data_7XLP # _entry.id 7XLP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7XLP pdb_00007xlp 10.2210/pdb7xlp/pdb WWPDB D_1300027231 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7XLP _pdbx_database_status.recvd_initial_deposition_date 2022-04-22 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kishikawa, S.' 1 0000-0002-9729-7423 'Takano, K.' 2 0000-0002-3759-9972 'Ubukata, O.' 3 0000-0002-8133-9705 'Hanzawa, H.' 4 0000-0002-0471-7936 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Mol.Cancer Ther.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1538-8514 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 22 _citation.language ? _citation.page_first 317 _citation.page_last 332 _citation.title ;Discovery of a Novel ATP-Competitive MEK Inhibitor DS03090629 that Overcomes Resistance Conferred by BRAF Overexpression in BRAF-Mutated Melanoma. ; _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1158/1535-7163.MCT-22-0306 _citation.pdbx_database_id_PubMed 36622773 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Takano, K.' 1 ? primary 'Munehira, Y.' 2 ? primary 'Hatanaka, M.' 3 ? primary 'Murakami, R.' 4 ? primary 'Shibata, Y.' 5 ? primary 'Shida, T.' 6 ? primary 'Takeuchi, K.' 7 ? primary 'Takechi, S.' 8 ? primary 'Tabata, T.' 9 ? primary 'Shimada, T.' 10 ? primary 'Kishikawa, S.' 11 ? primary 'Matsui, Y.' 12 ? primary 'Ubukata, O.' 13 ? primary 'Seki, T.' 14 ? primary 'Kaneta, Y.' 15 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7XLP _cell.details ? _cell.formula_units_Z ? _cell.length_a 76.760 _cell.length_a_esd ? _cell.length_b 76.760 _cell.length_b_esd ? _cell.length_c 222.438 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 7XLP _symmetry.cell_setting ? _symmetry.Int_Tables_number 178 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 61 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Dual specificity mitogen-activated protein kinase kinase 1' 38916.879 1 2.7.12.2 'S298N, S299K, Y300K' ? ? 2 non-polymer syn '(1~{R},3~{S})-3-[[6-[2-chloranyl-4-(4-methylpyrimidin-2-yl)oxy-phenyl]-3-methyl-1~{H}-indazol-4-yl]oxy]cyclohexan-1-amine' 463.959 1 ? ? ? ? 3 non-polymer syn 'DIMETHYL SULFOXIDE' 78.133 1 ? ? ? ? 4 non-polymer syn 'CALCIUM ION' 40.078 3 ? ? ? ? 5 water nat water 18.015 73 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MAP kinase kinase 1,MAPKK 1,MKK1,ERK activator kinase 1,MAPK/ERK kinase 1,MEK 1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIREL QVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSN ILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMF GCQVEGDAAETPPRPRTPGRPLNKKGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQL MVHAFIKRSDAEEVDFAGWLCSTIGLNQ ; _entity_poly.pdbx_seq_one_letter_code_can ;GLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIREL QVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSN ILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMF GCQVEGDAAETPPRPRTPGRPLNKKGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQL MVHAFIKRSDAEEVDFAGWLCSTIGLNQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 LEU n 1 3 GLU n 1 4 GLU n 1 5 LEU n 1 6 GLU n 1 7 LEU n 1 8 ASP n 1 9 GLU n 1 10 GLN n 1 11 GLN n 1 12 ARG n 1 13 LYS n 1 14 ARG n 1 15 LEU n 1 16 GLU n 1 17 ALA n 1 18 PHE n 1 19 LEU n 1 20 THR n 1 21 GLN n 1 22 LYS n 1 23 GLN n 1 24 LYS n 1 25 VAL n 1 26 GLY n 1 27 GLU n 1 28 LEU n 1 29 LYS n 1 30 ASP n 1 31 ASP n 1 32 ASP n 1 33 PHE n 1 34 GLU n 1 35 LYS n 1 36 ILE n 1 37 SER n 1 38 GLU n 1 39 LEU n 1 40 GLY n 1 41 ALA n 1 42 GLY n 1 43 ASN n 1 44 GLY n 1 45 GLY n 1 46 VAL n 1 47 VAL n 1 48 PHE n 1 49 LYS n 1 50 VAL n 1 51 SER n 1 52 HIS n 1 53 LYS n 1 54 PRO n 1 55 SER n 1 56 GLY n 1 57 LEU n 1 58 VAL n 1 59 MET n 1 60 ALA n 1 61 ARG n 1 62 LYS n 1 63 LEU n 1 64 ILE n 1 65 HIS n 1 66 LEU n 1 67 GLU n 1 68 ILE n 1 69 LYS n 1 70 PRO n 1 71 ALA n 1 72 ILE n 1 73 ARG n 1 74 ASN n 1 75 GLN n 1 76 ILE n 1 77 ILE n 1 78 ARG n 1 79 GLU n 1 80 LEU n 1 81 GLN n 1 82 VAL n 1 83 LEU n 1 84 HIS n 1 85 GLU n 1 86 CYS n 1 87 ASN n 1 88 SER n 1 89 PRO n 1 90 TYR n 1 91 ILE n 1 92 VAL n 1 93 GLY n 1 94 PHE n 1 95 TYR n 1 96 GLY n 1 97 ALA n 1 98 PHE n 1 99 TYR n 1 100 SER n 1 101 ASP n 1 102 GLY n 1 103 GLU n 1 104 ILE n 1 105 SER n 1 106 ILE n 1 107 CYS n 1 108 MET n 1 109 GLU n 1 110 HIS n 1 111 MET n 1 112 ASP n 1 113 GLY n 1 114 GLY n 1 115 SER n 1 116 LEU n 1 117 ASP n 1 118 GLN n 1 119 VAL n 1 120 LEU n 1 121 LYS n 1 122 LYS n 1 123 ALA n 1 124 GLY n 1 125 ARG n 1 126 ILE n 1 127 PRO n 1 128 GLU n 1 129 GLN n 1 130 ILE n 1 131 LEU n 1 132 GLY n 1 133 LYS n 1 134 VAL n 1 135 SER n 1 136 ILE n 1 137 ALA n 1 138 VAL n 1 139 ILE n 1 140 LYS n 1 141 GLY n 1 142 LEU n 1 143 THR n 1 144 TYR n 1 145 LEU n 1 146 ARG n 1 147 GLU n 1 148 LYS n 1 149 HIS n 1 150 LYS n 1 151 ILE n 1 152 MET n 1 153 HIS n 1 154 ARG n 1 155 ASP n 1 156 VAL n 1 157 LYS n 1 158 PRO n 1 159 SER n 1 160 ASN n 1 161 ILE n 1 162 LEU n 1 163 VAL n 1 164 ASN n 1 165 SER n 1 166 ARG n 1 167 GLY n 1 168 GLU n 1 169 ILE n 1 170 LYS n 1 171 LEU n 1 172 CYS n 1 173 ASP n 1 174 PHE n 1 175 GLY n 1 176 VAL n 1 177 SER n 1 178 GLY n 1 179 GLN n 1 180 LEU n 1 181 ILE n 1 182 ASP n 1 183 SER n 1 184 MET n 1 185 ALA n 1 186 ASN n 1 187 SER n 1 188 PHE n 1 189 VAL n 1 190 GLY n 1 191 THR n 1 192 ARG n 1 193 SER n 1 194 TYR n 1 195 MET n 1 196 SER n 1 197 PRO n 1 198 GLU n 1 199 ARG n 1 200 LEU n 1 201 GLN n 1 202 GLY n 1 203 THR n 1 204 HIS n 1 205 TYR n 1 206 SER n 1 207 VAL n 1 208 GLN n 1 209 SER n 1 210 ASP n 1 211 ILE n 1 212 TRP n 1 213 SER n 1 214 MET n 1 215 GLY n 1 216 LEU n 1 217 SER n 1 218 LEU n 1 219 VAL n 1 220 GLU n 1 221 MET n 1 222 ALA n 1 223 VAL n 1 224 GLY n 1 225 ARG n 1 226 TYR n 1 227 PRO n 1 228 ILE n 1 229 PRO n 1 230 PRO n 1 231 PRO n 1 232 ASP n 1 233 ALA n 1 234 LYS n 1 235 GLU n 1 236 LEU n 1 237 GLU n 1 238 LEU n 1 239 MET n 1 240 PHE n 1 241 GLY n 1 242 CYS n 1 243 GLN n 1 244 VAL n 1 245 GLU n 1 246 GLY n 1 247 ASP n 1 248 ALA n 1 249 ALA n 1 250 GLU n 1 251 THR n 1 252 PRO n 1 253 PRO n 1 254 ARG n 1 255 PRO n 1 256 ARG n 1 257 THR n 1 258 PRO n 1 259 GLY n 1 260 ARG n 1 261 PRO n 1 262 LEU n 1 263 ASN n 1 264 LYS n 1 265 LYS n 1 266 GLY n 1 267 MET n 1 268 ASP n 1 269 SER n 1 270 ARG n 1 271 PRO n 1 272 PRO n 1 273 MET n 1 274 ALA n 1 275 ILE n 1 276 PHE n 1 277 GLU n 1 278 LEU n 1 279 LEU n 1 280 ASP n 1 281 TYR n 1 282 ILE n 1 283 VAL n 1 284 ASN n 1 285 GLU n 1 286 PRO n 1 287 PRO n 1 288 PRO n 1 289 LYS n 1 290 LEU n 1 291 PRO n 1 292 SER n 1 293 GLY n 1 294 VAL n 1 295 PHE n 1 296 SER n 1 297 LEU n 1 298 GLU n 1 299 PHE n 1 300 GLN n 1 301 ASP n 1 302 PHE n 1 303 VAL n 1 304 ASN n 1 305 LYS n 1 306 CYS n 1 307 LEU n 1 308 ILE n 1 309 LYS n 1 310 ASN n 1 311 PRO n 1 312 ALA n 1 313 GLU n 1 314 ARG n 1 315 ALA n 1 316 ASP n 1 317 LEU n 1 318 LYS n 1 319 GLN n 1 320 LEU n 1 321 MET n 1 322 VAL n 1 323 HIS n 1 324 ALA n 1 325 PHE n 1 326 ILE n 1 327 LYS n 1 328 ARG n 1 329 SER n 1 330 ASP n 1 331 ALA n 1 332 GLU n 1 333 GLU n 1 334 VAL n 1 335 ASP n 1 336 PHE n 1 337 ALA n 1 338 GLY n 1 339 TRP n 1 340 LEU n 1 341 CYS n 1 342 SER n 1 343 THR n 1 344 ILE n 1 345 GLY n 1 346 LEU n 1 347 ASN n 1 348 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 348 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'MAP2K1, MEK1, PRKMK1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MP2K1_HUMAN _struct_ref.pdbx_db_accession Q02750 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;LEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQ VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNI LVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFG CQVEGDAAETPPRPRTPGRPLSSYGMDSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLM VHAFIKRSDAEEVDFAGWLCSTIGLNQ ; _struct_ref.pdbx_align_begin 37 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7XLP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 348 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q02750 _struct_ref_seq.db_align_beg 37 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 383 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 37 _struct_ref_seq.pdbx_auth_seq_align_end 383 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7XLP GLY A 1 ? UNP Q02750 ? ? 'expression tag' 36 1 1 7XLP ASN A 263 ? UNP Q02750 SER 298 'engineered mutation' 298 2 1 7XLP LYS A 264 ? UNP Q02750 SER 299 'engineered mutation' 299 3 1 7XLP LYS A 265 ? UNP Q02750 TYR 300 'engineered mutation' 300 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 DMS non-polymer . 'DIMETHYL SULFOXIDE' ? 'C2 H6 O S' 78.133 FZC non-polymer . '(1~{R},3~{S})-3-[[6-[2-chloranyl-4-(4-methylpyrimidin-2-yl)oxy-phenyl]-3-methyl-1~{H}-indazol-4-yl]oxy]cyclohexan-1-amine' ? 'C25 H26 Cl N5 O2' 463.959 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7XLP _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.43 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.39 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.75 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '100 mM Tris (pH 7.75), 200 mM calcium chloride, 2% DMSO, 18-20% PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2019-10-04 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL45XU' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL45XU _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate 43.090 _reflns.entry_id 7XLP _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.100 _reflns.d_resolution_low 49.500 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 23655 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.900 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 18.500 _reflns.pdbx_Rmerge_I_obs 0.327 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 9.200 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects 1873 _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.337 _reflns.pdbx_Rpim_I_all 0.079 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 436693 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.995 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.100 2.160 ? ? 37126 ? ? ? 1891 99.900 ? ? ? ? 7.849 ? ? ? ? ? ? ? ? 19.600 ? ? ? 1.700 8.063 1.810 ? 1 1 0.757 ? ? ? ? ? ? ? ? ? ? 8.910 49.500 ? ? 5502 ? ? ? 410 99.500 ? ? ? ? 0.077 ? ? ? ? ? ? ? ? 13.400 ? ? ? 24.900 0.080 0.021 ? 2 1 0.997 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 147.600 _refine.B_iso_mean 63.2445 _refine.B_iso_min 33.750 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7XLP _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1000 _refine.ls_d_res_low 49.5000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 23340 _refine.ls_number_reflns_R_free 1170 _refine.ls_number_reflns_R_work 22170 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.9000 _refine.ls_percent_reflns_R_free 5.0100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2200 _refine.ls_R_factor_R_free 0.2462 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2186 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.330 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 5BX0 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 33.0400 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.1000 _refine_hist.d_res_low 49.5000 _refine_hist.number_atoms_solvent 73 _refine_hist.number_atoms_total 2458 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 312 _refine_hist.pdbx_B_iso_mean_ligand 55.58 _refine_hist.pdbx_B_iso_mean_solvent 56.56 _refine_hist.pdbx_number_atoms_protein 2345 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 40 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.1000 2.2000 2831 . 138 2693 98.0000 . . . 0.3988 0.0000 0.3547 . . . . . . . 8 . . . 'X-RAY DIFFRACTION' 2.2000 2.3100 2784 . 143 2641 97.0000 . . . 0.3375 0.0000 0.3044 . . . . . . . 8 . . . 'X-RAY DIFFRACTION' 2.3100 2.4600 2829 . 132 2697 98.0000 . . . 0.3212 0.0000 0.2752 . . . . . . . 8 . . . 'X-RAY DIFFRACTION' 2.4600 2.6500 2888 . 138 2750 99.0000 . . . 0.2994 0.0000 0.2659 . . . . . . . 8 . . . 'X-RAY DIFFRACTION' 2.6500 2.9100 2891 . 149 2742 99.0000 . . . 0.2960 0.0000 0.2454 . . . . . . . 8 . . . 'X-RAY DIFFRACTION' 2.9100 3.3300 2937 . 163 2774 100.0000 . . . 0.2705 0.0000 0.2429 . . . . . . . 8 . . . 'X-RAY DIFFRACTION' 3.3300 4.2000 2965 . 148 2817 100.0000 . . . 0.2283 0.0000 0.1907 . . . . . . . 8 . . . 'X-RAY DIFFRACTION' 4.2000 49.5000 3215 . 159 3056 100.0000 . . . 0.1969 0.0000 0.1855 . . . . . . . 8 . . . # _struct.entry_id 7XLP _struct.title 'MEK1 bound to DS03090629' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7XLP _struct_keywords.text 'Kinase, Inhibitor, Complex, ATP competitive, TRANSFERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex' _struct_keywords.pdbx_keywords 'TRANSFERASE/TRANSFERASE INHIBITOR' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 4 ? G N N 5 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 2 ? GLU A 6 ? LEU A 37 GLU A 41 5 ? 5 HELX_P HELX_P2 AA2 ASP A 8 ? LYS A 24 ? ASP A 43 LYS A 59 1 ? 17 HELX_P HELX_P3 AA3 LYS A 29 ? ASP A 31 ? LYS A 64 ASP A 66 5 ? 3 HELX_P HELX_P4 AA4 LYS A 69 ? LEU A 80 ? LYS A 104 LEU A 115 1 ? 12 HELX_P HELX_P5 AA5 GLN A 81 ? CYS A 86 ? GLN A 116 CYS A 121 5 ? 6 HELX_P HELX_P6 AA6 SER A 115 ? GLY A 124 ? SER A 150 GLY A 159 1 ? 10 HELX_P HELX_P7 AA7 PRO A 127 ? LYS A 150 ? PRO A 162 LYS A 185 1 ? 24 HELX_P HELX_P8 AA8 LYS A 157 ? SER A 159 ? LYS A 192 SER A 194 5 ? 3 HELX_P HELX_P9 AA9 SER A 177 ? ALA A 185 ? SER A 212 ALA A 220 1 ? 9 HELX_P HELX_P10 AB1 SER A 196 ? GLN A 201 ? SER A 231 GLN A 236 1 ? 6 HELX_P HELX_P11 AB2 SER A 206 ? GLY A 224 ? SER A 241 GLY A 259 1 ? 19 HELX_P HELX_P12 AB3 ASP A 232 ? PHE A 240 ? ASP A 267 PHE A 275 1 ? 9 HELX_P HELX_P13 AB4 ALA A 274 ? GLU A 285 ? ALA A 309 GLU A 320 1 ? 12 HELX_P HELX_P14 AB5 SER A 296 ? LEU A 307 ? SER A 331 LEU A 342 1 ? 12 HELX_P HELX_P15 AB6 ASP A 316 ? VAL A 322 ? ASP A 351 VAL A 357 1 ? 7 HELX_P HELX_P16 AB7 HIS A 323 ? GLU A 332 ? HIS A 358 GLU A 367 1 ? 10 HELX_P HELX_P17 AB8 ASP A 335 ? GLY A 345 ? ASP A 370 GLY A 380 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 30 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 65 A CA 403 1_555 ? ? ? ? ? ? ? 2.462 ? ? metalc2 metalc ? ? A ASP 30 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 65 A CA 403 11_555 ? ? ? ? ? ? ? 2.654 ? ? metalc3 metalc ? ? A ASP 30 OD1 ? ? ? 1_555 E CA . CA ? ? A ASP 65 A CA 404 1_555 ? ? ? ? ? ? ? 2.464 ? ? metalc4 metalc ? ? A ASP 30 OD2 ? ? ? 1_555 E CA . CA ? ? A ASP 65 A CA 404 1_555 ? ? ? ? ? ? ? 2.333 ? ? metalc5 metalc ? ? A ASP 31 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 66 A CA 403 1_555 ? ? ? ? ? ? ? 2.697 ? ? metalc6 metalc ? ? A ASP 31 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 66 A CA 403 11_555 ? ? ? ? ? ? ? 2.302 ? ? metalc7 metalc ? ? A ASP 31 OD2 ? ? ? 1_555 E CA . CA ? ? A ASP 66 A CA 404 11_555 ? ? ? ? ? ? ? 2.263 ? ? metalc8 metalc ? ? E CA . CA ? ? ? 1_555 G HOH . O ? ? A CA 404 A HOH 563 1_555 ? ? ? ? ? ? ? 2.563 ? ? metalc9 metalc ? ? F CA . CA ? ? ? 1_555 G HOH . O ? ? A CA 405 A HOH 512 1_555 ? ? ? ? ? ? ? 3.190 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ILE _struct_mon_prot_cis.label_seq_id 228 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ILE _struct_mon_prot_cis.auth_seq_id 263 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 229 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 264 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 3.52 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 33 ? GLY A 42 ? PHE A 68 GLY A 77 AA1 2 GLY A 45 ? HIS A 52 ? GLY A 80 HIS A 87 AA1 3 VAL A 58 ? HIS A 65 ? VAL A 93 HIS A 100 AA1 4 GLU A 103 ? MET A 108 ? GLU A 138 MET A 143 AA1 5 PHE A 94 ? SER A 100 ? PHE A 129 SER A 135 AA2 1 ILE A 161 ? VAL A 163 ? ILE A 196 VAL A 198 AA2 2 ILE A 169 ? LEU A 171 ? ILE A 204 LEU A 206 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N GLY A 40 ? N GLY A 75 O VAL A 47 ? O VAL A 82 AA1 2 3 N PHE A 48 ? N PHE A 83 O ARG A 61 ? O ARG A 96 AA1 3 4 N ILE A 64 ? N ILE A 99 O ILE A 104 ? O ILE A 139 AA1 4 5 O SER A 105 ? O SER A 140 N PHE A 98 ? N PHE A 133 AA2 1 2 N LEU A 162 ? N LEU A 197 O LYS A 170 ? O LYS A 205 # _atom_sites.entry_id 7XLP _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.013028 _atom_sites.fract_transf_matrix[1][2] 0.007521 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015043 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004496 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CA CL N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 36 ? ? ? A . n A 1 2 LEU 2 37 37 LEU LEU A . n A 1 3 GLU 3 38 38 GLU GLU A . n A 1 4 GLU 4 39 39 GLU GLU A . n A 1 5 LEU 5 40 40 LEU LEU A . n A 1 6 GLU 6 41 41 GLU GLU A . n A 1 7 LEU 7 42 42 LEU LEU A . n A 1 8 ASP 8 43 43 ASP ASP A . n A 1 9 GLU 9 44 44 GLU GLU A . n A 1 10 GLN 10 45 45 GLN GLN A . n A 1 11 GLN 11 46 46 GLN GLN A . n A 1 12 ARG 12 47 47 ARG ARG A . n A 1 13 LYS 13 48 48 LYS LYS A . n A 1 14 ARG 14 49 49 ARG ARG A . n A 1 15 LEU 15 50 50 LEU LEU A . n A 1 16 GLU 16 51 51 GLU GLU A . n A 1 17 ALA 17 52 52 ALA ALA A . n A 1 18 PHE 18 53 53 PHE PHE A . n A 1 19 LEU 19 54 54 LEU LEU A . n A 1 20 THR 20 55 55 THR THR A . n A 1 21 GLN 21 56 56 GLN GLN A . n A 1 22 LYS 22 57 57 LYS LYS A . n A 1 23 GLN 23 58 58 GLN GLN A . n A 1 24 LYS 24 59 59 LYS LYS A . n A 1 25 VAL 25 60 60 VAL VAL A . n A 1 26 GLY 26 61 61 GLY GLY A . n A 1 27 GLU 27 62 62 GLU GLU A . n A 1 28 LEU 28 63 63 LEU LEU A . n A 1 29 LYS 29 64 64 LYS LYS A . n A 1 30 ASP 30 65 65 ASP ASP A . n A 1 31 ASP 31 66 66 ASP ASP A . n A 1 32 ASP 32 67 67 ASP ASP A . n A 1 33 PHE 33 68 68 PHE PHE A . n A 1 34 GLU 34 69 69 GLU GLU A . n A 1 35 LYS 35 70 70 LYS LYS A . n A 1 36 ILE 36 71 71 ILE ILE A . n A 1 37 SER 37 72 72 SER SER A . n A 1 38 GLU 38 73 73 GLU GLU A . n A 1 39 LEU 39 74 74 LEU LEU A . n A 1 40 GLY 40 75 75 GLY GLY A . n A 1 41 ALA 41 76 76 ALA ALA A . n A 1 42 GLY 42 77 77 GLY GLY A . n A 1 43 ASN 43 78 78 ASN ASN A . n A 1 44 GLY 44 79 79 GLY GLY A . n A 1 45 GLY 45 80 80 GLY GLY A . n A 1 46 VAL 46 81 81 VAL VAL A . n A 1 47 VAL 47 82 82 VAL VAL A . n A 1 48 PHE 48 83 83 PHE PHE A . n A 1 49 LYS 49 84 84 LYS LYS A . n A 1 50 VAL 50 85 85 VAL VAL A . n A 1 51 SER 51 86 86 SER SER A . n A 1 52 HIS 52 87 87 HIS HIS A . n A 1 53 LYS 53 88 88 LYS LYS A . n A 1 54 PRO 54 89 89 PRO PRO A . n A 1 55 SER 55 90 90 SER SER A . n A 1 56 GLY 56 91 91 GLY GLY A . n A 1 57 LEU 57 92 92 LEU LEU A . n A 1 58 VAL 58 93 93 VAL VAL A . n A 1 59 MET 59 94 94 MET MET A . n A 1 60 ALA 60 95 95 ALA ALA A . n A 1 61 ARG 61 96 96 ARG ARG A . n A 1 62 LYS 62 97 97 LYS LYS A . n A 1 63 LEU 63 98 98 LEU LEU A . n A 1 64 ILE 64 99 99 ILE ILE A . n A 1 65 HIS 65 100 100 HIS HIS A . n A 1 66 LEU 66 101 101 LEU LEU A . n A 1 67 GLU 67 102 102 GLU GLU A . n A 1 68 ILE 68 103 103 ILE ILE A . n A 1 69 LYS 69 104 104 LYS LYS A . n A 1 70 PRO 70 105 105 PRO PRO A . n A 1 71 ALA 71 106 106 ALA ALA A . n A 1 72 ILE 72 107 107 ILE ILE A . n A 1 73 ARG 73 108 108 ARG ARG A . n A 1 74 ASN 74 109 109 ASN ASN A . n A 1 75 GLN 75 110 110 GLN GLN A . n A 1 76 ILE 76 111 111 ILE ILE A . n A 1 77 ILE 77 112 112 ILE ILE A . n A 1 78 ARG 78 113 113 ARG ARG A . n A 1 79 GLU 79 114 114 GLU GLU A . n A 1 80 LEU 80 115 115 LEU LEU A . n A 1 81 GLN 81 116 116 GLN GLN A . n A 1 82 VAL 82 117 117 VAL VAL A . n A 1 83 LEU 83 118 118 LEU LEU A . n A 1 84 HIS 84 119 119 HIS HIS A . n A 1 85 GLU 85 120 120 GLU GLU A . n A 1 86 CYS 86 121 121 CYS CYS A . n A 1 87 ASN 87 122 122 ASN ASN A . n A 1 88 SER 88 123 123 SER SER A . n A 1 89 PRO 89 124 124 PRO PRO A . n A 1 90 TYR 90 125 125 TYR TYR A . n A 1 91 ILE 91 126 126 ILE ILE A . n A 1 92 VAL 92 127 127 VAL VAL A . n A 1 93 GLY 93 128 128 GLY GLY A . n A 1 94 PHE 94 129 129 PHE PHE A . n A 1 95 TYR 95 130 130 TYR TYR A . n A 1 96 GLY 96 131 131 GLY GLY A . n A 1 97 ALA 97 132 132 ALA ALA A . n A 1 98 PHE 98 133 133 PHE PHE A . n A 1 99 TYR 99 134 134 TYR TYR A . n A 1 100 SER 100 135 135 SER SER A . n A 1 101 ASP 101 136 136 ASP ASP A . n A 1 102 GLY 102 137 137 GLY GLY A . n A 1 103 GLU 103 138 138 GLU GLU A . n A 1 104 ILE 104 139 139 ILE ILE A . n A 1 105 SER 105 140 140 SER SER A . n A 1 106 ILE 106 141 141 ILE ILE A . n A 1 107 CYS 107 142 142 CYS CYS A . n A 1 108 MET 108 143 143 MET MET A . n A 1 109 GLU 109 144 144 GLU GLU A . n A 1 110 HIS 110 145 145 HIS HIS A . n A 1 111 MET 111 146 146 MET MET A . n A 1 112 ASP 112 147 147 ASP ASP A . n A 1 113 GLY 113 148 148 GLY GLY A . n A 1 114 GLY 114 149 149 GLY GLY A . n A 1 115 SER 115 150 150 SER SER A . n A 1 116 LEU 116 151 151 LEU LEU A . n A 1 117 ASP 117 152 152 ASP ASP A . n A 1 118 GLN 118 153 153 GLN GLN A . n A 1 119 VAL 119 154 154 VAL VAL A . n A 1 120 LEU 120 155 155 LEU LEU A . n A 1 121 LYS 121 156 156 LYS LYS A . n A 1 122 LYS 122 157 157 LYS LYS A . n A 1 123 ALA 123 158 158 ALA ALA A . n A 1 124 GLY 124 159 159 GLY GLY A . n A 1 125 ARG 125 160 160 ARG ARG A . n A 1 126 ILE 126 161 161 ILE ILE A . n A 1 127 PRO 127 162 162 PRO PRO A . n A 1 128 GLU 128 163 163 GLU GLU A . n A 1 129 GLN 129 164 164 GLN GLN A . n A 1 130 ILE 130 165 165 ILE ILE A . n A 1 131 LEU 131 166 166 LEU LEU A . n A 1 132 GLY 132 167 167 GLY GLY A . n A 1 133 LYS 133 168 168 LYS LYS A . n A 1 134 VAL 134 169 169 VAL VAL A . n A 1 135 SER 135 170 170 SER SER A . n A 1 136 ILE 136 171 171 ILE ILE A . n A 1 137 ALA 137 172 172 ALA ALA A . n A 1 138 VAL 138 173 173 VAL VAL A . n A 1 139 ILE 139 174 174 ILE ILE A . n A 1 140 LYS 140 175 175 LYS LYS A . n A 1 141 GLY 141 176 176 GLY GLY A . n A 1 142 LEU 142 177 177 LEU LEU A . n A 1 143 THR 143 178 178 THR THR A . n A 1 144 TYR 144 179 179 TYR TYR A . n A 1 145 LEU 145 180 180 LEU LEU A . n A 1 146 ARG 146 181 181 ARG ARG A . n A 1 147 GLU 147 182 182 GLU GLU A . n A 1 148 LYS 148 183 183 LYS LYS A . n A 1 149 HIS 149 184 184 HIS HIS A . n A 1 150 LYS 150 185 185 LYS LYS A . n A 1 151 ILE 151 186 186 ILE ILE A . n A 1 152 MET 152 187 187 MET MET A . n A 1 153 HIS 153 188 188 HIS HIS A . n A 1 154 ARG 154 189 189 ARG ARG A . n A 1 155 ASP 155 190 190 ASP ASP A . n A 1 156 VAL 156 191 191 VAL VAL A . n A 1 157 LYS 157 192 192 LYS LYS A . n A 1 158 PRO 158 193 193 PRO PRO A . n A 1 159 SER 159 194 194 SER SER A . n A 1 160 ASN 160 195 195 ASN ASN A . n A 1 161 ILE 161 196 196 ILE ILE A . n A 1 162 LEU 162 197 197 LEU LEU A . n A 1 163 VAL 163 198 198 VAL VAL A . n A 1 164 ASN 164 199 199 ASN ASN A . n A 1 165 SER 165 200 200 SER SER A . n A 1 166 ARG 166 201 201 ARG ARG A . n A 1 167 GLY 167 202 202 GLY GLY A . n A 1 168 GLU 168 203 203 GLU GLU A . n A 1 169 ILE 169 204 204 ILE ILE A . n A 1 170 LYS 170 205 205 LYS LYS A . n A 1 171 LEU 171 206 206 LEU LEU A . n A 1 172 CYS 172 207 207 CYS CYS A . n A 1 173 ASP 173 208 208 ASP ASP A . n A 1 174 PHE 174 209 209 PHE PHE A . n A 1 175 GLY 175 210 210 GLY GLY A . n A 1 176 VAL 176 211 211 VAL VAL A . n A 1 177 SER 177 212 212 SER SER A . n A 1 178 GLY 178 213 213 GLY GLY A . n A 1 179 GLN 179 214 214 GLN GLN A . n A 1 180 LEU 180 215 215 LEU LEU A . n A 1 181 ILE 181 216 216 ILE ILE A . n A 1 182 ASP 182 217 217 ASP ASP A . n A 1 183 SER 183 218 218 SER SER A . n A 1 184 MET 184 219 219 MET MET A . n A 1 185 ALA 185 220 220 ALA ALA A . n A 1 186 ASN 186 221 ? ? ? A . n A 1 187 SER 187 222 ? ? ? A . n A 1 188 PHE 188 223 ? ? ? A . n A 1 189 VAL 189 224 ? ? ? A . n A 1 190 GLY 190 225 225 GLY GLY A . n A 1 191 THR 191 226 226 THR THR A . n A 1 192 ARG 192 227 227 ARG ARG A . n A 1 193 SER 193 228 228 SER SER A . n A 1 194 TYR 194 229 229 TYR TYR A . n A 1 195 MET 195 230 230 MET MET A . n A 1 196 SER 196 231 231 SER SER A . n A 1 197 PRO 197 232 232 PRO PRO A . n A 1 198 GLU 198 233 233 GLU GLU A . n A 1 199 ARG 199 234 234 ARG ARG A . n A 1 200 LEU 200 235 235 LEU LEU A . n A 1 201 GLN 201 236 236 GLN GLN A . n A 1 202 GLY 202 237 237 GLY GLY A . n A 1 203 THR 203 238 238 THR THR A . n A 1 204 HIS 204 239 239 HIS HIS A . n A 1 205 TYR 205 240 240 TYR TYR A . n A 1 206 SER 206 241 241 SER SER A . n A 1 207 VAL 207 242 242 VAL VAL A . n A 1 208 GLN 208 243 243 GLN GLN A . n A 1 209 SER 209 244 244 SER SER A . n A 1 210 ASP 210 245 245 ASP ASP A . n A 1 211 ILE 211 246 246 ILE ILE A . n A 1 212 TRP 212 247 247 TRP TRP A . n A 1 213 SER 213 248 248 SER SER A . n A 1 214 MET 214 249 249 MET MET A . n A 1 215 GLY 215 250 250 GLY GLY A . n A 1 216 LEU 216 251 251 LEU LEU A . n A 1 217 SER 217 252 252 SER SER A . n A 1 218 LEU 218 253 253 LEU LEU A . n A 1 219 VAL 219 254 254 VAL VAL A . n A 1 220 GLU 220 255 255 GLU GLU A . n A 1 221 MET 221 256 256 MET MET A . n A 1 222 ALA 222 257 257 ALA ALA A . n A 1 223 VAL 223 258 258 VAL VAL A . n A 1 224 GLY 224 259 259 GLY GLY A . n A 1 225 ARG 225 260 260 ARG ARG A . n A 1 226 TYR 226 261 261 TYR TYR A . n A 1 227 PRO 227 262 262 PRO PRO A . n A 1 228 ILE 228 263 263 ILE ILE A . n A 1 229 PRO 229 264 264 PRO PRO A . n A 1 230 PRO 230 265 265 PRO PRO A . n A 1 231 PRO 231 266 266 PRO PRO A . n A 1 232 ASP 232 267 267 ASP ASP A . n A 1 233 ALA 233 268 268 ALA ALA A . n A 1 234 LYS 234 269 269 LYS LYS A . n A 1 235 GLU 235 270 270 GLU GLU A . n A 1 236 LEU 236 271 271 LEU LEU A . n A 1 237 GLU 237 272 272 GLU GLU A . n A 1 238 LEU 238 273 273 LEU LEU A . n A 1 239 MET 239 274 274 MET MET A . n A 1 240 PHE 240 275 275 PHE PHE A . n A 1 241 GLY 241 276 276 GLY GLY A . n A 1 242 CYS 242 277 ? ? ? A . n A 1 243 GLN 243 278 ? ? ? A . n A 1 244 VAL 244 279 ? ? ? A . n A 1 245 GLU 245 280 ? ? ? A . n A 1 246 GLY 246 281 ? ? ? A . n A 1 247 ASP 247 282 ? ? ? A . n A 1 248 ALA 248 283 ? ? ? A . n A 1 249 ALA 249 284 ? ? ? A . n A 1 250 GLU 250 285 ? ? ? A . n A 1 251 THR 251 286 ? ? ? A . n A 1 252 PRO 252 287 ? ? ? A . n A 1 253 PRO 253 288 ? ? ? A . n A 1 254 ARG 254 289 ? ? ? A . n A 1 255 PRO 255 290 ? ? ? A . n A 1 256 ARG 256 291 ? ? ? A . n A 1 257 THR 257 292 ? ? ? A . n A 1 258 PRO 258 293 ? ? ? A . n A 1 259 GLY 259 294 ? ? ? A . n A 1 260 ARG 260 295 ? ? ? A . n A 1 261 PRO 261 296 ? ? ? A . n A 1 262 LEU 262 297 ? ? ? A . n A 1 263 ASN 263 298 ? ? ? A . n A 1 264 LYS 264 299 ? ? ? A . n A 1 265 LYS 265 300 ? ? ? A . n A 1 266 GLY 266 301 ? ? ? A . n A 1 267 MET 267 302 ? ? ? A . n A 1 268 ASP 268 303 ? ? ? A . n A 1 269 SER 269 304 ? ? ? A . n A 1 270 ARG 270 305 ? ? ? A . n A 1 271 PRO 271 306 ? ? ? A . n A 1 272 PRO 272 307 307 PRO PRO A . n A 1 273 MET 273 308 308 MET MET A . n A 1 274 ALA 274 309 309 ALA ALA A . n A 1 275 ILE 275 310 310 ILE ILE A . n A 1 276 PHE 276 311 311 PHE PHE A . n A 1 277 GLU 277 312 312 GLU GLU A . n A 1 278 LEU 278 313 313 LEU LEU A . n A 1 279 LEU 279 314 314 LEU LEU A . n A 1 280 ASP 280 315 315 ASP ASP A . n A 1 281 TYR 281 316 316 TYR TYR A . n A 1 282 ILE 282 317 317 ILE ILE A . n A 1 283 VAL 283 318 318 VAL VAL A . n A 1 284 ASN 284 319 319 ASN ASN A . n A 1 285 GLU 285 320 320 GLU GLU A . n A 1 286 PRO 286 321 321 PRO PRO A . n A 1 287 PRO 287 322 322 PRO PRO A . n A 1 288 PRO 288 323 323 PRO PRO A . n A 1 289 LYS 289 324 324 LYS LYS A . n A 1 290 LEU 290 325 325 LEU LEU A . n A 1 291 PRO 291 326 326 PRO PRO A . n A 1 292 SER 292 327 327 SER SER A . n A 1 293 GLY 293 328 328 GLY GLY A . n A 1 294 VAL 294 329 329 VAL VAL A . n A 1 295 PHE 295 330 330 PHE PHE A . n A 1 296 SER 296 331 331 SER SER A . n A 1 297 LEU 297 332 332 LEU LEU A . n A 1 298 GLU 298 333 333 GLU GLU A . n A 1 299 PHE 299 334 334 PHE PHE A . n A 1 300 GLN 300 335 335 GLN GLN A . n A 1 301 ASP 301 336 336 ASP ASP A . n A 1 302 PHE 302 337 337 PHE PHE A . n A 1 303 VAL 303 338 338 VAL VAL A . n A 1 304 ASN 304 339 339 ASN ASN A . n A 1 305 LYS 305 340 340 LYS LYS A . n A 1 306 CYS 306 341 341 CYS CYS A . n A 1 307 LEU 307 342 342 LEU LEU A . n A 1 308 ILE 308 343 343 ILE ILE A . n A 1 309 LYS 309 344 344 LYS LYS A . n A 1 310 ASN 310 345 345 ASN ASN A . n A 1 311 PRO 311 346 346 PRO PRO A . n A 1 312 ALA 312 347 347 ALA ALA A . n A 1 313 GLU 313 348 348 GLU GLU A . n A 1 314 ARG 314 349 349 ARG ARG A . n A 1 315 ALA 315 350 350 ALA ALA A . n A 1 316 ASP 316 351 351 ASP ASP A . n A 1 317 LEU 317 352 352 LEU LEU A . n A 1 318 LYS 318 353 353 LYS LYS A . n A 1 319 GLN 319 354 354 GLN GLN A . n A 1 320 LEU 320 355 355 LEU LEU A . n A 1 321 MET 321 356 356 MET MET A . n A 1 322 VAL 322 357 357 VAL VAL A . n A 1 323 HIS 323 358 358 HIS HIS A . n A 1 324 ALA 324 359 359 ALA ALA A . n A 1 325 PHE 325 360 360 PHE PHE A . n A 1 326 ILE 326 361 361 ILE ILE A . n A 1 327 LYS 327 362 362 LYS LYS A . n A 1 328 ARG 328 363 363 ARG ARG A . n A 1 329 SER 329 364 364 SER SER A . n A 1 330 ASP 330 365 365 ASP ASP A . n A 1 331 ALA 331 366 366 ALA ALA A . n A 1 332 GLU 332 367 367 GLU GLU A . n A 1 333 GLU 333 368 368 GLU GLU A . n A 1 334 VAL 334 369 369 VAL VAL A . n A 1 335 ASP 335 370 370 ASP ASP A . n A 1 336 PHE 336 371 371 PHE PHE A . n A 1 337 ALA 337 372 372 ALA ALA A . n A 1 338 GLY 338 373 373 GLY GLY A . n A 1 339 TRP 339 374 374 TRP TRP A . n A 1 340 LEU 340 375 375 LEU LEU A . n A 1 341 CYS 341 376 376 CYS CYS A . n A 1 342 SER 342 377 377 SER SER A . n A 1 343 THR 343 378 378 THR THR A . n A 1 344 ILE 344 379 379 ILE ILE A . n A 1 345 GLY 345 380 380 GLY GLY A . n A 1 346 LEU 346 381 381 LEU LEU A . n A 1 347 ASN 347 382 382 ASN ASN A . n A 1 348 GLN 348 383 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email hanzawa.hiroyuki.ac@rdn.daiichisankyo.co.jp _pdbx_contact_author.name_first Hiroyuki _pdbx_contact_author.name_last Hanzawa _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-0471-7936 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FZC 1 401 401 FZC LIG A . C 3 DMS 1 402 402 DMS DMS A . D 4 CA 1 403 501 CA CA A . E 4 CA 1 404 502 CA CA A . F 4 CA 1 405 503 CA CA A . G 5 HOH 1 501 651 HOH HOH A . G 5 HOH 2 502 635 HOH HOH A . G 5 HOH 3 503 659 HOH HOH A . G 5 HOH 4 504 663 HOH HOH A . G 5 HOH 5 505 625 HOH HOH A . G 5 HOH 6 506 656 HOH HOH A . G 5 HOH 7 507 636 HOH HOH A . G 5 HOH 8 508 639 HOH HOH A . G 5 HOH 9 509 638 HOH HOH A . G 5 HOH 10 510 642 HOH HOH A . G 5 HOH 11 511 608 HOH HOH A . G 5 HOH 12 512 637 HOH HOH A . G 5 HOH 13 513 666 HOH HOH A . G 5 HOH 14 514 605 HOH HOH A . G 5 HOH 15 515 616 HOH HOH A . G 5 HOH 16 516 634 HOH HOH A . G 5 HOH 17 517 604 HOH HOH A . G 5 HOH 18 518 652 HOH HOH A . G 5 HOH 19 519 622 HOH HOH A . G 5 HOH 20 520 601 HOH HOH A . G 5 HOH 21 521 629 HOH HOH A . G 5 HOH 22 522 657 HOH HOH A . G 5 HOH 23 523 624 HOH HOH A . G 5 HOH 24 524 650 HOH HOH A . G 5 HOH 25 525 615 HOH HOH A . G 5 HOH 26 526 611 HOH HOH A . G 5 HOH 27 527 612 HOH HOH A . G 5 HOH 28 528 614 HOH HOH A . G 5 HOH 29 529 617 HOH HOH A . G 5 HOH 30 530 610 HOH HOH A . G 5 HOH 31 531 623 HOH HOH A . G 5 HOH 32 532 602 HOH HOH A . G 5 HOH 33 533 628 HOH HOH A . G 5 HOH 34 534 618 HOH HOH A . G 5 HOH 35 535 621 HOH HOH A . G 5 HOH 36 536 664 HOH HOH A . G 5 HOH 37 537 661 HOH HOH A . G 5 HOH 38 538 641 HOH HOH A . G 5 HOH 39 539 646 HOH HOH A . G 5 HOH 40 540 649 HOH HOH A . G 5 HOH 41 541 620 HOH HOH A . G 5 HOH 42 542 643 HOH HOH A . G 5 HOH 43 543 655 HOH HOH A . G 5 HOH 44 544 675 HOH HOH A . G 5 HOH 45 545 632 HOH HOH A . G 5 HOH 46 546 645 HOH HOH A . G 5 HOH 47 547 660 HOH HOH A . G 5 HOH 48 548 673 HOH HOH A . G 5 HOH 49 549 647 HOH HOH A . G 5 HOH 50 550 648 HOH HOH A . G 5 HOH 51 551 665 HOH HOH A . G 5 HOH 52 552 613 HOH HOH A . G 5 HOH 53 553 671 HOH HOH A . G 5 HOH 54 554 626 HOH HOH A . G 5 HOH 55 555 640 HOH HOH A . G 5 HOH 56 556 631 HOH HOH A . G 5 HOH 57 557 654 HOH HOH A . G 5 HOH 58 558 603 HOH HOH A . G 5 HOH 59 559 658 HOH HOH A . G 5 HOH 60 560 619 HOH HOH A . G 5 HOH 61 561 674 HOH HOH A . G 5 HOH 62 562 606 HOH HOH A . G 5 HOH 63 563 644 HOH HOH A . G 5 HOH 64 564 662 HOH HOH A . G 5 HOH 65 565 653 HOH HOH A . G 5 HOH 66 566 633 HOH HOH A . G 5 HOH 67 567 607 HOH HOH A . G 5 HOH 68 568 609 HOH HOH A . G 5 HOH 69 569 668 HOH HOH A . G 5 HOH 70 570 670 HOH HOH A . G 5 HOH 71 571 667 HOH HOH A . G 5 HOH 72 572 672 HOH HOH A . G 5 HOH 73 573 669 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 450 ? 1 MORE -26 ? 1 'SSA (A^2)' 14290 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 560 ? G HOH . 2 1 A HOH 573 ? G HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 30 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 OD2 ? A ASP 30 ? A ASP 65 ? 1_555 0.0 ? 2 OD2 ? A ASP 30 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 OD1 ? A ASP 31 ? A ASP 66 ? 1_555 85.1 ? 3 OD2 ? A ASP 30 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 OD1 ? A ASP 31 ? A ASP 66 ? 1_555 85.1 ? 4 OD2 ? A ASP 30 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 OD1 ? A ASP 31 ? A ASP 66 ? 1_555 85.1 ? 5 OD2 ? A ASP 30 ? A ASP 65 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 OD1 ? A ASP 31 ? A ASP 66 ? 1_555 85.1 ? 6 OD1 ? A ASP 31 ? A ASP 66 ? 1_555 CA ? D CA . ? A CA 403 ? 1_555 OD1 ? A ASP 31 ? A ASP 66 ? 1_555 0.0 ? 7 OD1 ? A ASP 30 ? A ASP 65 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 OD2 ? A ASP 30 ? A ASP 65 ? 1_555 54.3 ? 8 OD1 ? A ASP 30 ? A ASP 65 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 OD2 ? A ASP 31 ? A ASP 66 ? 1_555 80.4 ? 9 OD2 ? A ASP 30 ? A ASP 65 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 OD2 ? A ASP 31 ? A ASP 66 ? 1_555 36.5 ? 10 OD1 ? A ASP 30 ? A ASP 65 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O ? G HOH . ? A HOH 563 ? 1_555 77.6 ? 11 OD2 ? A ASP 30 ? A ASP 65 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O ? G HOH . ? A HOH 563 ? 1_555 124.4 ? 12 OD2 ? A ASP 31 ? A ASP 66 ? 1_555 CA ? E CA . ? A CA 404 ? 1_555 O ? G HOH . ? A HOH 563 ? 1_555 158.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-03-01 2 'Structure model' 1 1 2023-03-15 3 'Structure model' 1 2 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.page_first' 3 2 'Structure model' '_citation.page_last' 4 2 'Structure model' '_citation.title' 5 2 'Structure model' '_citation_author.identifier_ORCID' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 5.7296 71.3387 37.4232 0.5705 ? 0.0135 ? -0.0883 ? 0.7541 ? -0.0521 ? 0.5326 ? 2.0805 ? 0.2695 ? -0.0384 ? 2.1373 ? -0.0526 ? 2.4351 ? 0.1457 ? -0.0977 ? 0.1039 ? 0.0814 ? 0.0258 ? -0.1720 ? -0.0879 ? 0.2878 ? -0.1228 ? 2 'X-RAY DIFFRACTION' ? refined 0.0879 64.5694 30.7811 0.4294 ? 0.0257 ? -0.0354 ? 0.4808 ? -0.0373 ? 0.4819 ? 2.2302 ? -0.2350 ? 1.1226 ? 1.8104 ? -0.5495 ? 4.2244 ? 0.1420 ? -0.2508 ? -0.2429 ? 0.2274 ? -0.0249 ? -0.1306 ? 0.2768 ? 0.2835 ? -0.0926 ? 3 'X-RAY DIFFRACTION' ? refined -6.7835 51.9016 27.2010 0.8289 ? 0.0392 ? -0.0847 ? 0.6027 ? 0.0350 ? 0.6109 ? 2.6377 ? 0.7032 ? 1.5950 ? 0.9566 ? -0.0256 ? 1.2257 ? 0.0760 ? -0.4168 ? -0.1227 ? 0.5528 ? 0.2310 ? -0.4696 ? 0.3414 ? -0.1185 ? -0.3188 ? 4 'X-RAY DIFFRACTION' ? refined -17.9810 61.2767 15.2495 0.4920 ? -0.0161 ? -0.0234 ? 0.4524 ? 0.0061 ? 0.4555 ? 1.4031 ? 0.3430 ? -0.6238 ? 3.0022 ? 0.0918 ? 2.7521 ? -0.0643 ? -0.2449 ? -0.1871 ? -0.0541 ? 0.1282 ? 0.4219 ? 0.1552 ? -0.4534 ? -0.0648 ? 5 'X-RAY DIFFRACTION' ? refined -4.3598 67.9985 11.7744 0.4171 ? -0.0238 ? 0.0063 ? 0.3940 ? -0.0404 ? 0.4351 ? 1.8290 ? -1.0758 ? -0.3085 ? 1.4104 ? -0.4365 ? 3.3958 ? 0.0838 ? -0.0270 ? -0.0752 ? -0.3593 ? 0.0700 ? -0.1362 ? 0.1023 ? 0.4130 ? -0.0778 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 37 ? ? ? A 92 ? ? ;chain 'A' and (resid 37 through 92 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 93 ? ? ? A 206 ? ? ;chain 'A' and (resid 93 through 206 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 207 ? ? ? A 241 ? ? ;chain 'A' and (resid 207 through 241 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 242 ? ? ? A 331 ? ? ;chain 'A' and (resid 242 through 331 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? A 332 ? ? ? A 382 ? ? ;chain 'A' and (resid 332 through 382 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20_4459 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.4 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_entry_details.entry_id 7XLP _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 135 ? ? -161.31 117.98 2 1 HIS A 184 ? ? -140.65 -3.15 3 1 ASP A 190 ? ? -154.52 58.38 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU 37 ? CG ? A LEU 2 CG 2 1 Y 1 A LEU 37 ? CD1 ? A LEU 2 CD1 3 1 Y 1 A LEU 37 ? CD2 ? A LEU 2 CD2 4 1 Y 1 A GLU 38 ? CG ? A GLU 3 CG 5 1 Y 1 A GLU 38 ? CD ? A GLU 3 CD 6 1 Y 1 A GLU 38 ? OE1 ? A GLU 3 OE1 7 1 Y 1 A GLU 38 ? OE2 ? A GLU 3 OE2 8 1 Y 1 A GLU 39 ? CG ? A GLU 4 CG 9 1 Y 1 A GLU 39 ? CD ? A GLU 4 CD 10 1 Y 1 A GLU 39 ? OE1 ? A GLU 4 OE1 11 1 Y 1 A GLU 39 ? OE2 ? A GLU 4 OE2 12 1 Y 1 A LEU 40 ? CG ? A LEU 5 CG 13 1 Y 1 A LEU 40 ? CD1 ? A LEU 5 CD1 14 1 Y 1 A LEU 40 ? CD2 ? A LEU 5 CD2 15 1 Y 1 A GLU 41 ? CG ? A GLU 6 CG 16 1 Y 1 A GLU 41 ? CD ? A GLU 6 CD 17 1 Y 1 A GLU 41 ? OE1 ? A GLU 6 OE1 18 1 Y 1 A GLU 41 ? OE2 ? A GLU 6 OE2 19 1 Y 1 A ARG 47 ? CG ? A ARG 12 CG 20 1 Y 1 A ARG 47 ? CD ? A ARG 12 CD 21 1 Y 1 A ARG 47 ? NE ? A ARG 12 NE 22 1 Y 1 A ARG 47 ? CZ ? A ARG 12 CZ 23 1 Y 1 A ARG 47 ? NH1 ? A ARG 12 NH1 24 1 Y 1 A ARG 47 ? NH2 ? A ARG 12 NH2 25 1 Y 1 A GLU 51 ? CG ? A GLU 16 CG 26 1 Y 1 A GLU 51 ? CD ? A GLU 16 CD 27 1 Y 1 A GLU 51 ? OE1 ? A GLU 16 OE1 28 1 Y 1 A GLU 51 ? OE2 ? A GLU 16 OE2 29 1 Y 1 A GLN 56 ? CG ? A GLN 21 CG 30 1 Y 1 A GLN 56 ? CD ? A GLN 21 CD 31 1 Y 1 A GLN 56 ? OE1 ? A GLN 21 OE1 32 1 Y 1 A GLN 56 ? NE2 ? A GLN 21 NE2 33 1 Y 1 A GLU 69 ? CG ? A GLU 34 CG 34 1 Y 1 A GLU 69 ? CD ? A GLU 34 CD 35 1 Y 1 A GLU 69 ? OE1 ? A GLU 34 OE1 36 1 Y 1 A GLU 69 ? OE2 ? A GLU 34 OE2 37 1 Y 1 A LEU 101 ? CG ? A LEU 66 CG 38 1 Y 1 A LEU 101 ? CD1 ? A LEU 66 CD1 39 1 Y 1 A LEU 101 ? CD2 ? A LEU 66 CD2 40 1 Y 1 A GLU 102 ? CG ? A GLU 67 CG 41 1 Y 1 A GLU 102 ? CD ? A GLU 67 CD 42 1 Y 1 A GLU 102 ? OE1 ? A GLU 67 OE1 43 1 Y 1 A GLU 102 ? OE2 ? A GLU 67 OE2 44 1 Y 1 A ILE 103 ? CG1 ? A ILE 68 CG1 45 1 Y 1 A ILE 103 ? CG2 ? A ILE 68 CG2 46 1 Y 1 A ILE 103 ? CD1 ? A ILE 68 CD1 47 1 Y 1 A LYS 104 ? CG ? A LYS 69 CG 48 1 Y 1 A LYS 104 ? CD ? A LYS 69 CD 49 1 Y 1 A LYS 104 ? CE ? A LYS 69 CE 50 1 Y 1 A LYS 104 ? NZ ? A LYS 69 NZ 51 1 Y 1 A ARG 108 ? CG ? A ARG 73 CG 52 1 Y 1 A ARG 108 ? CD ? A ARG 73 CD 53 1 Y 1 A ARG 108 ? NE ? A ARG 73 NE 54 1 Y 1 A ARG 108 ? CZ ? A ARG 73 CZ 55 1 Y 1 A ARG 108 ? NH1 ? A ARG 73 NH1 56 1 Y 1 A ARG 108 ? NH2 ? A ARG 73 NH2 57 1 Y 1 A GLU 120 ? CG ? A GLU 85 CG 58 1 Y 1 A GLU 120 ? CD ? A GLU 85 CD 59 1 Y 1 A GLU 120 ? OE1 ? A GLU 85 OE1 60 1 Y 1 A GLU 120 ? OE2 ? A GLU 85 OE2 61 1 Y 1 A LYS 185 ? CG ? A LYS 150 CG 62 1 Y 1 A LYS 185 ? CD ? A LYS 150 CD 63 1 Y 1 A LYS 185 ? CE ? A LYS 150 CE 64 1 Y 1 A LYS 185 ? NZ ? A LYS 150 NZ 65 1 Y 1 A GLN 214 ? CG ? A GLN 179 CG 66 1 Y 1 A GLN 214 ? CD ? A GLN 179 CD 67 1 Y 1 A GLN 214 ? OE1 ? A GLN 179 OE1 68 1 Y 1 A GLN 214 ? NE2 ? A GLN 179 NE2 69 1 Y 1 A ASP 217 ? CG ? A ASP 182 CG 70 1 Y 1 A ASP 217 ? OD1 ? A ASP 182 OD1 71 1 Y 1 A ASP 217 ? OD2 ? A ASP 182 OD2 72 1 Y 1 A HIS 239 ? CG ? A HIS 204 CG 73 1 Y 1 A HIS 239 ? ND1 ? A HIS 204 ND1 74 1 Y 1 A HIS 239 ? CD2 ? A HIS 204 CD2 75 1 Y 1 A HIS 239 ? CE1 ? A HIS 204 CE1 76 1 Y 1 A HIS 239 ? NE2 ? A HIS 204 NE2 77 1 Y 1 A TYR 240 ? CG ? A TYR 205 CG 78 1 Y 1 A TYR 240 ? CD1 ? A TYR 205 CD1 79 1 Y 1 A TYR 240 ? CD2 ? A TYR 205 CD2 80 1 Y 1 A TYR 240 ? CE1 ? A TYR 205 CE1 81 1 Y 1 A TYR 240 ? CE2 ? A TYR 205 CE2 82 1 Y 1 A TYR 240 ? CZ ? A TYR 205 CZ 83 1 Y 1 A TYR 240 ? OH ? A TYR 205 OH 84 1 Y 1 A ARG 260 ? CG ? A ARG 225 CG 85 1 Y 1 A ARG 260 ? CD ? A ARG 225 CD 86 1 Y 1 A ARG 260 ? NE ? A ARG 225 NE 87 1 Y 1 A ARG 260 ? CZ ? A ARG 225 CZ 88 1 Y 1 A ARG 260 ? NH1 ? A ARG 225 NH1 89 1 Y 1 A ARG 260 ? NH2 ? A ARG 225 NH2 90 1 Y 1 A ASP 267 ? CG ? A ASP 232 CG 91 1 Y 1 A ASP 267 ? OD1 ? A ASP 232 OD1 92 1 Y 1 A ASP 267 ? OD2 ? A ASP 232 OD2 93 1 Y 1 A LYS 269 ? CG ? A LYS 234 CG 94 1 Y 1 A LYS 269 ? CD ? A LYS 234 CD 95 1 Y 1 A LYS 269 ? CE ? A LYS 234 CE 96 1 Y 1 A LYS 269 ? NZ ? A LYS 234 NZ 97 1 Y 1 A GLU 272 ? CG ? A GLU 237 CG 98 1 Y 1 A GLU 272 ? CD ? A GLU 237 CD 99 1 Y 1 A GLU 272 ? OE1 ? A GLU 237 OE1 100 1 Y 1 A GLU 272 ? OE2 ? A GLU 237 OE2 101 1 Y 1 A LEU 273 ? CG ? A LEU 238 CG 102 1 Y 1 A LEU 273 ? CD1 ? A LEU 238 CD1 103 1 Y 1 A LEU 273 ? CD2 ? A LEU 238 CD2 104 1 Y 1 A ASP 315 ? CG ? A ASP 280 CG 105 1 Y 1 A ASP 315 ? OD1 ? A ASP 280 OD1 106 1 Y 1 A ASP 315 ? OD2 ? A ASP 280 OD2 107 1 Y 1 A GLU 368 ? CG ? A GLU 333 CG 108 1 Y 1 A GLU 368 ? CD ? A GLU 333 CD 109 1 Y 1 A GLU 368 ? OE1 ? A GLU 333 OE1 110 1 Y 1 A GLU 368 ? OE2 ? A GLU 333 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 36 ? A GLY 1 2 1 Y 1 A ASN 221 ? A ASN 186 3 1 Y 1 A SER 222 ? A SER 187 4 1 Y 1 A PHE 223 ? A PHE 188 5 1 Y 1 A VAL 224 ? A VAL 189 6 1 Y 1 A CYS 277 ? A CYS 242 7 1 Y 1 A GLN 278 ? A GLN 243 8 1 Y 1 A VAL 279 ? A VAL 244 9 1 Y 1 A GLU 280 ? A GLU 245 10 1 Y 1 A GLY 281 ? A GLY 246 11 1 Y 1 A ASP 282 ? A ASP 247 12 1 Y 1 A ALA 283 ? A ALA 248 13 1 Y 1 A ALA 284 ? A ALA 249 14 1 Y 1 A GLU 285 ? A GLU 250 15 1 Y 1 A THR 286 ? A THR 251 16 1 Y 1 A PRO 287 ? A PRO 252 17 1 Y 1 A PRO 288 ? A PRO 253 18 1 Y 1 A ARG 289 ? A ARG 254 19 1 Y 1 A PRO 290 ? A PRO 255 20 1 Y 1 A ARG 291 ? A ARG 256 21 1 Y 1 A THR 292 ? A THR 257 22 1 Y 1 A PRO 293 ? A PRO 258 23 1 Y 1 A GLY 294 ? A GLY 259 24 1 Y 1 A ARG 295 ? A ARG 260 25 1 Y 1 A PRO 296 ? A PRO 261 26 1 Y 1 A LEU 297 ? A LEU 262 27 1 Y 1 A ASN 298 ? A ASN 263 28 1 Y 1 A LYS 299 ? A LYS 264 29 1 Y 1 A LYS 300 ? A LYS 265 30 1 Y 1 A GLY 301 ? A GLY 266 31 1 Y 1 A MET 302 ? A MET 267 32 1 Y 1 A ASP 303 ? A ASP 268 33 1 Y 1 A SER 304 ? A SER 269 34 1 Y 1 A ARG 305 ? A ARG 270 35 1 Y 1 A PRO 306 ? A PRO 271 36 1 Y 1 A GLN 383 ? A GLN 348 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 DMS S S N N 89 DMS O O N N 90 DMS C1 C N N 91 DMS C2 C N N 92 DMS H11 H N N 93 DMS H12 H N N 94 DMS H13 H N N 95 DMS H21 H N N 96 DMS H22 H N N 97 DMS H23 H N N 98 FZC C10 C Y N 99 FZC C15 C Y N 100 FZC C17 C Y N 101 FZC C20 C N N 102 FZC C21 C N N 103 FZC C22 C N N 104 FZC C26 C Y N 105 FZC C28 C N N 106 FZC C01 C N N 107 FZC C02 C Y N 108 FZC C03 C Y N 109 FZC C04 C Y N 110 FZC C06 C Y N 111 FZC C08 C Y N 112 FZC C09 C Y N 113 FZC C11 C Y N 114 FZC C12 C Y N 115 FZC C14 C Y N 116 FZC C16 C Y N 117 FZC C19 C N S 118 FZC C23 C N R 119 FZC C25 C N N 120 FZC C27 C Y N 121 FZC C31 C Y N 122 FZC C32 C Y N 123 FZC N05 N Y N 124 FZC N24 N N N 125 FZC N29 N Y N 126 FZC N30 N Y N 127 FZC N33 N Y N 128 FZC O07 O N N 129 FZC O18 O N N 130 FZC CL1 CL N N 131 FZC H1 H N N 132 FZC H2 H N N 133 FZC H3 H N N 134 FZC H4 H N N 135 FZC H5 H N N 136 FZC H6 H N N 137 FZC H7 H N N 138 FZC H8 H N N 139 FZC H9 H N N 140 FZC H10 H N N 141 FZC H11 H N N 142 FZC H12 H N N 143 FZC H13 H N N 144 FZC H14 H N N 145 FZC H15 H N N 146 FZC H16 H N N 147 FZC H17 H N N 148 FZC H18 H N N 149 FZC H19 H N N 150 FZC H20 H N N 151 FZC H21 H N N 152 FZC H22 H N N 153 FZC H23 H N N 154 FZC H24 H N N 155 FZC H25 H N N 156 FZC H26 H N N 157 GLN N N N N 158 GLN CA C N S 159 GLN C C N N 160 GLN O O N N 161 GLN CB C N N 162 GLN CG C N N 163 GLN CD C N N 164 GLN OE1 O N N 165 GLN NE2 N N N 166 GLN OXT O N N 167 GLN H H N N 168 GLN H2 H N N 169 GLN HA H N N 170 GLN HB2 H N N 171 GLN HB3 H N N 172 GLN HG2 H N N 173 GLN HG3 H N N 174 GLN HE21 H N N 175 GLN HE22 H N N 176 GLN HXT H N N 177 GLU N N N N 178 GLU CA C N S 179 GLU C C N N 180 GLU O O N N 181 GLU CB C N N 182 GLU CG C N N 183 GLU CD C N N 184 GLU OE1 O N N 185 GLU OE2 O N N 186 GLU OXT O N N 187 GLU H H N N 188 GLU H2 H N N 189 GLU HA H N N 190 GLU HB2 H N N 191 GLU HB3 H N N 192 GLU HG2 H N N 193 GLU HG3 H N N 194 GLU HE2 H N N 195 GLU HXT H N N 196 GLY N N N N 197 GLY CA C N N 198 GLY C C N N 199 GLY O O N N 200 GLY OXT O N N 201 GLY H H N N 202 GLY H2 H N N 203 GLY HA2 H N N 204 GLY HA3 H N N 205 GLY HXT H N N 206 HIS N N N N 207 HIS CA C N S 208 HIS C C N N 209 HIS O O N N 210 HIS CB C N N 211 HIS CG C Y N 212 HIS ND1 N Y N 213 HIS CD2 C Y N 214 HIS CE1 C Y N 215 HIS NE2 N Y N 216 HIS OXT O N N 217 HIS H H N N 218 HIS H2 H N N 219 HIS HA H N N 220 HIS HB2 H N N 221 HIS HB3 H N N 222 HIS HD1 H N N 223 HIS HD2 H N N 224 HIS HE1 H N N 225 HIS HE2 H N N 226 HIS HXT H N N 227 HOH O O N N 228 HOH H1 H N N 229 HOH H2 H N N 230 ILE N N N N 231 ILE CA C N S 232 ILE C C N N 233 ILE O O N N 234 ILE CB C N S 235 ILE CG1 C N N 236 ILE CG2 C N N 237 ILE CD1 C N N 238 ILE OXT O N N 239 ILE H H N N 240 ILE H2 H N N 241 ILE HA H N N 242 ILE HB H N N 243 ILE HG12 H N N 244 ILE HG13 H N N 245 ILE HG21 H N N 246 ILE HG22 H N N 247 ILE HG23 H N N 248 ILE HD11 H N N 249 ILE HD12 H N N 250 ILE HD13 H N N 251 ILE HXT H N N 252 LEU N N N N 253 LEU CA C N S 254 LEU C C N N 255 LEU O O N N 256 LEU CB C N N 257 LEU CG C N N 258 LEU CD1 C N N 259 LEU CD2 C N N 260 LEU OXT O N N 261 LEU H H N N 262 LEU H2 H N N 263 LEU HA H N N 264 LEU HB2 H N N 265 LEU HB3 H N N 266 LEU HG H N N 267 LEU HD11 H N N 268 LEU HD12 H N N 269 LEU HD13 H N N 270 LEU HD21 H N N 271 LEU HD22 H N N 272 LEU HD23 H N N 273 LEU HXT H N N 274 LYS N N N N 275 LYS CA C N S 276 LYS C C N N 277 LYS O O N N 278 LYS CB C N N 279 LYS CG C N N 280 LYS CD C N N 281 LYS CE C N N 282 LYS NZ N N N 283 LYS OXT O N N 284 LYS H H N N 285 LYS H2 H N N 286 LYS HA H N N 287 LYS HB2 H N N 288 LYS HB3 H N N 289 LYS HG2 H N N 290 LYS HG3 H N N 291 LYS HD2 H N N 292 LYS HD3 H N N 293 LYS HE2 H N N 294 LYS HE3 H N N 295 LYS HZ1 H N N 296 LYS HZ2 H N N 297 LYS HZ3 H N N 298 LYS HXT H N N 299 MET N N N N 300 MET CA C N S 301 MET C C N N 302 MET O O N N 303 MET CB C N N 304 MET CG C N N 305 MET SD S N N 306 MET CE C N N 307 MET OXT O N N 308 MET H H N N 309 MET H2 H N N 310 MET HA H N N 311 MET HB2 H N N 312 MET HB3 H N N 313 MET HG2 H N N 314 MET HG3 H N N 315 MET HE1 H N N 316 MET HE2 H N N 317 MET HE3 H N N 318 MET HXT H N N 319 PHE N N N N 320 PHE CA C N S 321 PHE C C N N 322 PHE O O N N 323 PHE CB C N N 324 PHE CG C Y N 325 PHE CD1 C Y N 326 PHE CD2 C Y N 327 PHE CE1 C Y N 328 PHE CE2 C Y N 329 PHE CZ C Y N 330 PHE OXT O N N 331 PHE H H N N 332 PHE H2 H N N 333 PHE HA H N N 334 PHE HB2 H N N 335 PHE HB3 H N N 336 PHE HD1 H N N 337 PHE HD2 H N N 338 PHE HE1 H N N 339 PHE HE2 H N N 340 PHE HZ H N N 341 PHE HXT H N N 342 PRO N N N N 343 PRO CA C N S 344 PRO C C N N 345 PRO O O N N 346 PRO CB C N N 347 PRO CG C N N 348 PRO CD C N N 349 PRO OXT O N N 350 PRO H H N N 351 PRO HA H N N 352 PRO HB2 H N N 353 PRO HB3 H N N 354 PRO HG2 H N N 355 PRO HG3 H N N 356 PRO HD2 H N N 357 PRO HD3 H N N 358 PRO HXT H N N 359 SER N N N N 360 SER CA C N S 361 SER C C N N 362 SER O O N N 363 SER CB C N N 364 SER OG O N N 365 SER OXT O N N 366 SER H H N N 367 SER H2 H N N 368 SER HA H N N 369 SER HB2 H N N 370 SER HB3 H N N 371 SER HG H N N 372 SER HXT H N N 373 THR N N N N 374 THR CA C N S 375 THR C C N N 376 THR O O N N 377 THR CB C N R 378 THR OG1 O N N 379 THR CG2 C N N 380 THR OXT O N N 381 THR H H N N 382 THR H2 H N N 383 THR HA H N N 384 THR HB H N N 385 THR HG1 H N N 386 THR HG21 H N N 387 THR HG22 H N N 388 THR HG23 H N N 389 THR HXT H N N 390 TRP N N N N 391 TRP CA C N S 392 TRP C C N N 393 TRP O O N N 394 TRP CB C N N 395 TRP CG C Y N 396 TRP CD1 C Y N 397 TRP CD2 C Y N 398 TRP NE1 N Y N 399 TRP CE2 C Y N 400 TRP CE3 C Y N 401 TRP CZ2 C Y N 402 TRP CZ3 C Y N 403 TRP CH2 C Y N 404 TRP OXT O N N 405 TRP H H N N 406 TRP H2 H N N 407 TRP HA H N N 408 TRP HB2 H N N 409 TRP HB3 H N N 410 TRP HD1 H N N 411 TRP HE1 H N N 412 TRP HE3 H N N 413 TRP HZ2 H N N 414 TRP HZ3 H N N 415 TRP HH2 H N N 416 TRP HXT H N N 417 TYR N N N N 418 TYR CA C N S 419 TYR C C N N 420 TYR O O N N 421 TYR CB C N N 422 TYR CG C Y N 423 TYR CD1 C Y N 424 TYR CD2 C Y N 425 TYR CE1 C Y N 426 TYR CE2 C Y N 427 TYR CZ C Y N 428 TYR OH O N N 429 TYR OXT O N N 430 TYR H H N N 431 TYR H2 H N N 432 TYR HA H N N 433 TYR HB2 H N N 434 TYR HB3 H N N 435 TYR HD1 H N N 436 TYR HD2 H N N 437 TYR HE1 H N N 438 TYR HE2 H N N 439 TYR HH H N N 440 TYR HXT H N N 441 VAL N N N N 442 VAL CA C N S 443 VAL C C N N 444 VAL O O N N 445 VAL CB C N N 446 VAL CG1 C N N 447 VAL CG2 C N N 448 VAL OXT O N N 449 VAL H H N N 450 VAL H2 H N N 451 VAL HA H N N 452 VAL HB H N N 453 VAL HG11 H N N 454 VAL HG12 H N N 455 VAL HG13 H N N 456 VAL HG21 H N N 457 VAL HG22 H N N 458 VAL HG23 H N N 459 VAL HXT H N N 460 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 DMS S O doub N N 83 DMS S C1 sing N N 84 DMS S C2 sing N N 85 DMS C1 H11 sing N N 86 DMS C1 H12 sing N N 87 DMS C1 H13 sing N N 88 DMS C2 H21 sing N N 89 DMS C2 H22 sing N N 90 DMS C2 H23 sing N N 91 FZC N24 C23 sing N N 92 FZC C01 C02 sing N N 93 FZC C25 C23 sing N N 94 FZC C25 C19 sing N N 95 FZC C23 C22 sing N N 96 FZC C22 C21 sing N N 97 FZC C28 C27 sing N N 98 FZC C02 C03 doub Y N 99 FZC C02 N33 sing Y N 100 FZC C03 C04 sing Y N 101 FZC C27 N29 doub Y N 102 FZC C27 C26 sing Y N 103 FZC N29 N30 sing Y N 104 FZC O18 C19 sing N N 105 FZC O18 C17 sing N N 106 FZC C21 C20 sing N N 107 FZC C19 C20 sing N N 108 FZC C26 C17 sing Y N 109 FZC C26 C31 doub Y N 110 FZC C17 C16 doub Y N 111 FZC N30 C31 sing Y N 112 FZC N33 C06 doub Y N 113 FZC C31 C32 sing Y N 114 FZC C10 C09 doub Y N 115 FZC C10 C11 sing Y N 116 FZC C16 C15 sing Y N 117 FZC C09 C08 sing Y N 118 FZC C32 C15 doub Y N 119 FZC C15 C11 sing N N 120 FZC C04 N05 doub Y N 121 FZC C11 C12 doub Y N 122 FZC C06 N05 sing Y N 123 FZC C06 O07 sing N N 124 FZC C08 O07 sing N N 125 FZC C08 C14 doub Y N 126 FZC C12 C14 sing Y N 127 FZC C12 CL1 sing N N 128 FZC C10 H1 sing N N 129 FZC C20 H2 sing N N 130 FZC C20 H3 sing N N 131 FZC C21 H4 sing N N 132 FZC C21 H5 sing N N 133 FZC C22 H6 sing N N 134 FZC C22 H7 sing N N 135 FZC C28 H8 sing N N 136 FZC C28 H9 sing N N 137 FZC C28 H10 sing N N 138 FZC C01 H11 sing N N 139 FZC C01 H12 sing N N 140 FZC C01 H13 sing N N 141 FZC C03 H14 sing N N 142 FZC C04 H15 sing N N 143 FZC C09 H16 sing N N 144 FZC C14 H17 sing N N 145 FZC C16 H18 sing N N 146 FZC C19 H19 sing N N 147 FZC C23 H20 sing N N 148 FZC C25 H21 sing N N 149 FZC C25 H22 sing N N 150 FZC C32 H23 sing N N 151 FZC N24 H24 sing N N 152 FZC N24 H25 sing N N 153 FZC N30 H26 sing N N 154 GLN N CA sing N N 155 GLN N H sing N N 156 GLN N H2 sing N N 157 GLN CA C sing N N 158 GLN CA CB sing N N 159 GLN CA HA sing N N 160 GLN C O doub N N 161 GLN C OXT sing N N 162 GLN CB CG sing N N 163 GLN CB HB2 sing N N 164 GLN CB HB3 sing N N 165 GLN CG CD sing N N 166 GLN CG HG2 sing N N 167 GLN CG HG3 sing N N 168 GLN CD OE1 doub N N 169 GLN CD NE2 sing N N 170 GLN NE2 HE21 sing N N 171 GLN NE2 HE22 sing N N 172 GLN OXT HXT sing N N 173 GLU N CA sing N N 174 GLU N H sing N N 175 GLU N H2 sing N N 176 GLU CA C sing N N 177 GLU CA CB sing N N 178 GLU CA HA sing N N 179 GLU C O doub N N 180 GLU C OXT sing N N 181 GLU CB CG sing N N 182 GLU CB HB2 sing N N 183 GLU CB HB3 sing N N 184 GLU CG CD sing N N 185 GLU CG HG2 sing N N 186 GLU CG HG3 sing N N 187 GLU CD OE1 doub N N 188 GLU CD OE2 sing N N 189 GLU OE2 HE2 sing N N 190 GLU OXT HXT sing N N 191 GLY N CA sing N N 192 GLY N H sing N N 193 GLY N H2 sing N N 194 GLY CA C sing N N 195 GLY CA HA2 sing N N 196 GLY CA HA3 sing N N 197 GLY C O doub N N 198 GLY C OXT sing N N 199 GLY OXT HXT sing N N 200 HIS N CA sing N N 201 HIS N H sing N N 202 HIS N H2 sing N N 203 HIS CA C sing N N 204 HIS CA CB sing N N 205 HIS CA HA sing N N 206 HIS C O doub N N 207 HIS C OXT sing N N 208 HIS CB CG sing N N 209 HIS CB HB2 sing N N 210 HIS CB HB3 sing N N 211 HIS CG ND1 sing Y N 212 HIS CG CD2 doub Y N 213 HIS ND1 CE1 doub Y N 214 HIS ND1 HD1 sing N N 215 HIS CD2 NE2 sing Y N 216 HIS CD2 HD2 sing N N 217 HIS CE1 NE2 sing Y N 218 HIS CE1 HE1 sing N N 219 HIS NE2 HE2 sing N N 220 HIS OXT HXT sing N N 221 HOH O H1 sing N N 222 HOH O H2 sing N N 223 ILE N CA sing N N 224 ILE N H sing N N 225 ILE N H2 sing N N 226 ILE CA C sing N N 227 ILE CA CB sing N N 228 ILE CA HA sing N N 229 ILE C O doub N N 230 ILE C OXT sing N N 231 ILE CB CG1 sing N N 232 ILE CB CG2 sing N N 233 ILE CB HB sing N N 234 ILE CG1 CD1 sing N N 235 ILE CG1 HG12 sing N N 236 ILE CG1 HG13 sing N N 237 ILE CG2 HG21 sing N N 238 ILE CG2 HG22 sing N N 239 ILE CG2 HG23 sing N N 240 ILE CD1 HD11 sing N N 241 ILE CD1 HD12 sing N N 242 ILE CD1 HD13 sing N N 243 ILE OXT HXT sing N N 244 LEU N CA sing N N 245 LEU N H sing N N 246 LEU N H2 sing N N 247 LEU CA C sing N N 248 LEU CA CB sing N N 249 LEU CA HA sing N N 250 LEU C O doub N N 251 LEU C OXT sing N N 252 LEU CB CG sing N N 253 LEU CB HB2 sing N N 254 LEU CB HB3 sing N N 255 LEU CG CD1 sing N N 256 LEU CG CD2 sing N N 257 LEU CG HG sing N N 258 LEU CD1 HD11 sing N N 259 LEU CD1 HD12 sing N N 260 LEU CD1 HD13 sing N N 261 LEU CD2 HD21 sing N N 262 LEU CD2 HD22 sing N N 263 LEU CD2 HD23 sing N N 264 LEU OXT HXT sing N N 265 LYS N CA sing N N 266 LYS N H sing N N 267 LYS N H2 sing N N 268 LYS CA C sing N N 269 LYS CA CB sing N N 270 LYS CA HA sing N N 271 LYS C O doub N N 272 LYS C OXT sing N N 273 LYS CB CG sing N N 274 LYS CB HB2 sing N N 275 LYS CB HB3 sing N N 276 LYS CG CD sing N N 277 LYS CG HG2 sing N N 278 LYS CG HG3 sing N N 279 LYS CD CE sing N N 280 LYS CD HD2 sing N N 281 LYS CD HD3 sing N N 282 LYS CE NZ sing N N 283 LYS CE HE2 sing N N 284 LYS CE HE3 sing N N 285 LYS NZ HZ1 sing N N 286 LYS NZ HZ2 sing N N 287 LYS NZ HZ3 sing N N 288 LYS OXT HXT sing N N 289 MET N CA sing N N 290 MET N H sing N N 291 MET N H2 sing N N 292 MET CA C sing N N 293 MET CA CB sing N N 294 MET CA HA sing N N 295 MET C O doub N N 296 MET C OXT sing N N 297 MET CB CG sing N N 298 MET CB HB2 sing N N 299 MET CB HB3 sing N N 300 MET CG SD sing N N 301 MET CG HG2 sing N N 302 MET CG HG3 sing N N 303 MET SD CE sing N N 304 MET CE HE1 sing N N 305 MET CE HE2 sing N N 306 MET CE HE3 sing N N 307 MET OXT HXT sing N N 308 PHE N CA sing N N 309 PHE N H sing N N 310 PHE N H2 sing N N 311 PHE CA C sing N N 312 PHE CA CB sing N N 313 PHE CA HA sing N N 314 PHE C O doub N N 315 PHE C OXT sing N N 316 PHE CB CG sing N N 317 PHE CB HB2 sing N N 318 PHE CB HB3 sing N N 319 PHE CG CD1 doub Y N 320 PHE CG CD2 sing Y N 321 PHE CD1 CE1 sing Y N 322 PHE CD1 HD1 sing N N 323 PHE CD2 CE2 doub Y N 324 PHE CD2 HD2 sing N N 325 PHE CE1 CZ doub Y N 326 PHE CE1 HE1 sing N N 327 PHE CE2 CZ sing Y N 328 PHE CE2 HE2 sing N N 329 PHE CZ HZ sing N N 330 PHE OXT HXT sing N N 331 PRO N CA sing N N 332 PRO N CD sing N N 333 PRO N H sing N N 334 PRO CA C sing N N 335 PRO CA CB sing N N 336 PRO CA HA sing N N 337 PRO C O doub N N 338 PRO C OXT sing N N 339 PRO CB CG sing N N 340 PRO CB HB2 sing N N 341 PRO CB HB3 sing N N 342 PRO CG CD sing N N 343 PRO CG HG2 sing N N 344 PRO CG HG3 sing N N 345 PRO CD HD2 sing N N 346 PRO CD HD3 sing N N 347 PRO OXT HXT sing N N 348 SER N CA sing N N 349 SER N H sing N N 350 SER N H2 sing N N 351 SER CA C sing N N 352 SER CA CB sing N N 353 SER CA HA sing N N 354 SER C O doub N N 355 SER C OXT sing N N 356 SER CB OG sing N N 357 SER CB HB2 sing N N 358 SER CB HB3 sing N N 359 SER OG HG sing N N 360 SER OXT HXT sing N N 361 THR N CA sing N N 362 THR N H sing N N 363 THR N H2 sing N N 364 THR CA C sing N N 365 THR CA CB sing N N 366 THR CA HA sing N N 367 THR C O doub N N 368 THR C OXT sing N N 369 THR CB OG1 sing N N 370 THR CB CG2 sing N N 371 THR CB HB sing N N 372 THR OG1 HG1 sing N N 373 THR CG2 HG21 sing N N 374 THR CG2 HG22 sing N N 375 THR CG2 HG23 sing N N 376 THR OXT HXT sing N N 377 TRP N CA sing N N 378 TRP N H sing N N 379 TRP N H2 sing N N 380 TRP CA C sing N N 381 TRP CA CB sing N N 382 TRP CA HA sing N N 383 TRP C O doub N N 384 TRP C OXT sing N N 385 TRP CB CG sing N N 386 TRP CB HB2 sing N N 387 TRP CB HB3 sing N N 388 TRP CG CD1 doub Y N 389 TRP CG CD2 sing Y N 390 TRP CD1 NE1 sing Y N 391 TRP CD1 HD1 sing N N 392 TRP CD2 CE2 doub Y N 393 TRP CD2 CE3 sing Y N 394 TRP NE1 CE2 sing Y N 395 TRP NE1 HE1 sing N N 396 TRP CE2 CZ2 sing Y N 397 TRP CE3 CZ3 doub Y N 398 TRP CE3 HE3 sing N N 399 TRP CZ2 CH2 doub Y N 400 TRP CZ2 HZ2 sing N N 401 TRP CZ3 CH2 sing Y N 402 TRP CZ3 HZ3 sing N N 403 TRP CH2 HH2 sing N N 404 TRP OXT HXT sing N N 405 TYR N CA sing N N 406 TYR N H sing N N 407 TYR N H2 sing N N 408 TYR CA C sing N N 409 TYR CA CB sing N N 410 TYR CA HA sing N N 411 TYR C O doub N N 412 TYR C OXT sing N N 413 TYR CB CG sing N N 414 TYR CB HB2 sing N N 415 TYR CB HB3 sing N N 416 TYR CG CD1 doub Y N 417 TYR CG CD2 sing Y N 418 TYR CD1 CE1 sing Y N 419 TYR CD1 HD1 sing N N 420 TYR CD2 CE2 doub Y N 421 TYR CD2 HD2 sing N N 422 TYR CE1 CZ doub Y N 423 TYR CE1 HE1 sing N N 424 TYR CE2 CZ sing Y N 425 TYR CE2 HE2 sing N N 426 TYR CZ OH sing N N 427 TYR OH HH sing N N 428 TYR OXT HXT sing N N 429 VAL N CA sing N N 430 VAL N H sing N N 431 VAL N H2 sing N N 432 VAL CA C sing N N 433 VAL CA CB sing N N 434 VAL CA HA sing N N 435 VAL C O doub N N 436 VAL C OXT sing N N 437 VAL CB CG1 sing N N 438 VAL CB CG2 sing N N 439 VAL CB HB sing N N 440 VAL CG1 HG11 sing N N 441 VAL CG1 HG12 sing N N 442 VAL CG1 HG13 sing N N 443 VAL CG2 HG21 sing N N 444 VAL CG2 HG22 sing N N 445 VAL CG2 HG23 sing N N 446 VAL OXT HXT sing N N 447 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id FZC _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id FZC _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '(1~{R},3~{S})-3-[[6-[2-chloranyl-4-(4-methylpyrimidin-2-yl)oxy-phenyl]-3-methyl-1~{H}-indazol-4-yl]oxy]cyclohexan-1-amine' FZC 3 'DIMETHYL SULFOXIDE' DMS 4 'CALCIUM ION' CA 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5BX0 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #