . n A 1 186 ARG 186 184 184 ARG ARG A . n A 1 187 GLY 187 185 185 GLY GLY A . n A 1 188 SER 188 186 186 SER SER A . n A 1 189 SER 189 187 187 SER SER A . n A 1 190 SER 190 188 188 SER SER A . n A 1 191 PHE 191 189 189 PHE PHE A . n A 1 192 GLU 192 190 190 GLU GLU A . n A 1 193 CYS 193 191 191 CYS CYS A . n A 1 194 THR 194 192 192 THR THR A . n A 1 195 HIS 195 193 193 HIS HIS A . n A 1 196 TYR 196 194 194 TYR TYR A . n A 1 197 SER 197 195 195 SER SER A . n A 1 198 SER 198 196 196 SER SER A . n A 1 199 TYR 199 197 197 TYR TYR A . n A 1 200 LEU 200 198 198 LEU LEU A . n A 1 201 GLU 201 199 199 GLU GLU A . n A 1 202 TYR 202 200 200 TYR TYR A . n A 1 203 MET 203 201 201 MET MET A . n A 1 204 LYS 204 202 202 LYS LYS A . n A 1 205 VAL 205 203 203 VAL VAL A . n A 1 206 VAL 206 204 204 VAL VAL A . n A 1 207 ASP 207 205 205 ASP ASP A . n A 1 208 GLY 208 206 206 GLY GLY A . n A 1 209 LEU 209 207 207 LEU LEU A . n A 1 210 GLU 210 208 208 GLU GLU A . n A 1 211 LYS 211 209 209 LYS LYS A . n A 1 212 ALA 212 210 210 ALA ALA A . n A 1 213 ILE 213 211 211 ILE ILE A . n A 1 214 TYR 214 212 212 TYR TYR A . n A 1 215 GLN 215 213 213 GLN GLN A . n A 1 216 GLY 216 214 214 GLY GLY A . n A 1 217 PRO 217 215 215 PRO PRO A . n A 1 218 SER 218 216 216 SER ALA A . n A 1 219 SER 219 217 ? ? ? A . n A 1 220 PRO 220 218 ? ? ? A . n A 1 221 ASP 221 219 ? ? ? A . n A 1 222 LYS 222 220 ? ? ? A . n A 1 223 SER 223 221 ? ? ? A . n B 1 1 GLY 1 -1 ? ? ? B . n B 1 2 SER 2 0 0 SER ALA B . n B 1 3 MET 3 1 1 MET MET B . n B 1 4 GLY 4 2 2 GLY GLY B . n B 1 5 ASP 5 3 3 ASP ASP B . n B 1 6 THR 6 4 4 THR THR B . n B 1 7 LYS 7 5 5 LYS LYS B . n B 1 8 GLU 8 6 6 GLU GLU B . n B 1 9 GLN 9 7 7 GLN GLN B . n B 1 10 ARG 10 8 8 ARG ARG B . n B 1 11 ILE 11 9 9 ILE ILE B . n B 1 12 LEU 12 10 10 LEU LEU B . n B 1 13 ARG 13 11 11 ARG ARG B . n B 1 14 TYR 14 12 12 TYR TYR B . n B 1 15 VAL 15 13 13 VAL VAL B . n B 1 16 GLN 16 14 14 GLN GLN B . n B 1 17 GLN 17 15 15 GLN GLN B . n B 1 18 ASN 18 16 16 ASN ASN B . n B 1 19 ALA 19 17 17 ALA ALA B . n B 1 20 LYS 20 18 18 LYS LYS B . n B 1 21 PRO 21 19 19 PRO PRO B . n B 1 22 GLY 22 20 20 GLY GLY B . n B 1 23 ASP 23 21 21 ASP ASP B . n B 1 24 PRO 24 22 22 PRO PRO B . n B 1 25 GLN 25 23 23 GLN GLN B . n B 1 26 SER 26 24 24 SER SER B . n B 1 27 VAL 27 25 25 VAL VAL B . n B 1 28 LEU 28 26 26 LEU LEU B . n B 1 29 GLU 29 27 27 GLU GLU B . n B 1 30 ALA 30 28 28 ALA ALA B . n B 1 31 ILE 31 29 29 ILE ILE B . n B 1 32 ASP 32 30 30 ASP ASP B . n B 1 33 THR 33 31 31 THR THR B . n B 1 34 TYR 34 32 32 TYR TYR B . n B 1 35 CYS 35 33 33 CYS CYS B . n B 1 36 THR 36 34 34 THR THR B . n B 1 37 GLN 37 35 35 GLN GLN B . n B 1 38 LYS 38 36 36 LYS LYS B . n B 1 39 GLU 39 37 37 GLU GLU B . n B 1 40 TRP 40 38 38 TRP TRP B . n B 1 41 ALA 41 39 39 ALA ALA B . n B 1 42 MET 42 40 40 MET MET B . n B 1 43 ASN 43 41 41 ASN ASN B . n B 1 44 VAL 44 42 42 VAL VAL B . n B 1 45 GLY 45 43 43 GLY GLY B . n B 1 46 ASP 46 44 44 ASP ASP B . n B 1 47 ALA 47 45 45 ALA ALA B . n B 1 48 LYS 48 46 46 LYS LYS B . n B 1 49 GLY 49 47 47 GLY GLY B . n B 1 50 GLN 50 48 48 GLN GLN B . n B 1 51 ILE 51 49 49 ILE ILE B . n B 1 52 MET 52 50 50 MET MET B . n B 1 53 ASP 53 51 51 ASP ASP B . n B 1 54 ALA 54 52 52 ALA ALA B . n B 1 55 VAL 55 53 53 VAL VAL B . n B 1 56 ILE 56 54 54 ILE ILE B . n B 1 57 ARG 57 55 55 ARG ARG B . n B 1 58 GLU 58 56 56 GLU GLU B . n B 1 59 TYR 59 57 57 TYR TYR B . n B 1 60 SER 60 58 58 SER SER B . n B 1 61 PRO 61 59 59 PRO PRO B . n B 1 62 SER 62 60 60 SER SER B . n B 1 63 LEU 63 61 61 LEU LEU B . n B 1 64 VAL 64 62 62 VAL VAL B . n B 1 65 LEU 65 63 63 LEU LEU B . n B 1 66 GLU 66 64 64 GLU GLU B . n B 1 67 LEU 67 65 65 LEU LEU B . n B 1 68 GLY 68 66 66 GLY GLY B . n B 1 69 ALA 69 67 67 ALA ALA B . n B 1 70 TYR 70 68 68 TYR TYR B . n B 1 71 CYS 71 69 69 CYS CYS B . n B 1 72 GLY 72 70 70 GLY GLY B . n B 1 73 TYR 73 71 71 TYR TYR B . n B 1 74 SER 74 72 72 SER SER B . n B 1 75 ALA 75 73 73 ALA ALA B . n B 1 76 VAL 76 74 74 VAL VAL B . n B 1 77 ARG 77 75 75 ARG ARG B . n B 1 78 MET 78 76 76 MET MET B . n B 1 79 ALA 79 77 77 ALA ALA B . n B 1 80 ARG 80 78 78 ARG ARG B . n B 1 81 LEU 81 79 79 LEU LEU B . n B 1 82 LEU 82 80 80 LEU LEU B . n B 1 83 GLN 83 81 81 GLN GLN B . n B 1 84 PRO 84 82 82 PRO PRO B . n B 1 85 GLY 85 83 83 GLY GLY B . n B 1 86 ALA 86 84 84 ALA ALA B . n B 1 87 ARG 87 85 85 ARG ARG B . n B 1 88 LEU 88 86 86 LEU LEU B . n B 1 89 LEU 89 87 87 LEU LEU B . n B 1 90 THR 90 88 88 THR THR B . n B 1 91 MET 91 89 89 MET MET B . n B 1 92 GLU 92 90 90 GLU GLU B . n B 1 93 MET 93 91 91 MET MET B . n B 1 94 ASN 94 92 92 ASN ASN B . n B 1 95 PRO 95 93 93 PRO PRO B . n B 1 96 ASP 96 94 94 ASP ASP B . n B 1 97 TYR 97 95 95 TYR TYR B . n B 1 98 ALA 98 96 96 ALA ALA B . n B 1 99 ALA 99 97 97 ALA ALA B . n B 1 100 ILE 100 98 98 ILE ILE B . n B 1 101 THR 101 99 99 THR THR B . n B 1 102 GLN 102 100 100 GLN GLN B . n B 1 103 GLN 103 101 101 GLN GLN B . n B 1 104 MET 104 102 102 MET MET B . n B 1 105 LEU 105 103 103 LEU LEU B . n B 1 106 ASN 106 104 104 ASN ASN B . n B 1 107 PHE 107 105 105 PHE PHE B . n B 1 108 ALA 108 106 106 ALA ALA B . n B 1 109 GLY 109 107 107 GLY GLY B . n B 1 110 LEU 110 108 108 LEU LEU B . n B 1 111 GLN 111 109 109 GLN GLN B . n B 1 112 ASP 112 110 110 ASP ASP B . n B 1 113 LYS 113 111 111 LYS LYS B . n B 1 114 VAL 114 112 112 VAL VAL B . n B 1 115 THR 115 113 113 THR THR B . n B 1 116 ILE 116 114 114 ILE ILE B . n B 1 117 LEU 117 115 115 LEU LEU B . n B 1 118 ASN 118 116 116 ASN ASN B . n B 1 119 GLY 119 117 117 GLY GLY B . n B 1 120 ALA 120 118 118 ALA ALA B . n B 1 121 SER 121 119 119 SER SER B . n B 1 122 GLN 122 120 120 GLN GLN B . n B 1 123 ASP 123 121 121 ASP ASP B . n B 1 124 LEU 124 122 122 LEU LEU B . n B 1 125 ILE 125 123 123 ILE ILE B . n B 1 126 PRO 126 124 124 PRO PRO B . n B 1 127 GLN 127 125 125 GLN GLN B . n B 1 128 LEU 128 126 126 LEU LEU B . n B 1 129 LYS 129 127 127 LYS LYS B . n B 1 130 LYS 130 128 128 LYS LYS B . n B 1 131 LYS 131 129 129 LYS LYS B . n B 1 132 TYR 132 130 130 TYR TYR B . n B 1 133 ASP 133 131 131 ASP ASP B . n B 1 134 VAL 134 132 132 VAL VAL B . n B 1 135 ASP 135 133 133 ASP ASP B . n B 1 136 THR 136 134 134 THR THR B . n B 1 137 LEU 137 135 135 LEU LEU B . n B 1 138 ASP 138 136 136 ASP ASP B . n B 1 139 MET 139 137 137 MET MET B . n B 1 140 VAL 140 138 138 VAL VAL B . n B 1 141 PHE 141 139 139 PHE PHE B . n B 1 142 LEU 142 140 140 LEU LEU B . n B 1 143 ASP 143 141 141 ASP ASP B . n B 1 144 HIS 144 142 142 HIS HIS B . n B 1 145 TRP 145 143 143 TRP TRP B . n B 1 146 LYS 146 144 144 LYS LYS B . n B 1 147 ASP 147 145 145 ASP ASP B . n B 1 148 ARG 148 146 146 ARG ARG B . n B 1 149 TYR 149 147 147 TYR TYR B . n B 1 150 LEU 150 148 148 LEU LEU B . n B 1 151 PRO 151 149 149 PRO PRO B . n B 1 152 ASP 152 150 150 ASP ASP B . n B 1 153 THR 153 151 151 THR THR B . n B 1 154 LEU 154 152 152 LEU LEU B . n B 1 155 LEU 155 153 153 LEU LEU B . n B 1 156 LEU 156 154 154 LEU LEU B . n B 1 157 GLU 157 155 155 GLU GLU B . n B 1 158 LYS 158 156 156 LYS LYS B . n B 1 159 CYS 159 157 157 CYS CYS B . n B 1 160 GLY 160 158 158 GLY GLY B . n B 1 161 LEU 161 159 159 LEU LEU B . n B 1 162 LEU 162 160 160 LEU LEU B . n B 1 163 ARG 163 161 161 ARG ARG B . n B 1 164 LYS 164 162 162 LYS LYS B . n B 1 165 GLY 165 163 163 GLY GLY B . n B 1 166 THR 166 164 164 THR THR B . n B 1 167 VAL 167 165 165 VAL VAL B . n B 1 168 LEU 168 166 166 LEU LEU B . n B 1 169 LEU 169 167 167 LEU LEU B . n B 1 170 ALA 170 168 168 ALA ALA B . n B 1 171 ASP 171 169 169 ASP ASP B . n B 1 172 ASN 172 170 170 ASN ASN B . n B 1 173 VAL 173 171 171 VAL VAL B . n B 1 174 ILE 174 172 172 ILE ILE B . n B 1 175 VAL 175 173 173 VAL VAL B . n B 1 176 PRO 176 174 174 PRO PRO B . n B 1 177 GLY 177 175 175 GLY GLY B . n B 1 178 THR 178 176 176 THR THR B . n B 1 179 PRO 179 177 177 PRO PRO B . n B 1 180 ASP 180 178 178 ASP ASP B . n B 1 181 PHE 181 179 179 PHE PHE B . n B 1 182 LEU 182 180 180 LEU LEU B . n B 1 183 ALA 183 181 181 ALA ALA B . n B 1 184 TYR 184 182 182 TYR TYR B . n B 1 185 VAL 185 183 183 VAL VAL B . n B 1 186 ARG 186 184 184 ARG ARG B . n B 1 187 GLY 187 185 185 GLY GLY B . n B 1 188 SER 188 186 186 SER SER B . n B 1 189 SER 189 187 187 SER SER B . n B 1 190 SER 190 188 188 SER SER B . n B 1 191 PHE 191 189 189 PHE PHE B . n B 1 192 GLU 192 190 190 GLU GLU B . n B 1 193 CYS 193 191 191 CYS CYS B . n B 1 194 THR 194 192 192 THR THR B . n B 1 195 HIS 195 193 193 HIS HIS B . n B 1 196 TYR 196 194 194 TYR TYR B . n B 1 197 SER 197 195 195 SER SER B . n B 1 198 SER 198 196 196 SER SER B . n B 1 199 TYR 199 197 197 TYR TYR B . n B 1 200 LEU 200 198 198 LEU LEU B . n B 1 201 GLU 201 199 199 GLU GLU B . n B 1 202 TYR 202 200 200 TYR TYR B . n B 1 203 MET 203 201 201 MET MET B . n B 1 204 LYS 204 202 202 LYS LYS B . n B 1 205 VAL 205 203 203 VAL VAL B . n B 1 206 VAL 206 204 204 VAL VAL B . n B 1 207 ASP 207 205 205 ASP ASP B . n B 1 208 GLY 208 206 206 GLY GLY B . n B 1 209 LEU 209 207 207 LEU LEU B . n B 1 210 GLU 210 208 208 GLU GLU B . n B 1 211 LYS 211 209 209 LYS LYS B . n B 1 212 ALA 212 210 210 ALA ALA B . n B 1 213 ILE 213 211 211 ILE ILE B . n B 1 214 TYR 214 212 212 TYR TYR B . n B 1 215 GLN 215 213 213 GLN GLN B . n B 1 216 GLY 216 214 214 GLY GLY B . n B 1 217 PRO 217 215 215 PRO PRO B . n B 1 218 SER 218 216 216 SER ALA B . n B 1 219 SER 219 217 ? ? ? B . n B 1 220 PRO 220 218 ? ? ? B . n B 1 221 ASP 221 219 ? ? ? B . n B 1 222 LYS 222 220 ? ? ? B . n B 1 223 SER 223 221 ? ? ? B . n C 1 1 GLY 1 -1 ? ? ? C . n C 1 2 SER 2 0 ? ? ? C . n C 1 3 MET 3 1 ? ? ? C . n C 1 4 GLY 4 2 ? ? ? C . n C 1 5 ASP 5 3 3 ASP ASP C . n C 1 6 THR 6 4 4 THR THR C . n C 1 7 LYS 7 5 5 LYS LYS C . n C 1 8 GLU 8 6 6 GLU GLU C . n C 1 9 GLN 9 7 7 GLN GLN C . n C 1 10 ARG 10 8 8 ARG ARG C . n C 1 11 ILE 11 9 9 ILE ILE C . n C 1 12 LEU 12 10 10 LEU LEU C . n C 1 13 ARG 13 11 11 ARG ARG C . n C 1 14 TYR 14 12 12 TYR TYR C . n C 1 15 VAL 15 13 13 VAL VAL C . n C 1 16 GLN 16 14 14 GLN GLN C . n C 1 17 GLN 17 15 15 GLN GLN C . n C 1 18 ASN 18 16 16 ASN ASN C . n C 1 19 ALA 19 17 17 ALA ALA C . n C 1 20 LYS 20 18 18 LYS LYS C . n C 1 21 PRO 21 19 19 PRO PRO C . n C 1 22 GLY 22 20 20 GLY GLY C . n C 1 23 ASP 23 21 21 ASP ASP C . n C 1 24 PRO 24 22 22 PRO PRO C . n C 1 25 GLN 25 23 23 GLN GLN C . n C 1 26 SER 26 24 24 SER SER C . n C 1 27 VAL 27 25 25 VAL VAL C . n C 1 28 LEU 28 26 26 LEU LEU C . n C 1 29 GLU 29 27 27 GLU GLU C . n C 1 30 ALA 30 28 28 ALA ALA C . n C 1 31 ILE 31 29 29 ILE ILE C . n C 1 32 ASP 32 30 30 ASP ASP C . n C 1 33 THR 33 31 31 THR THR C . n C 1 34 TYR 34 32 32 TYR TYR C . n C 1 35 CYS 35 33 33 CYS CYS C . n C 1 36 THR 36 34 34 THR THR C . n C 1 37 GLN 37 35 35 GLN GLN C . n C 1 38 LYS 38 36 36 LYS LYS C . n C 1 39 GLU 39 37 37 GLU GLU C . n C 1 40 TRP 40 38 38 TRP TRP C . n C 1 41 ALA 41 39 39 ALA ALA C . n C 1 42 MET 42 40 40 MET MET C . n C 1 43 ASN 43 41 41 ASN ASN C . n C 1 44 VAL 44 42 42 VAL VAL C . n C 1 45 GLY 45 43 43 GLY GLY C . n C 1 46 ASP 46 44 44 ASP ASP C . n C 1 47 ALA 47 45 45 ALA ALA C . n C 1 48 LYS 48 46 46 LYS LYS C . n C 1 49 GLY 49 47 47 GLY GLY C . n C 1 50 GLN 50 48 48 GLN GLN C . n C 1 51 ILE 51 49 49 ILE ILE C . n C 1 52 MET 52 50 50 MET MET C . n C 1 53 ASP 53 51 51 ASP ASP C . n C 1 54 ALA 54 52 52 ALA ALA C . n C 1 55 VAL 55 53 53 VAL VAL C . n C 1 56 ILE 56 54 54 ILE ILE C . n C 1 57 ARG 57 55 55 ARG ARG C . n C 1 58 GLU 58 56 56 GLU GLU C . n C 1 59 TYR 59 57 57 TYR TYR C . n C 1 60 SER 60 58 58 SER SER C . n C 1 61 PRO 61 59 59 PRO PRO C . n C 1 62 SER 62 60 60 SER SER C . n C 1 63 LEU 63 61 61 LEU LEU C . n C 1 64 VAL 64 62 62 VAL VAL C . n C 1 65 LEU 65 63 63 LEU LEU C . n C 1 66 GLU 66 64 64 GLU GLU C . n C 1 67 LEU 67 65 65 LEU LEU C . n C 1 68 GLY 68 66 66 GLY GLY C . n C 1 69 ALA 69 67 67 ALA ALA C . n C 1 70 TYR 70 68 68 TYR TYR C . n C 1 71 CYS 71 69 69 CYS CYS C . n C 1 72 GLY 72 70 70 GLY GLY C . n C 1 73 TYR 73 71 71 TYR TYR C . n C 1 74 SER 74 72 72 SER SER C . n C 1 75 ALA 75 73 73 ALA ALA C . n C 1 76 VAL 76 74 74 VAL VAL C . n C 1 77 ARG 77 75 75 ARG ARG C . n C 1 78 MET 78 76 76 MET MET C . n C 1 79 ALA 79 77 77 ALA ALA C . n C 1 80 ARG 80 78 78 ARG ARG C . n C 1 81 LEU 81 79 79 LEU LEU C . n C 1 82 LEU 82 80 80 LEU LEU C . n C 1 83 GLN 83 81 81 GLN GLN C . n C 1 84 PRO 84 82 82 PRO PRO C . n C 1 85 GLY 85 83 83 GLY GLY C . n C 1 86 ALA 86 84 84 ALA ALA C . n C 1 87 ARG 87 85 85 ARG ARG C . n C 1 88 LEU 88 86 86 LEU LEU C . n C 1 89 LEU 89 87 87 LEU LEU C . n C 1 90 THR 90 88 88 THR THR C . n C 1 91 MET 91 89 89 MET MET C . n C 1 92 GLU 92 90 90 GLU GLU C . n C 1 93 MET 93 91 91 MET MET C . n C 1 94 ASN 94 92 92 ASN ASN C . n C 1 95 PRO 95 93 93 PRO PRO C . n C 1 96 ASP 96 94 94 ASP ASP C . n C 1 97 TYR 97 95 95 TYR TYR C . n C 1 98 ALA 98 96 96 ALA ALA C . n C 1 99 ALA 99 97 97 ALA ALA C . n C 1 100 ILE 100 98 98 ILE ILE C . n C 1 101 THR 101 99 99 THR THR C . n C 1 102 GLN 102 100 100 GLN GLN C . n C 1 103 GLN 103 101 101 GLN GLN C . n C 1 104 MET 104 102 102 MET MET C . n C 1 105 LEU 105 103 103 LEU LEU C . n C 1 106 ASN 106 104 104 ASN ASN C . n C 1 107 PHE 107 105 105 PHE PHE C . n C 1 108 ALA 108 106 106 ALA ALA C . n C 1 109 GLY 109 107 107 GLY GLY C . n C 1 110 LEU 110 108 108 LEU LEU C . n C 1 111 GLN 111 109 109 GLN GLN C . n C 1 112 ASP 112 110 110 ASP ASP C . n C 1 113 LYS 113 111 111 LYS LYS C . n C 1 114 VAL 114 112 112 VAL VAL C . n C 1 115 THR 115 113 113 THR THR C . n C 1 116 ILE 116 114 114 ILE ILE C . n C 1 117 LEU 117 115 115 LEU LEU C . n C 1 118 ASN 118 116 116 ASN ASN C . n C 1 119 GLY 119 117 117 GLY GLY C . n C 1 120 ALA 120 118 118 ALA ALA C . n C 1 121 SER 121 119 119 SER SER C . n C 1 122 GLN 122 120 120 GLN GLN C . n C 1 123 ASP 123 121 121 ASP ASP C . n C 1 124 LEU 124 122 122 LEU LEU C . n C 1 125 ILE 125 123 123 ILE ILE C . n C 1 126 PRO 126 124 124 PRO PRO C . n C 1 127 GLN 127 125 125 GLN GLN C . n C 1 128 LEU 128 126 126 LEU LEU C . n C 1 129 LYS 129 127 127 LYS LYS C . n C 1 130 LYS 130 128 128 LYS LYS C . n C 1 131 LYS 131 129 129 LYS LYS C . n C 1 132 TYR 132 130 130 TYR TYR C . n C 1 133 ASP 133 131 131 ASP ASP C . n C 1 134 VAL 134 132 132 VAL VAL C . n C 1 135 ASP 135 133 133 ASP ASP C . n C 1 136 THR 136 134 134 THR THR C . n C 1 137 LEU 137 135 135 LEU LEU C . n C 1 138 ASP 138 136 136 ASP ASP C . n C 1 139 MET 139 137 137 MET MET C . n C 1 140 VAL 140 138 138 VAL VAL C . n C 1 141 PHE 141 139 139 PHE PHE C . n C 1 142 LEU 142 140 140 LEU LEU C . n C 1 143 ASP 143 141 141 ASP ASP C . n C 1 144 HIS 144 142 142 HIS HIS C . n C 1 145 TRP 145 143 143 TRP TRP C . n C 1 146 LYS 146 144 144 LYS LYS C . n C 1 147 ASP 147 145 145 ASP ASP C . n C 1 148 ARG 148 146 146 ARG ARG C . n C 1 149 TYR 149 147 147 TYR TYR C . n C 1 150 LEU 150 148 148 LEU LEU C . n C 1 151 PRO 151 149 149 PRO PRO C . n C 1 152 ASP 152 150 150 ASP ASP C . n C 1 153 THR 153 151 151 THR THR C . n C 1 154 LEU 154 152 152 LEU LEU C . n C 1 155 LEU 155 153 153 LEU LEU C . n C 1 156 LEU 156 154 154 LEU LEU C . n C 1 157 GLU 157 155 155 GLU GLU C . n C 1 158 LYS 158 156 156 LYS LYS C . n C 1 159 CYS 159 157 157 CYS CYS C . n C 1 160 GLY 160 158 158 GLY GLY C . n C 1 161 LEU 161 159 159 LEU LEU C . n C 1 162 LEU 162 160 160 LEU LEU C . n C 1 163 ARG 163 161 161 ARG ARG C . n C 1 164 LYS 164 162 162 LYS LYS C . n C 1 165 GLY 165 163 163 GLY GLY C . n C 1 166 THR 166 164 164 THR THR C . n C 1 167 VAL 167 165 165 VAL VAL C . n C 1 168 LEU 168 166 166 LEU LEU C . n C 1 169 LEU 169 167 167 LEU LEU C . n C 1 170 ALA 170 168 168 ALA ALA C . n C 1 171 ASP 171 169 169 ASP ASP C . n C 1 172 ASN 172 170 170 ASN ASN C . n C 1 173 VAL 173 171 171 VAL VAL C . n C 1 174 ILE 174 172 172 ILE ILE C . n C 1 175 VAL 175 173 173 VAL VAL C . n C 1 176 PRO 176 174 174 PRO PRO C . n C 1 177 GLY 177 175 175 GLY GLY C . n C 1 178 THR 178 176 176 THR THR C . n C 1 179 PRO 179 177 177 PRO PRO C . n C 1 180 ASP 180 178 178 ASP ASP C . n C 1 181 PHE 181 179 179 PHE PHE C . n C 1 182 LEU 182 180 180 LEU LEU C . n C 1 183 ALA 183 181 181 ALA ALA C . n C 1 184 TYR 184 182 182 TYR TYR C . n C 1 185 VAL 185 183 183 VAL VAL C . n C 1 186 ARG 186 184 184 ARG ARG C . n C 1 187 GLY 187 185 185 GLY GLY C . n C 1 188 SER 188 186 186 SER SER C . n C 1 189 SER 189 187 187 SER SER C . n C 1 190 SER 190 188 188 SER SER C . n C 1 191 PHE 191 189 189 PHE PHE C . n C 1 192 GLU 192 190 190 GLU GLU C . n C 1 193 CYS 193 191 191 CYS CYS C . n C 1 194 THR 194 192 192 THR THR C . n C 1 195 HIS 195 193 193 HIS HIS C . n C 1 196 TYR 196 194 194 TYR TYR C . n C 1 197 SER 197 195 195 SER SER C . n C 1 198 SER 198 196 196 SER SER C . n C 1 199 TYR 199 197 197 TYR TYR C . n C 1 200 LEU 200 198 198 LEU LEU C . n C 1 201 GLU 201 199 199 GLU GLU C . n C 1 202 TYR 202 200 200 TYR TYR C . n C 1 203 MET 203 201 201 MET MET C . n C 1 204 LYS 204 202 202 LYS LYS C . n C 1 205 VAL 205 203 203 VAL VAL C . n C 1 206 VAL 206 204 204 VAL VAL C . n C 1 207 ASP 207 205 205 ASP ASP C . n C 1 208 GLY 208 206 206 GLY GLY C . n C 1 209 LEU 209 207 207 LEU LEU C . n C 1 210 GLU 210 208 208 GLU GLU C . n C 1 211 LYS 211 209 209 LYS LYS C . n C 1 212 ALA 212 210 210 ALA ALA C . n C 1 213 ILE 213 211 211 ILE ILE C . n C 1 214 TYR 214 212 212 TYR TYR C . n C 1 215 GLN 215 213 213 GLN GLN C . n C 1 216 GLY 216 214 214 GLY GLY C . n C 1 217 PRO 217 215 215 PRO PRO C . n C 1 218 SER 218 216 ? ? ? C . n C 1 219 SER 219 217 ? ? ? C . n C 1 220 PRO 220 218 ? ? ? C . n C 1 221 ASP 221 219 ? ? ? C . n C 1 222 LYS 222 220 ? ? ? C . n C 1 223 SER 223 221 ? ? ? C . n D 1 1 GLY 1 -1 ? ? ? D . n D 1 2 SER 2 0 ? ? ? D . n D 1 3 MET 3 1 ? ? ? D . n D 1 4 GLY 4 2 ? ? ? D . n D 1 5 ASP 5 3 3 ASP ASP D . n D 1 6 THR 6 4 4 THR THR D . n D 1 7 LYS 7 5 5 LYS LYS D . n D 1 8 GLU 8 6 6 GLU GLU D . n D 1 9 GLN 9 7 7 GLN GLN D . n D 1 10 ARG 10 8 8 ARG ARG D . n D 1 11 ILE 11 9 9 ILE ILE D . n D 1 12 LEU 12 10 10 LEU LEU D . n D 1 13 ARG 13 11 11 ARG ARG D . n D 1 14 TYR 14 12 12 TYR TYR D . n D 1 15 VAL 15 13 13 VAL VAL D . n D 1 16 GLN 16 14 14 GLN GLN D . n D 1 17 GLN 17 15 15 GLN GLN D . n D 1 18 ASN 18 16 16 ASN ASN D . n D 1 19 ALA 19 17 17 ALA ALA D . n D 1 20 LYS 20 18 18 LYS LYS D . n D 1 21 PRO 21 19 19 PRO PRO D . n D 1 22 GLY 22 20 20 GLY GLY D . n D 1 23 ASP 23 21 21 ASP ASP D . n D 1 24 PRO 24 22 22 PRO PRO D . n D 1 25 GLN 25 23 23 GLN GLN D . n D 1 26 SER 26 24 24 SER SER D . n D 1 27 VAL 27 25 25 VAL VAL D . n D 1 28 LEU 28 26 26 LEU LEU D . n D 1 29 GLU 29 27 27 GLU GLU D . n D 1 30 ALA 30 28 28 ALA ALA D . n D 1 31 ILE 31 29 29 ILE ILE D . n D 1 32 ASP 32 30 30 ASP ASP D . n D 1 33 THR 33 31 31 THR THR D . n D 1 34 TYR 34 32 32 TYR TYR D . n D 1 35 CYS 35 33 33 CYS CYS D . n D 1 36 THR 36 34 34 THR THR D . n D 1 37 GLN 37 35 35 GLN GLN D . n D 1 38 LYS 38 36 36 LYS LYS D . n D 1 39 GLU 39 37 37 GLU GLU D . n D 1 40 TRP 40 38 38 TRP TRP D . n D 1 41 ALA 41 39 39 ALA ALA D . n D 1 42 MET 42 40 40 MET MET D . n D 1 43 ASN 43 41 41 ASN ASN D . n D 1 44 VAL 44 42 42 VAL VAL D . n D 1 45 GLY 45 43 43 GLY GLY D . n D 1 46 ASP 46 44 44 ASP ASP D . n D 1 47 ALA 47 45 45 ALA ALA D . n D 1 48 LYS 48 46 46 LYS LYS D . n D 1 49 GLY 49 47 47 GLY GLY D . n D 1 50 GLN 50 48 48 GLN GLN D . n D 1 51 ILE 51 49 49 ILE ILE D . n D 1 52 MET 52 50 50 MET MET D . n D 1 53 ASP 53 51 51 ASP ASP D . n D 1 54 ALA 54 52 52 ALA ALA D . n D 1 55 VAL 55 53 53 VAL VAL D . n D 1 56 ILE 56 54 54 ILE ILE D . n D 1 57 ARG 57 55 55 ARG ARG D . n D 1 58 GLU 58 56 56 GLU GLU D . n D 1 59 TYR 59 57 57 TYR TYR D . n D 1 60 SER 60 58 58 SER SER D . n D 1 61 PRO 61 59 59 PRO PRO D . n D 1 62 SER 62 60 60 SER SER D . n D 1 63 LEU 63 61 61 LEU LEU D . n D 1 64 VAL 64 62 62 VAL VAL D . n D 1 65 LEU 65 63 63 LEU LEU D . n D 1 66 GLU 66 64 64 GLU GLU D . n D 1 67 LEU 67 65 65 LEU LEU D . n D 1 68 GLY 68 66 66 GLY GLY D . n D 1 69 ALA 69 67 67 ALA ALA D . n D 1 70 TYR 70 68 68 TYR TYR D . n D 1 71 CYS 71 69 69 CYS CYS D . n D 1 72 GLY 72 70 70 GLY GLY D . n D 1 73 TYR 73 71 71 TYR TYR D . n D 1 74 SER 74 72 72 SER SER D . n D 1 75 ALA 75 73 73 ALA ALA D . n D 1 76 VAL 76 74 74 VAL VAL D . n D 1 77 ARG 77 75 75 ARG ARG D . n D 1 78 MET 78 76 76 MET MET D . n D 1 79 ALA 79 77 77 ALA ALA D . n D 1 80 ARG 80 78 78 ARG ARG D . n D 1 81 LEU 81 79 79 LEU LEU D . n D 1 82 LEU 82 80 80 LEU LEU D . n D 1 83 GLN 83 81 81 GLN GLN D . n D 1 84 PRO 84 82 82 PRO PRO D . n D 1 85 GLY 85 83 83 GLY GLY D . n D 1 86 ALA 86 84 84 ALA ALA D . n D 1 87 ARG 87 85 85 ARG ARG D . n D 1 88 LEU 88 86 86 LEU LEU D . n D 1 89 LEU 89 87 87 LEU LEU D . n D 1 90 THR 90 88 88 THR THR D . n D 1 91 MET 91 89 89 MET MET D . n D 1 92 GLU 92 90 90 GLU GLU D . n D 1 93 MET 93 91 91 MET MET D . n D 1 94 ASN 94 92 92 ASN ASN D . n D 1 95 PRO 95 93 93 PRO PRO D . n D 1 96 ASP 96 94 94 ASP ASP D . n D 1 97 TYR 97 95 95 TYR TYR D . n D 1 98 ALA 98 96 96 ALA ALA D . n D 1 99 ALA 99 97 97 ALA ALA D . n D 1 100 ILE 100 98 98 ILE ILE D . n D 1 101 THR 101 99 99 THR THR D . n D 1 102 GLN 102 100 100 GLN GLN D . n D 1 103 GLN 103 101 101 GLN GLN D . n D 1 104 MET 104 102 102 MET MET D . n D 1 105 LEU 105 103 103 LEU LEU D . n D 1 106 ASN 106 104 104 ASN ASN D . n D 1 107 PHE 107 105 105 PHE PHE D . n D 1 108 ALA 108 106 106 ALA ALA D . n D 1 109 GLY 109 107 107 GLY GLY D . n D 1 110 LEU 110 108 108 LEU LEU D . n D 1 111 GLN 111 109 109 GLN GLN D . n D 1 112 ASP 112 110 110 ASP ASP D . n D 1 113 LYS 113 111 111 LYS LYS D . n D 1 114 VAL 114 112 112 VAL VAL D . n D 1 115 THR 115 113 113 THR THR D . n D 1 116 ILE 116 114 114 ILE ILE D . n D 1 117 LEU 117 115 115 LEU LEU D . n D 1 118 ASN 118 116 116 ASN ASN D . n D 1 119 GLY 119 117 117 GLY GLY D . n D 1 120 ALA 120 118 118 ALA ALA D . n D 1 121 SER 121 119 119 SER SER D . n D 1 122 GLN 122 120 120 GLN GLN D . n D 1 123 ASP 123 121 121 ASP ASP D . n D 1 124 LEU 124 122 122 LEU LEU D . n D 1 125 ILE 125 123 123 ILE ILE D . n D 1 126 PRO 126 124 124 PRO PRO D . n D 1 127 GLN 127 125 125 GLN GLN D . n D 1 128 LEU 128 126 126 LEU LEU D . n D 1 129 LYS 129 127 127 LYS LYS D . n D 1 130 LYS 130 128 128 LYS LYS D . n D 1 131 LYS 131 129 129 LYS LYS D . n D 1 132 TYR 132 130 130 TYR TYR D . n D 1 133 ASP 133 131 131 ASP ASP D . n D 1 134 VAL 134 132 132 VAL VAL D . n D 1 135 ASP 135 133 133 ASP ASP D . n D 1 136 THR 136 134 134 THR THR D . n D 1 137 LEU 137 135 135 LEU LEU D . n D 1 138 ASP 138 136 136 ASP ASP D . n D 1 139 MET 139 137 137 MET MET D . n D 1 140 VAL 140 138 138 VAL VAL D . n D 1 141 PHE 141 139 139 PHE PHE D . n D 1 142 LEU 142 140 140 LEU LEU D . n D 1 143 ASP 143 141 141 ASP ASP D . n D 1 144 HIS 144 142 142 HIS HIS D . n D 1 145 TRP 145 143 143 TRP TRP D . n D 1 146 LYS 146 144 144 LYS LYS D . n D 1 147 ASP 147 145 145 ASP ASP D . n D 1 148 ARG 148 146 146 ARG ARG D . n D 1 149 TYR 149 147 147 TYR TYR D . n D 1 150 LEU 150 148 148 LEU LEU D . n D 1 151 PRO 151 149 149 PRO PRO D . n D 1 152 ASP 152 150 150 ASP ASP D . n D 1 153 THR 153 151 151 THR THR D . n D 1 154 LEU 154 152 152 LEU LEU D . n D 1 155 LEU 155 153 153 LEU LEU D . n D 1 156 LEU 156 154 154 LEU LEU D . n D 1 157 GLU 157 155 155 GLU GLU D . n D 1 158 LYS 158 156 156 LYS LYS D . n D 1 159 CYS 159 157 157 CYS CYS D . n D 1 160 GLY 160 158 158 GLY GLY D . n D 1 161 LEU 161 159 159 LEU LEU D . n D 1 162 LEU 162 160 160 LEU LEU D . n D 1 163 ARG 163 161 161 ARG ARG D . n D 1 164 LYS 164 162 162 LYS LYS D . n D 1 165 GLY 165 163 163 GLY GLY D . n D 1 166 THR 166 164 164 THR THR D . n D 1 167 VAL 167 165 165 VAL VAL D . n D 1 168 LEU 168 166 166 LEU LEU D . n D 1 169 LEU 169 167 167 LEU LEU D . n D 1 170 ALA 170 168 168 ALA ALA D . n D 1 171 ASP 171 169 169 ASP ASP D . n D 1 172 ASN 172 170 170 ASN ASN D . n D 1 173 VAL 173 171 171 VAL VAL D . n D 1 174 ILE 174 172 172 ILE ILE D . n D 1 175 VAL 175 173 173 VAL VAL D . n D 1 176 PRO 176 174 174 PRO PRO D . n D 1 177 GLY 177 175 175 GLY GLY D . n D 1 178 THR 178 176 176 THR THR D . n D 1 179 PRO 179 177 177 PRO PRO D . n D 1 180 ASP 180 178 178 ASP ASP D . n D 1 181 PHE 181 179 179 PHE PHE D . n D 1 182 LEU 182 180 180 LEU LEU D . n D 1 183 ALA 183 181 181 ALA ALA D . n D 1 184 TYR 184 182 182 TYR TYR D . n D 1 185 VAL 185 183 183 VAL VAL D . n D 1 186 ARG 186 184 184 ARG ARG D . n D 1 187 GLY 187 185 185 GLY GLY D . n D 1 188 SER 188 186 186 SER SER D . n D 1 189 SER 189 187 187 SER SER D . n D 1 190 SER 190 188 188 SER SER D . n D 1 191 PHE 191 189 189 PHE PHE D . n D 1 192 GLU 192 190 190 GLU GLU D . n D 1 193 CYS 193 191 191 CYS CYS D . n D 1 194 THR 194 192 192 THR THR D . n D 1 195 HIS 195 193 193 HIS HIS D . n D 1 196 TYR 196 194 194 TYR TYR D . n D 1 197 SER 197 195 195 SER SER D . n D 1 198 SER 198 196 196 SER SER D . n D 1 199 TYR 199 197 197 TYR TYR D . n D 1 200 LEU 200 198 198 LEU LEU D . n D 1 201 GLU 201 199 199 GLU GLU D . n D 1 202 TYR 202 200 200 TYR TYR D . n D 1 203 MET 203 201 201 MET MET D . n D 1 204 LYS 204 202 202 LYS LYS D . n D 1 205 VAL 205 203 203 VAL VAL D . n D 1 206 VAL 206 204 204 VAL VAL D . n D 1 207 ASP 207 205 205 ASP ASP D . n D 1 208 GLY 208 206 206 GLY GLY D . n D 1 209 LEU 209 207 207 LEU LEU D . n D 1 210 GLU 210 208 208 GLU GLU D . n D 1 211 LYS 211 209 209 LYS LYS D . n D 1 212 ALA 212 210 210 ALA ALA D . n D 1 213 ILE 213 211 211 ILE ILE D . n D 1 214 TYR 214 212 212 TYR TYR D . n D 1 215 GLN 215 213 213 GLN GLN D . n D 1 216 GLY 216 214 214 GLY GLY D . n D 1 217 PRO 217 215 215 PRO PRO D . n D 1 218 SER 218 216 ? ? ? D . n D 1 219 SER 219 217 ? ? ? D . n D 1 220 PRO 220 218 ? ? ? D . n D 1 221 ASP 221 219 ? ? ? D . n D 1 222 LYS 222 220 ? ? ? D . n D 1 223 SER 223 221 ? ? ? D . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email katsukitakebe19930208@outlook.jp _pdbx_contact_author.name_first Takebe _pdbx_contact_author.name_last katsuki _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-1611-1042 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 2 SAM 1 301 1 SAM SAM A . F 3 DNI 1 302 5 DNI OCP A . G 4 MG 1 303 1 MG MG A . H 5 CL 1 304 4 CL CL A . I 6 NA 1 305 1 NA NA A . J 2 SAM 1 301 2 SAM SAM B . K 3 DNI 1 302 4 DNI OCP B . L 4 MG 1 303 3 MG MG B . M 5 CL 1 304 7 CL CL B . N 2 SAM 1 301 3 SAM SAM C . O 3 DNI 1 302 3 DNI OCP C . P 4 MG 1 303 4 MG MG C . Q 5 CL 1 304 5 CL CL C . R 2 SAM 1 301 4 SAM SAM D . S 3 DNI 1 302 2 DNI OCP D . T 4 MG 1 303 2 MG MG D . U 5 CL 1 304 1 CL CL D . V 5 CL 1 305 6 CL CL D . W 7 HOH 1 401 74 HOH HOH A . W 7 HOH 2 402 173 HOH HOH A . W 7 HOH 3 403 111 HOH HOH A . W 7 HOH 4 404 143 HOH HOH A . W 7 HOH 5 405 59 HOH HOH A . W 7 HOH 6 406 50 HOH HOH A . W 7 HOH 7 407 76 HOH HOH A . W 7 HOH 8 408 93 HOH HOH A . W 7 HOH 9 409 53 HOH HOH A . W 7 HOH 10 410 26 HOH HOH A . W 7 HOH 11 411 226 HOH HOH A . W 7 HOH 12 412 45 HOH HOH A . W 7 HOH 13 413 135 HOH HOH A . W 7 HOH 14 414 32 HOH HOH A . W 7 HOH 15 415 22 HOH HOH A . W 7 HOH 16 416 47 HOH HOH A . W 7 HOH 17 417 36 HOH HOH A . W 7 HOH 18 418 147 HOH HOH A . W 7 HOH 19 419 58 HOH HOH A . W 7 HOH 20 420 10 HOH HOH A . W 7 HOH 21 421 107 HOH HOH A . W 7 HOH 22 422 30 HOH HOH A . W 7 HOH 23 423 62 HOH HOH A . W 7 HOH 24 424 196 HOH HOH A . W 7 HOH 25 425 14 HOH HOH A . W 7 HOH 26 426 2 HOH HOH A . W 7 HOH 27 427 29 HOH HOH A . W 7 HOH 28 428 176 HOH HOH A . W 7 HOH 29 429 13 HOH HOH A . W 7 HOH 30 430 25 HOH HOH A . W 7 HOH 31 431 229 HOH HOH A . W 7 HOH 32 432 205 HOH HOH A . W 7 HOH 33 433 202 HOH HOH A . W 7 HOH 34 434 150 HOH HOH A . W 7 HOH 35 435 149 HOH HOH A . W 7 HOH 36 436 124 HOH HOH A . W 7 HOH 37 437 19 HOH HOH A . W 7 HOH 38 438 213 HOH HOH A . W 7 HOH 39 439 102 HOH HOH A . W 7 HOH 40 440 92 HOH HOH A . W 7 HOH 41 441 90 HOH HOH A . W 7 HOH 42 442 131 HOH HOH A . W 7 HOH 43 443 101 HOH HOH A . W 7 HOH 44 444 95 HOH HOH A . W 7 HOH 45 445 151 HOH HOH A . W 7 HOH 46 446 200 HOH HOH A . W 7 HOH 47 447 112 HOH HOH A . W 7 HOH 48 448 157 HOH HOH A . W 7 HOH 49 449 85 HOH HOH A . W 7 HOH 50 450 145 HOH HOH A . W 7 HOH 51 451 162 HOH HOH A . W 7 HOH 52 452 56 HOH HOH A . W 7 HOH 53 453 80 HOH HOH A . W 7 HOH 54 454 211 HOH HOH A . W 7 HOH 55 455 132 HOH HOH A . W 7 HOH 56 456 155 HOH HOH A . W 7 HOH 57 457 16 HOH HOH A . W 7 HOH 58 458 82 HOH HOH A . W 7 HOH 59 459 218 HOH HOH A . W 7 HOH 60 460 186 HOH HOH A . W 7 HOH 61 461 115 HOH HOH A . W 7 HOH 62 462 65 HOH HOH A . W 7 HOH 63 463 144 HOH HOH A . W 7 HOH 64 464 141 HOH HOH A . W 7 HOH 65 465 212 HOH HOH A . W 7 HOH 66 466 73 HOH HOH A . W 7 HOH 67 467 180 HOH HOH A . W 7 HOH 68 468 170 HOH HOH A . W 7 HOH 69 469 210 HOH HOH A . W 7 HOH 70 470 152 HOH HOH A . W 7 HOH 71 471 159 HOH HOH A . X 7 HOH 1 401 120 HOH HOH B . X 7 HOH 2 402 55 HOH HOH B . X 7 HOH 3 403 43 HOH HOH B . X 7 HOH 4 404 223 HOH HOH B . X 7 HOH 5 405 98 HOH HOH B . X 7 HOH 6 406 44 HOH HOH B . X 7 HOH 7 407 114 HOH HOH B . X 7 HOH 8 408 103 HOH HOH B . X 7 HOH 9 409 137 HOH HOH B . X 7 HOH 10 410 27 HOH HOH B . X 7 HOH 11 411 99 HOH HOH B . X 7 HOH 12 412 160 HOH HOH B . X 7 HOH 13 413 183 HOH HOH B . X 7 HOH 14 414 139 HOH HOH B . X 7 HOH 15 415 28 HOH HOH B . X 7 HOH 16 416 20 HOH HOH B . X 7 HOH 17 417 7 HOH HOH B . X 7 HOH 18 418 108 HOH HOH B . X 7 HOH 19 419 24 HOH HOH B . X 7 HOH 20 420 64 HOH HOH B . X 7 HOH 21 421 198 HOH HOH B . X 7 HOH 22 422 5 HOH HOH B . X 7 HOH 23 423 18 HOH HOH B . X 7 HOH 24 424 181 HOH HOH B . X 7 HOH 25 425 177 HOH HOH B . X 7 HOH 26 426 123 HOH HOH B . X 7 HOH 27 427 121 HOH HOH B . X 7 HOH 28 428 126 HOH HOH B . X 7 HOH 29 429 91 HOH HOH B . X 7 HOH 30 430 96 HOH HOH B . X 7 HOH 31 431 63 HOH HOH B . X 7 HOH 32 432 104 HOH HOH B . X 7 HOH 33 433 130 HOH HOH B . X 7 HOH 34 434 87 HOH HOH B . X 7 HOH 35 435 48 HOH HOH B . X 7 HOH 36 436 71 HOH HOH B . X 7 HOH 37 437 175 HOH HOH B . X 7 HOH 38 438 84 HOH HOH B . X 7 HOH 39 439 189 HOH HOH B . X 7 HOH 40 440 100 HOH HOH B . X 7 HOH 41 441 31 HOH HOH B . X 7 HOH 42 442 156 HOH HOH B . X 7 HOH 43 443 172 HOH HOH B . X 7 HOH 44 444 89 HOH HOH B . X 7 HOH 45 445 33 HOH HOH B . X 7 HOH 46 446 79 HOH HOH B . X 7 HOH 47 447 105 HOH HOH B . X 7 HOH 48 448 127 HOH HOH B . X 7 HOH 49 449 209 HOH HOH B . X 7 HOH 50 450 9 HOH HOH B . X 7 HOH 51 451 164 HOH HOH B . X 7 HOH 52 452 113 HOH HOH B . X 7 HOH 53 453 197 HOH HOH B . X 7 HOH 54 454 125 HOH HOH B . X 7 HOH 55 455 192 HOH HOH B . X 7 HOH 56 456 128 HOH HOH B . X 7 HOH 57 457 230 HOH HOH B . X 7 HOH 58 458 146 HOH HOH B . X 7 HOH 59 459 168 HOH HOH B . X 7 HOH 60 460 184 HOH HOH B . X 7 HOH 61 461 225 HOH HOH B . X 7 HOH 62 462 15 HOH HOH B . X 7 HOH 63 463 165 HOH HOH B . X 7 HOH 64 464 142 HOH HOH B . X 7 HOH 65 465 179 HOH HOH B . X 7 HOH 66 466 158 HOH HOH B . Y 7 HOH 1 401 231 HOH HOH C . Y 7 HOH 2 402 224 HOH HOH C . Y 7 HOH 3 403 39 HOH HOH C . Y 7 HOH 4 404 35 HOH HOH C . Y 7 HOH 5 405 97 HOH HOH C . Y 7 HOH 6 406 54 HOH HOH C . Y 7 HOH 7 407 78 HOH HOH C . Y 7 HOH 8 408 171 HOH HOH C . Y 7 HOH 9 409 21 HOH HOH C . Y 7 HOH 10 410 153 HOH HOH C . Y 7 HOH 11 411 52 HOH HOH C . Y 7 HOH 12 412 8 HOH HOH C . Y 7 HOH 13 413 118 HOH HOH C . Y 7 HOH 14 414 185 HOH HOH C . Y 7 HOH 15 415 49 HOH HOH C . Y 7 HOH 16 416 66 HOH HOH C . Y 7 HOH 17 417 72 HOH HOH C . Y 7 HOH 18 418 163 HOH HOH C . Y 7 HOH 19 419 37 HOH HOH C . Y 7 HOH 20 420 233 HOH HOH C . Y 7 HOH 21 421 38 HOH HOH C . Y 7 HOH 22 422 236 HOH HOH C . Y 7 HOH 23 423 109 HOH HOH C . Y 7 HOH 24 424 178 HOH HOH C . Y 7 HOH 25 425 136 HOH HOH C . Y 7 HOH 26 426 83 HOH HOH C . Y 7 HOH 27 427 174 HOH HOH C . Y 7 HOH 28 428 46 HOH HOH C . Y 7 HOH 29 429 94 HOH HOH C . Y 7 HOH 30 430 110 HOH HOH C . Y 7 HOH 31 431 41 HOH HOH C . Y 7 HOH 32 432 203 HOH HOH C . Y 7 HOH 33 433 166 HOH HOH C . Y 7 HOH 34 434 232 HOH HOH C . Y 7 HOH 35 435 138 HOH HOH C . Y 7 HOH 36 436 81 HOH HOH C . Y 7 HOH 37 437 238 HOH HOH C . Y 7 HOH 38 438 234 HOH HOH C . Y 7 HOH 39 439 235 HOH HOH C . Y 7 HOH 40 440 204 HOH HOH C . Y 7 HOH 41 441 228 HOH HOH C . Y 7 HOH 42 442 208 HOH HOH C . Y 7 HOH 43 443 239 HOH HOH C . Y 7 HOH 44 444 195 HOH HOH C . Y 7 HOH 45 445 237 HOH HOH C . Y 7 HOH 46 446 119 HOH HOH C . Y 7 HOH 47 447 161 HOH HOH C . Z 7 HOH 1 401 241 HOH HOH D . Z 7 HOH 2 402 182 HOH HOH D . Z 7 HOH 3 403 227 HOH HOH D . Z 7 HOH 4 404 67 HOH HOH D . Z 7 HOH 5 405 193 HOH HOH D . Z 7 HOH 6 406 201 HOH HOH D . Z 7 HOH 7 407 70 HOH HOH D . Z 7 HOH 8 408 23 HOH HOH D . Z 7 HOH 9 409 40 HOH HOH D . Z 7 HOH 10 410 244 HOH HOH D . Z 7 HOH 11 411 117 HOH HOH D . Z 7 HOH 12 412 133 HOH HOH D . Z 7 HOH 13 413 6 HOH HOH D . Z 7 HOH 14 414 194 HOH HOH D . Z 7 HOH 15 415 34 HOH HOH D . Z 7 HOH 16 416 75 HOH HOH D . Z 7 HOH 17 417 61 HOH HOH D . Z 7 HOH 18 418 122 HOH HOH D . Z 7 HOH 19 419 190 HOH HOH D . Z 7 HOH 20 420 207 HOH HOH D . Z 7 HOH 21 421 60 HOH HOH D . Z 7 HOH 22 422 57 HOH HOH D . Z 7 HOH 23 423 140 HOH HOH D . Z 7 HOH 24 424 86 HOH HOH D . Z 7 HOH 25 425 134 HOH HOH D . Z 7 HOH 26 426 129 HOH HOH D . Z 7 HOH 27 427 116 HOH HOH D . Z 7 HOH 28 428 51 HOH HOH D . Z 7 HOH 29 429 148 HOH HOH D . Z 7 HOH 30 430 106 HOH HOH D . Z 7 HOH 31 431 243 HOH HOH D . Z 7 HOH 32 432 242 HOH HOH D . Z 7 HOH 33 433 206 HOH HOH D . Z 7 HOH 34 434 245 HOH HOH D . Z 7 HOH 35 435 240 HOH HOH D . Z 7 HOH 36 436 187 HOH HOH D . Z 7 HOH 37 437 215 HOH HOH D . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA monomeric 1 2 author_and_software_defined_assembly PISA monomeric 1 3 author_and_software_defined_assembly PISA monomeric 1 4 author_and_software_defined_assembly PISA monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,E,F,G,H,I,W 2 1 B,J,K,L,M,X 3 1 C,N,O,P,Q,Y 4 1 D,R,S,T,U,V,Z # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 150 ? 1 MORE -10 ? 1 'SSA (A^2)' 9400 ? 2 'ABSA (A^2)' 150 ? 2 MORE -10 ? 2 'SSA (A^2)' 9350 ? 3 'ABSA (A^2)' 150 ? 3 MORE -10 ? 3 'SSA (A^2)' 8760 ? 4 'ABSA (A^2)' 150 ? 4 MORE -10 ? 4 'SSA (A^2)' 8930 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 143 ? A ASP 141 ? 1_555 MG ? G MG . ? A MG 303 ? 1_555 OD2 ? A ASP 171 ? A ASP 169 ? 1_555 92.0 ? 2 OD1 ? A ASP 143 ? A ASP 141 ? 1_555 MG ? G MG . ? A MG 303 ? 1_555 OD1 ? A ASN 172 ? A ASN 170 ? 1_555 92.9 ? 3 OD2 ? A ASP 171 ? A ASP 169 ? 1_555 MG ? G MG . ? A MG 303 ? 1_555 OD1 ? A ASN 172 ? A ASN 170 ? 1_555 83.0 ? 4 OD1 ? A ASP 143 ? A ASP 141 ? 1_555 MG ? G MG . ? A MG 303 ? 1_555 O23 ? F DNI . ? A DNI 302 ? 1_555 165.6 ? 5 OD2 ? A ASP 171 ? A ASP 169 ? 1_555 MG ? G MG . ? A MG 303 ? 1_555 O23 ? F DNI . ? A DNI 302 ? 1_555 101.9 ? 6 OD1 ? A ASN 172 ? A ASN 170 ? 1_555 MG ? G MG . ? A MG 303 ? 1_555 O23 ? F DNI . ? A DNI 302 ? 1_555 85.6 ? 7 OD1 ? A ASP 143 ? A ASP 141 ? 1_555 MG ? G MG . ? A MG 303 ? 1_555 O24 ? F DNI . ? A DNI 302 ? 1_555 85.1 ? 8 OD2 ? A ASP 171 ? A ASP 169 ? 1_555 MG ? G MG . ? A MG 303 ? 1_555 O24 ? F DNI . ? A DNI 302 ? 1_555 167.2 ? 9 OD1 ? A ASN 172 ? A ASN 170 ? 1_555 MG ? G MG . ? A MG 303 ? 1_555 O24 ? F DNI . ? A DNI 302 ? 1_555 84.7 ? 10 O23 ? F DNI . ? A DNI 302 ? 1_555 MG ? G MG . ? A MG 303 ? 1_555 O24 ? F DNI . ? A DNI 302 ? 1_555 80.6 ? 11 OD1 ? A ASP 143 ? A ASP 141 ? 1_555 MG ? G MG . ? A MG 303 ? 1_555 O ? W HOH . ? A HOH 411 ? 1_555 91.8 ? 12 OD2 ? A ASP 171 ? A ASP 169 ? 1_555 MG ? G MG . ? A MG 303 ? 1_555 O ? W HOH . ? A HOH 411 ? 1_555 93.6 ? 13 OD1 ? A ASN 172 ? A ASN 170 ? 1_555 MG ? G MG . ? A MG 303 ? 1_555 O ? W HOH . ? A HOH 411 ? 1_555 174.3 ? 14 O23 ? F DNI . ? A DNI 302 ? 1_555 MG ? G MG . ? A MG 303 ? 1_555 O ? W HOH . ? A HOH 411 ? 1_555 90.7 ? 15 O24 ? F DNI . ? A DNI 302 ? 1_555 MG ? G MG . ? A MG 303 ? 1_555 O ? W HOH . ? A HOH 411 ? 1_555 98.9 ? 16 OD1 ? B ASP 143 ? B ASP 141 ? 1_555 MG ? L MG . ? B MG 303 ? 1_555 OD2 ? B ASP 171 ? B ASP 169 ? 1_555 93.9 ? 17 OD1 ? B ASP 143 ? B ASP 141 ? 1_555 MG ? L MG . ? B MG 303 ? 1_555 OD1 ? B ASN 172 ? B ASN 170 ? 1_555 91.7 ? 18 OD2 ? B ASP 171 ? B ASP 169 ? 1_555 MG ? L MG . ? B MG 303 ? 1_555 OD1 ? B ASN 172 ? B ASN 170 ? 1_555 80.3 ? 19 OD1 ? B ASP 143 ? B ASP 141 ? 1_555 MG ? L MG . ? B MG 303 ? 1_555 O23 ? K DNI . ? B DNI 302 ? 1_555 164.6 ? 20 OD2 ? B ASP 171 ? B ASP 169 ? 1_555 MG ? L MG . ? B MG 303 ? 1_555 O23 ? K DNI . ? B DNI 302 ? 1_555 96.9 ? 21 OD1 ? B ASN 172 ? B ASN 170 ? 1_555 MG ? L MG . ? B MG 303 ? 1_555 O23 ? K DNI . ? B DNI 302 ? 1_555 79.4 ? 22 OD1 ? B ASP 143 ? B ASP 141 ? 1_555 MG ? L MG . ? B MG 303 ? 1_555 O24 ? K DNI . ? B DNI 302 ? 1_555 84.4 ? 23 OD2 ? B ASP 171 ? B ASP 169 ? 1_555 MG ? L MG . ? B MG 303 ? 1_555 O24 ? K DNI . ? B DNI 302 ? 1_555 162.9 ? 24 OD1 ? B ASN 172 ? B ASN 170 ? 1_555 MG ? L MG . ? B MG 303 ? 1_555 O24 ? K DNI . ? B DNI 302 ? 1_555 82.8 ? 25 O23 ? K DNI . ? B DNI 302 ? 1_555 MG ? L MG . ? B MG 303 ? 1_555 O24 ? K DNI . ? B DNI 302 ? 1_555 82.0 ? 26 OD1 ? B ASP 143 ? B ASP 141 ? 1_555 MG ? L MG . ? B MG 303 ? 1_555 O ? X HOH . ? B HOH 404 ? 1_555 101.0 ? 27 OD2 ? B ASP 171 ? B ASP 169 ? 1_555 MG ? L MG . ? B MG 303 ? 1_555 O ? X HOH . ? B HOH 404 ? 1_555 94.2 ? 28 OD1 ? B ASN 172 ? B ASN 170 ? 1_555 MG ? L MG . ? B MG 303 ? 1_555 O ? X HOH . ? B HOH 404 ? 1_555 166.6 ? 29 O23 ? K DNI . ? B DNI 302 ? 1_555 MG ? L MG . ? B MG 303 ? 1_555 O ? X HOH . ? B HOH 404 ? 1_555 89.2 ? 30 O24 ? K DNI . ? B DNI 302 ? 1_555 MG ? L MG . ? B MG 303 ? 1_555 O ? X HOH . ? B HOH 404 ? 1_555 102.8 ? 31 OD1 ? C ASP 143 ? C ASP 141 ? 1_555 MG ? P MG . ? C MG 303 ? 1_555 OD2 ? C ASP 171 ? C ASP 169 ? 1_555 97.1 ? 32 OD1 ? C ASP 143 ? C ASP 141 ? 1_555 MG ? P MG . ? C MG 303 ? 1_555 OD1 ? C ASN 172 ? C ASN 170 ? 1_555 87.4 ? 33 OD2 ? C ASP 171 ? C ASP 169 ? 1_555 MG ? P MG . ? C MG 303 ? 1_555 OD1 ? C ASN 172 ? C ASN 170 ? 1_555 80.2 ? 34 OD1 ? C ASP 143 ? C ASP 141 ? 1_555 MG ? P MG . ? C MG 303 ? 1_555 O23 ? O DNI . ? C DNI 302 ? 1_555 166.5 ? 35 OD2 ? C ASP 171 ? C ASP 169 ? 1_555 MG ? P MG . ? C MG 303 ? 1_555 O23 ? O DNI . ? C DNI 302 ? 1_555 92.8 ? 36 OD1 ? C ASN 172 ? C ASN 170 ? 1_555 MG ? P MG . ? C MG 303 ? 1_555 O23 ? O DNI . ? C DNI 302 ? 1_555 85.2 ? 37 OD1 ? C ASP 143 ? C ASP 141 ? 1_555 MG ? P MG . ? C MG 303 ? 1_555 O24 ? O DNI . ? C DNI 302 ? 1_555 88.1 ? 38 OD2 ? C ASP 171 ? C ASP 169 ? 1_555 MG ? P MG . ? C MG 303 ? 1_555 O24 ? O DNI . ? C DNI 302 ? 1_555 163.4 ? 39 OD1 ? C ASN 172 ? C ASN 170 ? 1_555 MG ? P MG . ? C MG 303 ? 1_555 O24 ? O DNI . ? C DNI 302 ? 1_555 84.4 ? 40 O23 ? O DNI . ? C DNI 302 ? 1_555 MG ? P MG . ? C MG 303 ? 1_555 O24 ? O DNI . ? C DNI 302 ? 1_555 79.9 ? 41 OD1 ? C ASP 143 ? C ASP 141 ? 1_555 MG ? P MG . ? C MG 303 ? 1_555 O ? Y HOH . ? C HOH 402 ? 1_555 97.5 ? 42 OD2 ? C ASP 171 ? C ASP 169 ? 1_555 MG ? P MG . ? C MG 303 ? 1_555 O ? Y HOH . ? C HOH 402 ? 1_555 90.3 ? 43 OD1 ? C ASN 172 ? C ASN 170 ? 1_555 MG ? P MG . ? C MG 303 ? 1_555 O ? Y HOH . ? C HOH 402 ? 1_555 169.9 ? 44 O23 ? O DNI . ? C DNI 302 ? 1_555 MG ? P MG . ? C MG 303 ? 1_555 O ? Y HOH . ? C HOH 402 ? 1_555 91.6 ? 45 O24 ? O DNI . ? C DNI 302 ? 1_555 MG ? P MG . ? C MG 303 ? 1_555 O ? Y HOH . ? C HOH 402 ? 1_555 104.6 ? 46 OD1 ? D ASP 143 ? D ASP 141 ? 1_555 MG ? T MG . ? D MG 303 ? 1_555 OD2 ? D ASP 143 ? D ASP 141 ? 1_555 47.1 ? 47 OD1 ? D ASP 143 ? D ASP 141 ? 1_555 MG ? T MG . ? D MG 303 ? 1_555 OD2 ? D ASP 171 ? D ASP 169 ? 1_555 92.5 ? 48 OD2 ? D ASP 143 ? D ASP 141 ? 1_555 MG ? T MG . ? D MG 303 ? 1_555 OD2 ? D ASP 171 ? D ASP 169 ? 1_555 91.2 ? 49 OD1 ? D ASP 143 ? D ASP 141 ? 1_555 MG ? T MG . ? D MG 303 ? 1_555 OD1 ? D ASN 172 ? D ASN 170 ? 1_555 87.2 ? 50 OD2 ? D ASP 143 ? D ASP 141 ? 1_555 MG ? T MG . ? D MG 303 ? 1_555 OD1 ? D ASN 172 ? D ASN 170 ? 1_555 134.2 ? 51 OD2 ? D ASP 171 ? D ASP 169 ? 1_555 MG ? T MG . ? D MG 303 ? 1_555 OD1 ? D ASN 172 ? D ASN 170 ? 1_555 85.7 ? 52 OD1 ? D ASP 143 ? D ASP 141 ? 1_555 MG ? T MG . ? D MG 303 ? 1_555 O23 ? S DNI . ? D DNI 302 ? 1_555 164.3 ? 53 OD2 ? D ASP 143 ? D ASP 141 ? 1_555 MG ? T MG . ? D MG 303 ? 1_555 O23 ? S DNI . ? D DNI 302 ? 1_555 141.6 ? 54 OD2 ? D ASP 171 ? D ASP 169 ? 1_555 MG ? T MG . ? D MG 303 ? 1_555 O23 ? S DNI . ? D DNI 302 ? 1_555 99.5 ? 55 OD1 ? D ASN 172 ? D ASN 170 ? 1_555 MG ? T MG . ? D MG 303 ? 1_555 O23 ? S DNI . ? D DNI 302 ? 1_555 83.6 ? 56 OD1 ? D ASP 143 ? D ASP 141 ? 1_555 MG ? T MG . ? D MG 303 ? 1_555 O24 ? S DNI . ? D DNI 302 ? 1_555 92.1 ? 57 OD2 ? D ASP 143 ? D ASP 141 ? 1_555 MG ? T MG . ? D MG 303 ? 1_555 O24 ? S DNI . ? D DNI 302 ? 1_555 103.5 ? 58 OD2 ? D ASP 171 ? D ASP 169 ? 1_555 MG ? T MG . ? D MG 303 ? 1_555 O24 ? S DNI . ? D DNI 302 ? 1_555 163.5 ? 59 OD1 ? D ASN 172 ? D ASN 170 ? 1_555 MG ? T MG . ? D MG 303 ? 1_555 O24 ? S DNI . ? D DNI 302 ? 1_555 78.7 ? 60 O23 ? S DNI . ? D DNI 302 ? 1_555 MG ? T MG . ? D MG 303 ? 1_555 O24 ? S DNI . ? D DNI 302 ? 1_555 73.6 ? 61 OD1 ? D ASP 143 ? D ASP 141 ? 1_555 MG ? T MG . ? D MG 303 ? 1_555 O ? Z HOH . ? D HOH 403 ? 1_555 100.8 ? 62 OD2 ? D ASP 143 ? D ASP 141 ? 1_555 MG ? T MG . ? D MG 303 ? 1_555 O ? Z HOH . ? D HOH 403 ? 1_555 54.1 ? 63 OD2 ? D ASP 171 ? D ASP 169 ? 1_555 MG ? T MG . ? D MG 303 ? 1_555 O ? Z HOH . ? D HOH 403 ? 1_555 97.0 ? 64 OD1 ? D ASN 172 ? D ASN 170 ? 1_555 MG ? T MG . ? D MG 303 ? 1_555 O ? Z HOH . ? D HOH 403 ? 1_555 171.4 ? 65 O23 ? S DNI . ? D DNI 302 ? 1_555 MG ? T MG . ? D MG 303 ? 1_555 O ? Z HOH . ? D HOH 403 ? 1_555 87.9 ? 66 O24 ? S DNI . ? D DNI 302 ? 1_555 MG ? T MG . ? D MG 303 ? 1_555 O ? Z HOH . ? D HOH 403 ? 1_555 97.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-05-31 2 'Structure model' 1 1 2023-06-21 3 'Structure model' 1 2 2023-08-02 4 'Structure model' 1 3 2023-09-27 5 'Structure model' 1 4 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Structure summary' 6 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' audit_author 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' chem_comp 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' entity 8 4 'Structure model' pdbx_entity_nonpoly 9 5 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.country' 2 3 'Structure model' '_citation.journal_abbrev' 3 3 'Structure model' '_citation.journal_id_CSD' 4 3 'Structure model' '_citation.journal_id_ISSN' 5 3 'Structure model' '_citation.journal_volume' 6 3 'Structure model' '_citation.page_first' 7 3 'Structure model' '_citation.page_last' 8 3 'Structure model' '_citation.pdbx_database_id_DOI' 9 3 'Structure model' '_citation.pdbx_database_id_PubMed' 10 3 'Structure model' '_citation.title' 11 3 'Structure model' '_citation.year' 12 4 'Structure model' '_chem_comp.name' 13 4 'Structure model' '_chem_comp.pdbx_synonyms' 14 4 'Structure model' '_entity.pdbx_description' 15 4 'Structure model' '_pdbx_entity_nonpoly.name' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -75.8673 16.7366 37.8311 0.2339 ? -0.0012 ? 0.0325 ? 0.2019 ? -0.0233 ? 0.1915 ? 1.6982 ? -0.0663 ? 0.8143 ? 1.4424 ? -0.6060 ? 1.7352 ? -0.0187 ? -0.1074 ? 0.0913 ? 0.0640 ? -0.0530 ? 0.0053 ? -0.0485 ? 0.0303 ? 0.0733 ? 2 'X-RAY DIFFRACTION' ? refined -65.1258 3.4620 12.5340 0.2108 ? 0.0212 ? 0.0182 ? 0.2511 ? -0.0265 ? 0.2027 ? 1.0377 ? 0.0421 ? 0.4370 ? 2.0004 ? -0.9677 ? 1.5186 ? -0.0298 ? 0.0487 ? 0.0089 ? -0.1002 ? -0.0309 ? -0.0408 ? 0.0213 ? 0.0544 ? 0.0585 ? 3 'X-RAY DIFFRACTION' ? refined -67.8665 46.1592 24.2591 0.3614 ? -0.0355 ? -0.0595 ? 0.2666 ? 0.0223 ? 0.3391 ? 2.3986 ? 0.3977 ? -0.6164 ? 1.6458 ? 0.2737 ? 1.9088 ? -0.0124 ? 0.0121 ? 0.3007 ? -0.0652 ? 0.0289 ? 0.0031 ? -0.2969 ? 0.1367 ? -0.0129 ? 4 'X-RAY DIFFRACTION' ? refined -34.6435 4.9684 26.4604 0.2490 ? -0.0003 ? 0.0194 ? 0.4288 ? 0.0501 ? 0.3454 ? 1.8721 ? 0.5214 ? 0.2136 ? 2.8289 ? 0.7127 ? 2.1903 ? 0.0492 ? 0.1149 ? -0.0608 ? -0.1071 ? 0.0496 ? -0.4779 ? -0.0627 ? 0.5119 ? -0.0940 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 0 ? ? ? A 216 ? ? ;(chain 'A' and resid 0 through 216) ; 2 'X-RAY DIFFRACTION' 2 ? ? B 0 ? ? ? B 216 ? ? ;(chain 'B' and resid 0 through 216) ; 3 'X-RAY DIFFRACTION' 3 ? ? C 3 ? ? ? C 215 ? ? ;(chain 'C' and resid 3 through 215) ; 4 'X-RAY DIFFRACTION' 4 ? ? D 3 ? ? ? D 215 ? ? ;(chain 'D' and resid 3 through 215) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14_3260 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # _pdbx_entry_details.entry_id 7XJB _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 C _pdbx_validate_rmsd_angle.auth_comp_id_1 GLN _pdbx_validate_rmsd_angle.auth_seq_id_1 81 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 C _pdbx_validate_rmsd_angle.auth_comp_id_2 GLN _pdbx_validate_rmsd_angle.auth_seq_id_2 81 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CG _pdbx_validate_rmsd_angle.auth_asym_id_3 C _pdbx_validate_rmsd_angle.auth_comp_id_3 GLN _pdbx_validate_rmsd_angle.auth_seq_id_3 81 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 81.18 _pdbx_validate_rmsd_angle.angle_target_value 113.40 _pdbx_validate_rmsd_angle.angle_deviation -32.22 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.20 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 16 ? ? -130.81 -31.32 2 1 LYS A 36 ? ? -126.37 -51.59 3 1 MET A 40 ? ? -82.24 35.79 4 1 SER A 58 ? ? 23.36 69.05 5 1 TYR A 68 ? ? 55.73 -111.17 6 1 ASP A 133 ? ? -87.74 -82.52 7 1 ASP A 141 ? ? -158.41 36.35 8 1 HIS A 142 ? ? -104.57 -151.10 9 1 SER A 196 ? ? -155.63 -153.24 10 1 LYS B 36 ? ? -130.17 -54.11 11 1 MET B 40 ? ? -82.69 34.91 12 1 SER B 58 ? ? 24.38 68.67 13 1 TYR B 68 ? ? 55.57 -109.74 14 1 ASP B 133 ? ? -87.81 -81.60 15 1 ASP B 141 ? ? -158.89 36.01 16 1 HIS B 142 ? ? -104.55 -151.37 17 1 SER B 196 ? ? -153.21 -154.12 18 1 ASN C 16 ? ? -130.30 -31.09 19 1 LYS C 36 ? ? -124.11 -51.83 20 1 MET C 40 ? ? -83.78 35.80 21 1 SER C 58 ? ? 21.86 69.36 22 1 TYR C 68 ? ? 54.61 -110.75 23 1 ASP C 133 ? ? -87.32 -81.55 24 1 ASP C 141 ? ? -157.23 38.11 25 1 HIS C 142 ? ? -104.89 -149.34 26 1 SER C 196 ? ? -152.66 -146.65 27 1 MET D 40 ? ? -82.75 35.27 28 1 SER D 58 ? ? 22.31 67.48 29 1 TYR D 68 ? ? 56.16 -109.40 30 1 ASP D 133 ? ? -88.18 -82.03 31 1 ASP D 141 ? ? -156.44 37.19 32 1 HIS D 142 ? ? -105.10 -149.41 33 1 SER D 196 ? ? -152.94 -143.55 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A SER 0 ? OG ? A SER 2 OG 2 1 Y 1 A LYS 129 ? CG ? A LYS 131 CG 3 1 Y 1 A LYS 129 ? CD ? A LYS 131 CD 4 1 Y 1 A LYS 129 ? CE ? A LYS 131 CE 5 1 Y 1 A LYS 129 ? NZ ? A LYS 131 NZ 6 1 Y 1 A SER 216 ? OG ? A SER 218 OG 7 1 Y 1 B SER 0 ? OG ? B SER 2 OG 8 1 Y 1 B ARG 11 ? NE ? B ARG 13 NE 9 1 Y 1 B ARG 11 ? CZ ? B ARG 13 CZ 10 1 Y 1 B ARG 11 ? NH1 ? B ARG 13 NH1 11 1 Y 1 B ARG 11 ? NH2 ? B ARG 13 NH2 12 1 Y 1 B LYS 128 ? CE ? B LYS 130 CE 13 1 Y 1 B LYS 128 ? NZ ? B LYS 130 NZ 14 1 Y 1 B LYS 129 ? CG ? B LYS 131 CG 15 1 Y 1 B LYS 129 ? CD ? B LYS 131 CD 16 1 Y 1 B LYS 129 ? CE ? B LYS 131 CE 17 1 Y 1 B LYS 129 ? NZ ? B LYS 131 NZ 18 1 Y 1 B SER 216 ? OG ? B SER 218 OG 19 1 Y 1 C ARG 11 ? CG ? C ARG 13 CG 20 1 Y 1 C ARG 11 ? CD ? C ARG 13 CD 21 1 Y 1 C ARG 11 ? NE ? C ARG 13 NE 22 1 Y 1 C ARG 11 ? CZ ? C ARG 13 CZ 23 1 Y 1 C ARG 11 ? NH1 ? C ARG 13 NH1 24 1 Y 1 C ARG 11 ? NH2 ? C ARG 13 NH2 25 1 Y 1 C LYS 18 ? CG ? C LYS 20 CG 26 1 Y 1 C LYS 18 ? CD ? C LYS 20 CD 27 1 Y 1 C LYS 18 ? CE ? C LYS 20 CE 28 1 Y 1 C LYS 18 ? NZ ? C LYS 20 NZ 29 1 Y 1 C LYS 36 ? CD ? C LYS 38 CD 30 1 Y 1 C LYS 36 ? CE ? C LYS 38 CE 31 1 Y 1 C LYS 36 ? NZ ? C LYS 38 NZ 32 1 Y 1 C GLN 100 ? OE1 ? C GLN 102 OE1 33 1 Y 1 C GLN 100 ? NE2 ? C GLN 102 NE2 34 1 Y 1 C GLN 109 ? CG ? C GLN 111 CG 35 1 Y 1 C GLN 109 ? CD ? C GLN 111 CD 36 1 Y 1 C GLN 109 ? OE1 ? C GLN 111 OE1 37 1 Y 1 C GLN 109 ? NE2 ? C GLN 111 NE2 38 1 Y 1 C LYS 128 ? CG ? C LYS 130 CG 39 1 Y 1 C LYS 128 ? CD ? C LYS 130 CD 40 1 Y 1 C LYS 128 ? CE ? C LYS 130 CE 41 1 Y 1 C LYS 128 ? NZ ? C LYS 130 NZ 42 1 Y 1 C LYS 156 ? CG ? C LYS 158 CG 43 1 Y 1 C LYS 156 ? CD ? C LYS 158 CD 44 1 Y 1 C LYS 156 ? CE ? C LYS 158 CE 45 1 Y 1 C LYS 156 ? NZ ? C LYS 158 NZ 46 1 Y 1 C LYS 162 ? CG ? C LYS 164 CG 47 1 Y 1 C LYS 162 ? CD ? C LYS 164 CD 48 1 Y 1 C LYS 162 ? CE ? C LYS 164 CE 49 1 Y 1 C LYS 162 ? NZ ? C LYS 164 NZ 50 1 Y 1 C LYS 202 ? CD ? C LYS 204 CD 51 1 Y 1 C LYS 202 ? CE ? C LYS 204 CE 52 1 Y 1 C LYS 202 ? NZ ? C LYS 204 NZ 53 1 Y 1 D ARG 11 ? CG ? D ARG 13 CG 54 1 Y 1 D ARG 11 ? CD ? D ARG 13 CD 55 1 Y 1 D ARG 11 ? NE ? D ARG 13 NE 56 1 Y 1 D ARG 11 ? CZ ? D ARG 13 CZ 57 1 Y 1 D ARG 11 ? NH1 ? D ARG 13 NH1 58 1 Y 1 D ARG 11 ? NH2 ? D ARG 13 NH2 59 1 Y 1 D LYS 36 ? CG ? D LYS 38 CG 60 1 Y 1 D LYS 36 ? CD ? D LYS 38 CD 61 1 Y 1 D LYS 36 ? CE ? D LYS 38 CE 62 1 Y 1 D LYS 36 ? NZ ? D LYS 38 NZ 63 1 Y 1 D GLN 81 ? CG ? D GLN 83 CG 64 1 Y 1 D GLN 81 ? CD ? D GLN 83 CD 65 1 Y 1 D GLN 81 ? OE1 ? D GLN 83 OE1 66 1 Y 1 D GLN 81 ? NE2 ? D GLN 83 NE2 67 1 Y 1 D LYS 128 ? CG ? D LYS 130 CG 68 1 Y 1 D LYS 128 ? CD ? D LYS 130 CD 69 1 Y 1 D LYS 128 ? CE ? D LYS 130 CE 70 1 Y 1 D LYS 128 ? NZ ? D LYS 130 NZ 71 1 Y 1 D GLU 190 ? CG ? D GLU 192 CG 72 1 Y 1 D GLU 190 ? CD ? D GLU 192 CD 73 1 Y 1 D GLU 190 ? OE1 ? D GLU 192 OE1 74 1 Y 1 D GLU 190 ? OE2 ? D GLU 192 OE2 75 1 Y 1 D LYS 202 ? CD ? D LYS 204 CD 76 1 Y 1 D LYS 202 ? CE ? D LYS 204 CE 77 1 Y 1 D LYS 202 ? NZ ? D LYS 204 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -1 ? A GLY 1 2 1 Y 1 A SER 217 ? A SER 219 3 1 Y 1 A PRO 218 ? A PRO 220 4 1 Y 1 A ASP 219 ? A ASP 221 5 1 Y 1 A LYS 220 ? A LYS 222 6 1 Y 1 A SER 221 ? A SER 223 7 1 Y 1 B GLY -1 ? B GLY 1 8 1 Y 1 B SER 217 ? B SER 219 9 1 Y 1 B PRO 218 ? B PRO 220 10 1 Y 1 B ASP 219 ? B ASP 221 11 1 Y 1 B LYS 220 ? B LYS 222 12 1 Y 1 B SER 221 ? B SER 223 13 1 Y 1 C GLY -1 ? C GLY 1 14 1 Y 1 C SER 0 ? C SER 2 15 1 Y 1 C MET 1 ? C MET 3 16 1 Y 1 C GLY 2 ? C GLY 4 17 1 Y 1 C SER 216 ? C SER 218 18 1 Y 1 C SER 217 ? C SER 219 19 1 Y 1 C PRO 218 ? C PRO 220 20 1 Y 1 C ASP 219 ? C ASP 221 21 1 Y 1 C LYS 220 ? C LYS 222 22 1 Y 1 C SER 221 ? C SER 223 23 1 Y 1 D GLY -1 ? D GLY 1 24 1 Y 1 D SER 0 ? D SER 2 25 1 Y 1 D MET 1 ? D MET 3 26 1 Y 1 D GLY 2 ? D GLY 4 27 1 Y 1 D SER 216 ? D SER 218 28 1 Y 1 D SER 217 ? D SER 219 29 1 Y 1 D PRO 218 ? D PRO 220 30 1 Y 1 D ASP 219 ? D ASP 221 31 1 Y 1 D LYS 220 ? D LYS 222 32 1 Y 1 D SER 221 ? D SER 223 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 DNI C12 C Y N 89 DNI C15 C Y N 90 DNI C17 C Y N 91 DNI C18 C Y N 92 DNI C19 C Y N 93 DNI C20 C Y N 94 DNI C22 C Y N 95 DNI C01 C N N 96 DNI C02 C Y N 97 DNI C03 C Y N 98 DNI C04 C Y N 99 DNI C06 C Y N 100 DNI C07 C Y N 101 DNI C09 C N N 102 DNI C21 C Y N 103 DNI N05 N Y N 104 DNI N13 N Y N 105 DNI N16 N Y N 106 DNI N25 N N N 107 DNI O10 O N N 108 DNI O14 O Y N 109 DNI O23 O N N 110 DNI O24 O N N 111 DNI O26 O N N 112 DNI O27 O N N 113 DNI CL1 CL N N 114 DNI CL2 CL N N 115 DNI H1 H N N 116 DNI H2 H N N 117 DNI H3 H N N 118 DNI H4 H N N 119 DNI H5 H N N 120 DNI H6 H N N 121 DNI H7 H N N 122 DNI H8 H N N 123 DNI H10 H N N 124 DNI H11 H N N 125 GLN N N N N 126 GLN CA C N S 127 GLN C C N N 128 GLN O O N N 129 GLN CB C N N 130 GLN CG C N N 131 GLN CD C N N 132 GLN OE1 O N N 133 GLN NE2 N N N 134 GLN OXT O N N 135 GLN H H N N 136 GLN H2 H N N 137 GLN HA H N N 138 GLN HB2 H N N 139 GLN HB3 H N N 140 GLN HG2 H N N 141 GLN HG3 H N N 142 GLN HE21 H N N 143 GLN HE22 H N N 144 GLN HXT H N N 145 GLU N N N N 146 GLU CA C N S 147 GLU C C N N 148 GLU O O N N 149 GLU CB C N N 150 GLU CG C N N 151 GLU CD C N N 152 GLU OE1 O N N 153 GLU OE2 O N N 154 GLU OXT O N N 155 GLU H H N N 156 GLU H2 H N N 157 GLU HA H N N 158 GLU HB2 H N N 159 GLU HB3 H N N 160 GLU HG2 H N N 161 GLU HG3 H N N 162 GLU HE2 H N N 163 GLU HXT H N N 164 GLY N N N N 165 GLY CA C N N 166 GLY C C N N 167 GLY O O N N 168 GLY OXT O N N 169 GLY H H N N 170 GLY H2 H N N 171 GLY HA2 H N N 172 GLY HA3 H N N 173 GLY HXT H N N 174 HIS N N N N 175 HIS CA C N S 176 HIS C C N N 177 HIS O O N N 178 HIS CB C N N 179 HIS CG C Y N 180 HIS ND1 N Y N 181 HIS CD2 C Y N 182 HIS CE1 C Y N 183 HIS NE2 N Y N 184 HIS OXT O N N 185 HIS H H N N 186 HIS H2 H N N 187 HIS HA H N N 188 HIS HB2 H N N 189 HIS HB3 H N N 190 HIS HD1 H N N 191 HIS HD2 H N N 192 HIS HE1 H N N 193 HIS HE2 H N N 194 HIS HXT H N N 195 HOH O O N N 196 HOH H1 H N N 197 HOH H2 H N N 198 ILE N N N N 199 ILE CA C N S 200 ILE C C N N 201 ILE O O N N 202 ILE CB C N S 203 ILE CG1 C N N 204 ILE CG2 C N N 205 ILE CD1 C N N 206 ILE OXT O N N 207 ILE H H N N 208 ILE H2 H N N 209 ILE HA H N N 210 ILE HB H N N 211 ILE HG12 H N N 212 ILE HG13 H N N 213 ILE HG21 H N N 214 ILE HG22 H N N 215 ILE HG23 H N N 216 ILE HD11 H N N 217 ILE HD12 H N N 218 ILE HD13 H N N 219 ILE HXT H N N 220 LEU N N N N 221 LEU CA C N S 222 LEU C C N N 223 LEU O O N N 224 LEU CB C N N 225 LEU CG C N N 226 LEU CD1 C N N 227 LEU CD2 C N N 228 LEU OXT O N N 229 LEU H H N N 230 LEU H2 H N N 231 LEU HA H N N 232 LEU HB2 H N N 233 LEU HB3 H N N 234 LEU HG H N N 235 LEU HD11 H N N 236 LEU HD12 H N N 237 LEU HD13 H N N 238 LEU HD21 H N N 239 LEU HD22 H N N 240 LEU HD23 H N N 241 LEU HXT H N N 242 LYS N N N N 243 LYS CA C N S 244 LYS C C N N 245 LYS O O N N 246 LYS CB C N N 247 LYS CG C N N 248 LYS CD C N N 249 LYS CE C N N 250 LYS NZ N N N 251 LYS OXT O N N 252 LYS H H N N 253 LYS H2 H N N 254 LYS HA H N N 255 LYS HB2 H N N 256 LYS HB3 H N N 257 LYS HG2 H N N 258 LYS HG3 H N N 259 LYS HD2 H N N 260 LYS HD3 H N N 261 LYS HE2 H N N 262 LYS HE3 H N N 263 LYS HZ1 H N N 264 LYS HZ2 H N N 265 LYS HZ3 H N N 266 LYS HXT H N N 267 MET N N N N 268 MET CA C N S 269 MET C C N N 270 MET O O N N 271 MET CB C N N 272 MET CG C N N 273 MET SD S N N 274 MET CE C N N 275 MET OXT O N N 276 MET H H N N 277 MET H2 H N N 278 MET HA H N N 279 MET HB2 H N N 280 MET HB3 H N N 281 MET HG2 H N N 282 MET HG3 H N N 283 MET HE1 H N N 284 MET HE2 H N N 285 MET HE3 H N N 286 MET HXT H N N 287 MG MG MG N N 288 NA NA NA N N 289 PHE N N N N 290 PHE CA C N S 291 PHE C C N N 292 PHE O O N N 293 PHE CB C N N 294 PHE CG C Y N 295 PHE CD1 C Y N 296 PHE CD2 C Y N 297 PHE CE1 C Y N 298 PHE CE2 C Y N 299 PHE CZ C Y N 300 PHE OXT O N N 301 PHE H H N N 302 PHE H2 H N N 303 PHE HA H N N 304 PHE HB2 H N N 305 PHE HB3 H N N 306 PHE HD1 H N N 307 PHE HD2 H N N 308 PHE HE1 H N N 309 PHE HE2 H N N 310 PHE HZ H N N 311 PHE HXT H N N 312 PRO N N N N 313 PRO CA C N S 314 PRO C C N N 315 PRO O O N N 316 PRO CB C N N 317 PRO CG C N N 318 PRO CD C N N 319 PRO OXT O N N 320 PRO H H N N 321 PRO HA H N N 322 PRO HB2 H N N 323 PRO HB3 H N N 324 PRO HG2 H N N 325 PRO HG3 H N N 326 PRO HD2 H N N 327 PRO HD3 H N N 328 PRO HXT H N N 329 SAM N N N N 330 SAM CA C N S 331 SAM C C N N 332 SAM O O N N 333 SAM OXT O N N 334 SAM CB C N N 335 SAM CG C N N 336 SAM SD S N S 337 SAM CE C N N 338 SAM "C5'" C N N 339 SAM "C4'" C N S 340 SAM "O4'" O N N 341 SAM "C3'" C N S 342 SAM "O3'" O N N 343 SAM "C2'" C N R 344 SAM "O2'" O N N 345 SAM "C1'" C N R 346 SAM N9 N Y N 347 SAM C8 C Y N 348 SAM N7 N Y N 349 SAM C5 C Y N 350 SAM C6 C Y N 351 SAM N6 N N N 352 SAM N1 N Y N 353 SAM C2 C Y N 354 SAM N3 N Y N 355 SAM C4 C Y N 356 SAM HN1 H N N 357 SAM HN2 H N N 358 SAM HA H N N 359 SAM HB1 H N N 360 SAM HB2 H N N 361 SAM HG1 H N N 362 SAM HG2 H N N 363 SAM HE1 H N N 364 SAM HE2 H N N 365 SAM HE3 H N N 366 SAM "H5'1" H N N 367 SAM "H5'2" H N N 368 SAM "H4'" H N N 369 SAM "H3'" H N N 370 SAM "HO3'" H N N 371 SAM "H2'" H N N 372 SAM "HO2'" H N N 373 SAM "H1'" H N N 374 SAM H8 H N N 375 SAM HN61 H N N 376 SAM HN62 H N N 377 SAM H2 H N N 378 SER N N N N 379 SER CA C N S 380 SER C C N N 381 SER O O N N 382 SER CB C N N 383 SER OG O N N 384 SER OXT O N N 385 SER H H N N 386 SER H2 H N N 387 SER HA H N N 388 SER HB2 H N N 389 SER HB3 H N N 390 SER HG H N N 391 SER HXT H N N 392 THR N N N N 393 THR CA C N S 394 THR C C N N 395 THR O O N N 396 THR CB C N R 397 THR OG1 O N N 398 THR CG2 C N N 399 THR OXT O N N 400 THR H H N N 401 THR H2 H N N 402 THR HA H N N 403 THR HB H N N 404 THR HG1 H N N 405 THR HG21 H N N 406 THR HG22 H N N 407 THR HG23 H N N 408 THR HXT H N N 409 TRP N N N N 410 TRP CA C N S 411 TRP C C N N 412 TRP O O N N 413 TRP CB C N N 414 TRP CG C Y N 415 TRP CD1 C Y N 416 TRP CD2 C Y N 417 TRP NE1 N Y N 418 TRP CE2 C Y N 419 TRP CE3 C Y N 420 TRP CZ2 C Y N 421 TRP CZ3 C Y N 422 TRP CH2 C Y N 423 TRP OXT O N N 424 TRP H H N N 425 TRP H2 H N N 426 TRP HA H N N 427 TRP HB2 H N N 428 TRP HB3 H N N 429 TRP HD1 H N N 430 TRP HE1 H N N 431 TRP HE3 H N N 432 TRP HZ2 H N N 433 TRP HZ3 H N N 434 TRP HH2 H N N 435 TRP HXT H N N 436 TYR N N N N 437 TYR CA C N S 438 TYR C C N N 439 TYR O O N N 440 TYR CB C N N 441 TYR CG C Y N 442 TYR CD1 C Y N 443 TYR CD2 C Y N 444 TYR CE1 C Y N 445 TYR CE2 C Y N 446 TYR CZ C Y N 447 TYR OH O N N 448 TYR OXT O N N 449 TYR H H N N 450 TYR H2 H N N 451 TYR HA H N N 452 TYR HB2 H N N 453 TYR HB3 H N N 454 TYR HD1 H N N 455 TYR HD2 H N N 456 TYR HE1 H N N 457 TYR HE2 H N N 458 TYR HH H N N 459 TYR HXT H N N 460 VAL N N N N 461 VAL CA C N S 462 VAL C C N N 463 VAL O O N N 464 VAL CB C N N 465 VAL CG1 C N N 466 VAL CG2 C N N 467 VAL OXT O N N 468 VAL H H N N 469 VAL H2 H N N 470 VAL HA H N N 471 VAL HB H N N 472 VAL HG11 H N N 473 VAL HG12 H N N 474 VAL HG13 H N N 475 VAL HG21 H N N 476 VAL HG22 H N N 477 VAL HG23 H N N 478 VAL HXT H N N 479 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 DNI O27 N25 sing N N 83 DNI O24 C20 sing N N 84 DNI N25 O26 doub N N 85 DNI N25 C19 sing N N 86 DNI C20 C19 doub Y N 87 DNI C20 C21 sing Y N 88 DNI C19 C18 sing Y N 89 DNI O23 C21 sing N N 90 DNI C21 C22 doub Y N 91 DNI C18 C17 doub Y N 92 DNI C22 C17 sing Y N 93 DNI C17 C15 sing N N 94 DNI O14 C15 sing Y N 95 DNI O14 N13 sing Y N 96 DNI C15 N16 doub Y N 97 DNI N13 C12 doub Y N 98 DNI N16 C12 sing Y N 99 DNI C01 C02 sing N N 100 DNI C12 C03 sing N N 101 DNI C02 C03 doub Y N 102 DNI C02 C07 sing Y N 103 DNI C03 C04 sing Y N 104 DNI CL1 C07 sing N N 105 DNI C07 C06 doub Y N 106 DNI C04 CL2 sing N N 107 DNI C04 N05 doub Y N 108 DNI C06 N05 sing Y N 109 DNI C06 C09 sing N N 110 DNI N05 O10 sing N N 111 DNI C18 H1 sing N N 112 DNI C22 H2 sing N N 113 DNI C01 H3 sing N N 114 DNI C01 H4 sing N N 115 DNI C01 H5 sing N N 116 DNI C09 H6 sing N N 117 DNI C09 H7 sing N N 118 DNI C09 H8 sing N N 119 DNI O23 H10 sing N N 120 DNI O24 H11 sing N N 121 GLN N CA sing N N 122 GLN N H sing N N 123 GLN N H2 sing N N 124 GLN CA C sing N N 125 GLN CA CB sing N N 126 GLN CA HA sing N N 127 GLN C O doub N N 128 GLN C OXT sing N N 129 GLN CB CG sing N N 130 GLN CB HB2 sing N N 131 GLN CB HB3 sing N N 132 GLN CG CD sing N N 133 GLN CG HG2 sing N N 134 GLN CG HG3 sing N N 135 GLN CD OE1 doub N N 136 GLN CD NE2 sing N N 137 GLN NE2 HE21 sing N N 138 GLN NE2 HE22 sing N N 139 GLN OXT HXT sing N N 140 GLU N CA sing N N 141 GLU N H sing N N 142 GLU N H2 sing N N 143 GLU CA C sing N N 144 GLU CA CB sing N N 145 GLU CA HA sing N N 146 GLU C O doub N N 147 GLU C OXT sing N N 148 GLU CB CG sing N N 149 GLU CB HB2 sing N N 150 GLU CB HB3 sing N N 151 GLU CG CD sing N N 152 GLU CG HG2 sing N N 153 GLU CG HG3 sing N N 154 GLU CD OE1 doub N N 155 GLU CD OE2 sing N N 156 GLU OE2 HE2 sing N N 157 GLU OXT HXT sing N N 158 GLY N CA sing N N 159 GLY N H sing N N 160 GLY N H2 sing N N 161 GLY CA C sing N N 162 GLY CA HA2 sing N N 163 GLY CA HA3 sing N N 164 GLY C O doub N N 165 GLY C OXT sing N N 166 GLY OXT HXT sing N N 167 HIS N CA sing N N 168 HIS N H sing N N 169 HIS N H2 sing N N 170 HIS CA C sing N N 171 HIS CA CB sing N N 172 HIS CA HA sing N N 173 HIS C O doub N N 174 HIS C OXT sing N N 175 HIS CB CG sing N N 176 HIS CB HB2 sing N N 177 HIS CB HB3 sing N N 178 HIS CG ND1 sing Y N 179 HIS CG CD2 doub Y N 180 HIS ND1 CE1 doub Y N 181 HIS ND1 HD1 sing N N 182 HIS CD2 NE2 sing Y N 183 HIS CD2 HD2 sing N N 184 HIS CE1 NE2 sing Y N 185 HIS CE1 HE1 sing N N 186 HIS NE2 HE2 sing N N 187 HIS OXT HXT sing N N 188 HOH O H1 sing N N 189 HOH O H2 sing N N 190 ILE N CA sing N N 191 ILE N H sing N N 192 ILE N H2 sing N N 193 ILE CA C sing N N 194 ILE CA CB sing N N 195 ILE CA HA sing N N 196 ILE C O doub N N 197 ILE C OXT sing N N 198 ILE CB CG1 sing N N 199 ILE CB CG2 sing N N 200 ILE CB HB sing N N 201 ILE CG1 CD1 sing N N 202 ILE CG1 HG12 sing N N 203 ILE CG1 HG13 sing N N 204 ILE CG2 HG21 sing N N 205 ILE CG2 HG22 sing N N 206 ILE CG2 HG23 sing N N 207 ILE CD1 HD11 sing N N 208 ILE CD1 HD12 sing N N 209 ILE CD1 HD13 sing N N 210 ILE OXT HXT sing N N 211 LEU N CA sing N N 212 LEU N H sing N N 213 LEU N H2 sing N N 214 LEU CA C sing N N 215 LEU CA CB sing N N 216 LEU CA HA sing N N 217 LEU C O doub N N 218 LEU C OXT sing N N 219 LEU CB CG sing N N 220 LEU CB HB2 sing N N 221 LEU CB HB3 sing N N 222 LEU CG CD1 sing N N 223 LEU CG CD2 sing N N 224 LEU CG HG sing N N 225 LEU CD1 HD11 sing N N 226 LEU CD1 HD12 sing N N 227 LEU CD1 HD13 sing N N 228 LEU CD2 HD21 sing N N 229 LEU CD2 HD22 sing N N 230 LEU CD2 HD23 sing N N 231 LEU OXT HXT sing N N 232 LYS N CA sing N N 233 LYS N H sing N N 234 LYS N H2 sing N N 235 LYS CA C sing N N 236 LYS CA CB sing N N 237 LYS CA HA sing N N 238 LYS C O doub N N 239 LYS C OXT sing N N 240 LYS CB CG sing N N 241 LYS CB HB2 sing N N 242 LYS CB HB3 sing N N 243 LYS CG CD sing N N 244 LYS CG HG2 sing N N 245 LYS CG HG3 sing N N 246 LYS CD CE sing N N 247 LYS CD HD2 sing N N 248 LYS CD HD3 sing N N 249 LYS CE NZ sing N N 250 LYS CE HE2 sing N N 251 LYS CE HE3 sing N N 252 LYS NZ HZ1 sing N N 253 LYS NZ HZ2 sing N N 254 LYS NZ HZ3 sing N N 255 LYS OXT HXT sing N N 256 MET N CA sing N N 257 MET N H sing N N 258 MET N H2 sing N N 259 MET CA C sing N N 260 MET CA CB sing N N 261 MET CA HA sing N N 262 MET C O doub N N 263 MET C OXT sing N N 264 MET CB CG sing N N 265 MET CB HB2 sing N N 266 MET CB HB3 sing N N 267 MET CG SD sing N N 268 MET CG HG2 sing N N 269 MET CG HG3 sing N N 270 MET SD CE sing N N 271 MET CE HE1 sing N N 272 MET CE HE2 sing N N 273 MET CE HE3 sing N N 274 MET OXT HXT sing N N 275 PHE N CA sing N N 276 PHE N H sing N N 277 PHE N H2 sing N N 278 PHE CA C sing N N 279 PHE CA CB sing N N 280 PHE CA HA sing N N 281 PHE C O doub N N 282 PHE C OXT sing N N 283 PHE CB CG sing N N 284 PHE CB HB2 sing N N 285 PHE CB HB3 sing N N 286 PHE CG CD1 doub Y N 287 PHE CG CD2 sing Y N 288 PHE CD1 CE1 sing Y N 289 PHE CD1 HD1 sing N N 290 PHE CD2 CE2 doub Y N 291 PHE CD2 HD2 sing N N 292 PHE CE1 CZ doub Y N 293 PHE CE1 HE1 sing N N 294 PHE CE2 CZ sing Y N 295 PHE CE2 HE2 sing N N 296 PHE CZ HZ sing N N 297 PHE OXT HXT sing N N 298 PRO N CA sing N N 299 PRO N CD sing N N 300 PRO N H sing N N 301 PRO CA C sing N N 302 PRO CA CB sing N N 303 PRO CA HA sing N N 304 PRO C O doub N N 305 PRO C OXT sing N N 306 PRO CB CG sing N N 307 PRO CB HB2 sing N N 308 PRO CB HB3 sing N N 309 PRO CG CD sing N N 310 PRO CG HG2 sing N N 311 PRO CG HG3 sing N N 312 PRO CD HD2 sing N N 313 PRO CD HD3 sing N N 314 PRO OXT HXT sing N N 315 SAM N CA sing N N 316 SAM N HN1 sing N N 317 SAM N HN2 sing N N 318 SAM CA C sing N N 319 SAM CA CB sing N N 320 SAM CA HA sing N N 321 SAM C O doub N N 322 SAM C OXT sing N N 323 SAM CB CG sing N N 324 SAM CB HB1 sing N N 325 SAM CB HB2 sing N N 326 SAM CG SD sing N N 327 SAM CG HG1 sing N N 328 SAM CG HG2 sing N N 329 SAM SD CE sing N N 330 SAM SD "C5'" sing N N 331 SAM CE HE1 sing N N 332 SAM CE HE2 sing N N 333 SAM CE HE3 sing N N 334 SAM "C5'" "C4'" sing N N 335 SAM "C5'" "H5'1" sing N N 336 SAM "C5'" "H5'2" sing N N 337 SAM "C4'" "O4'" sing N N 338 SAM "C4'" "C3'" sing N N 339 SAM "C4'" "H4'" sing N N 340 SAM "O4'" "C1'" sing N N 341 SAM "C3'" "O3'" sing N N 342 SAM "C3'" "C2'" sing N N 343 SAM "C3'" "H3'" sing N N 344 SAM "O3'" "HO3'" sing N N 345 SAM "C2'" "O2'" sing N N 346 SAM "C2'" "C1'" sing N N 347 SAM "C2'" "H2'" sing N N 348 SAM "O2'" "HO2'" sing N N 349 SAM "C1'" N9 sing N N 350 SAM "C1'" "H1'" sing N N 351 SAM N9 C8 sing Y N 352 SAM N9 C4 sing Y N 353 SAM C8 N7 doub Y N 354 SAM C8 H8 sing N N 355 SAM N7 C5 sing Y N 356 SAM C5 C6 sing Y N 357 SAM C5 C4 doub Y N 358 SAM C6 N6 sing N N 359 SAM C6 N1 doub Y N 360 SAM N6 HN61 sing N N 361 SAM N6 HN62 sing N N 362 SAM N1 C2 sing Y N 363 SAM C2 N3 doub Y N 364 SAM C2 H2 sing N N 365 SAM N3 C4 sing Y N 366 SER N CA sing N N 367 SER N H sing N N 368 SER N H2 sing N N 369 SER CA C sing N N 370 SER CA CB sing N N 371 SER CA HA sing N N 372 SER C O doub N N 373 SER C OXT sing N N 374 SER CB OG sing N N 375 SER CB HB2 sing N N 376 SER CB HB3 sing N N 377 SER OG HG sing N N 378 SER OXT HXT sing N N 379 THR N CA sing N N 380 THR N H sing N N 381 THR N H2 sing N N 382 THR CA C sing N N 383 THR CA CB sing N N 384 THR CA HA sing N N 385 THR C O doub N N 386 THR C OXT sing N N 387 THR CB OG1 sing N N 388 THR CB CG2 sing N N 389 THR CB HB sing N N 390 THR OG1 HG1 sing N N 391 THR CG2 HG21 sing N N 392 THR CG2 HG22 sing N N 393 THR CG2 HG23 sing N N 394 THR OXT HXT sing N N 395 TRP N CA sing N N 396 TRP N H sing N N 397 TRP N H2 sing N N 398 TRP CA C sing N N 399 TRP CA CB sing N N 400 TRP CA HA sing N N 401 TRP C O doub N N 402 TRP C OXT sing N N 403 TRP CB CG sing N N 404 TRP CB HB2 sing N N 405 TRP CB HB3 sing N N 406 TRP CG CD1 doub Y N 407 TRP CG CD2 sing Y N 408 TRP CD1 NE1 sing Y N 409 TRP CD1 HD1 sing N N 410 TRP CD2 CE2 doub Y N 411 TRP CD2 CE3 sing Y N 412 TRP NE1 CE2 sing Y N 413 TRP NE1 HE1 sing N N 414 TRP CE2 CZ2 sing Y N 415 TRP CE3 CZ3 doub Y N 416 TRP CE3 HE3 sing N N 417 TRP CZ2 CH2 doub Y N 418 TRP CZ2 HZ2 sing N N 419 TRP CZ3 CH2 sing Y N 420 TRP CZ3 HZ3 sing N N 421 TRP CH2 HH2 sing N N 422 TRP OXT HXT sing N N 423 TYR N CA sing N N 424 TYR N H sing N N 425 TYR N H2 sing N N 426 TYR CA C sing N N 427 TYR CA CB sing N N 428 TYR CA HA sing N N 429 TYR C O doub N N 430 TYR C OXT sing N N 431 TYR CB CG sing N N 432 TYR CB HB2 sing N N 433 TYR CB HB3 sing N N 434 TYR CG CD1 doub Y N 435 TYR CG CD2 sing Y N 436 TYR CD1 CE1 sing Y N 437 TYR CD1 HD1 sing N N 438 TYR CD2 CE2 doub Y N 439 TYR CD2 HD2 sing N N 440 TYR CE1 CZ doub Y N 441 TYR CE1 HE1 sing N N 442 TYR CE2 CZ sing Y N 443 TYR CE2 HE2 sing N N 444 TYR CZ OH sing N N 445 TYR OH HH sing N N 446 TYR OXT HXT sing N N 447 VAL N CA sing N N 448 VAL N H sing N N 449 VAL N H2 sing N N 450 VAL CA C sing N N 451 VAL CA CB sing N N 452 VAL CA HA sing N N 453 VAL C O doub N N 454 VAL C OXT sing N N 455 VAL CB CG1 sing N N 456 VAL CB CG2 sing N N 457 VAL CB HB sing N N 458 VAL CG1 HG11 sing N N 459 VAL CG1 HG12 sing N N 460 VAL CG1 HG13 sing N N 461 VAL CG2 HG21 sing N N 462 VAL CG2 HG22 sing N N 463 VAL CG2 HG23 sing N N 464 VAL OXT HXT sing N N 465 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Japan Society for the Promotion of Science (JSPS)' Japan JP15K08034 1 'Japan Agency for Medical Research and Development (AMED)' Japan 'JP18am0101001 (0318)' 2 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 DNI ? ? DNI ? ? 'SUBJECT OF INVESTIGATION' ? 2 MG ? ? MG ? ? 'SUBJECT OF INVESTIGATION' ? 3 SAM ? ? SAM ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 S-ADENOSYLMETHIONINE SAM 3 Opicapone DNI 4 'MAGNESIUM ION' MG 5 'CHLORIDE ION' CL 6 'SODIUM ION' NA 7 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6LFE _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #