data_7XUQ # _entry.id 7XUQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.391 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7XUQ pdb_00007xuq 10.2210/pdb7xuq/pdb WWPDB D_1300029592 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-09-28 2 'Structure model' 1 1 2022-10-05 3 'Structure model' 1 2 2022-12-07 4 'Structure model' 1 3 2023-11-29 5 'Structure model' 1 4 2024-05-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Refinement description' 5 5 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation 4 3 'Structure model' citation_author 5 4 'Structure model' chem_comp_atom 6 4 'Structure model' chem_comp_bond 7 4 'Structure model' pdbx_initial_refinement_model 8 5 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 3 'Structure model' '_citation.journal_volume' 4 3 'Structure model' '_citation.page_first' 5 3 'Structure model' '_citation.page_last' 6 3 'Structure model' '_citation.pdbx_database_id_PubMed' 7 3 'Structure model' '_citation.title' 8 3 'Structure model' '_citation_author.name' 9 5 'Structure model' '_citation.pdbx_database_id_PubMed' 10 5 'Structure model' '_citation.title' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7XUQ _pdbx_database_status.recvd_initial_deposition_date 2022-05-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email xchen@nwu.edu.cn _pdbx_contact_author.name_first Xi _pdbx_contact_author.name_last Chen _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-8295-2854 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Chen, X.' 1 ? 'Qian, J.Y.' 2 ? 'Sun, N.N.' 3 ? 'Zhong, F.R.' 4 ? 'Wu, Y.Z.' 5 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Nature _citation.journal_id_ASTM NATUAS _citation.journal_id_CSD 0006 _citation.journal_id_ISSN 1476-4687 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 611 _citation.language ? _citation.page_first 715 _citation.page_last 720 _citation.title 'Enantioselective [2+2]-cycloadditions with triplet photoenzymes.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41586-022-05342-4 _citation.pdbx_database_id_PubMed 36130726 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sun, N.' 1 ? primary 'Huang, J.' 2 ? primary 'Qian, J.' 3 ? primary 'Zhou, T.P.' 4 ? primary 'Guo, J.' 5 ? primary 'Tang, L.' 6 ? primary 'Zhang, W.' 7 ? primary 'Deng, Y.' 8 ? primary 'Zhao, W.' 9 ? primary 'Wu, G.' 10 ? primary 'Liao, R.Z.' 11 ? primary 'Chen, X.' 12 ? primary 'Zhong, F.' 13 ? primary 'Wu, Y.' 14 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Transcriptional regulator, PadR-like family' 15135.001 1 ? 'M8L, K55D, K59Q, W96L' ? 'There is an unnatural amino acid DFF inserted between ALA A 92 and GLU A 94.' 2 non-polymer syn 'dimethyl 2-[[2-methyl-1-[(2-methylpropan-2-yl)oxycarbonyl]indol-3-yl]methyl]-2-prop-2-enyl-propanedioate' 415.479 1 ? ? ? ? 3 water nat water 18.015 11 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MGAEIPKELLRAQTNVILLNVLKQGDNYVYGIIKQVKEASNGEMELNEATLYTIFDRLEQDGIISSYWGDESQGGRRKYY RLTEIGHENMRLA(DFF)ESLSRVDKIIENLEANKKSEAIKSRGGSGGWSHPQFEK ; _entity_poly.pdbx_seq_one_letter_code_can ;MGAEIPKELLRAQTNVILLNVLKQGDNYVYGIIKQVKEASNGEMELNEATLYTIFDRLEQDGIISSYWGDESQGGRRKYY RLTEIGHENMRLAXESLSRVDKIIENLEANKKSEAIKSRGGSGGWSHPQFEK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'dimethyl 2-[[2-methyl-1-[(2-methylpropan-2-yl)oxycarbonyl]indol-3-yl]methyl]-2-prop-2-enyl-propanedioate' I1A 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 ALA n 1 4 GLU n 1 5 ILE n 1 6 PRO n 1 7 LYS n 1 8 GLU n 1 9 LEU n 1 10 LEU n 1 11 ARG n 1 12 ALA n 1 13 GLN n 1 14 THR n 1 15 ASN n 1 16 VAL n 1 17 ILE n 1 18 LEU n 1 19 LEU n 1 20 ASN n 1 21 VAL n 1 22 LEU n 1 23 LYS n 1 24 GLN n 1 25 GLY n 1 26 ASP n 1 27 ASN n 1 28 TYR n 1 29 VAL n 1 30 TYR n 1 31 GLY n 1 32 ILE n 1 33 ILE n 1 34 LYS n 1 35 GLN n 1 36 VAL n 1 37 LYS n 1 38 GLU n 1 39 ALA n 1 40 SER n 1 41 ASN n 1 42 GLY n 1 43 GLU n 1 44 MET n 1 45 GLU n 1 46 LEU n 1 47 ASN n 1 48 GLU n 1 49 ALA n 1 50 THR n 1 51 LEU n 1 52 TYR n 1 53 THR n 1 54 ILE n 1 55 PHE n 1 56 ASP n 1 57 ARG n 1 58 LEU n 1 59 GLU n 1 60 GLN n 1 61 ASP n 1 62 GLY n 1 63 ILE n 1 64 ILE n 1 65 SER n 1 66 SER n 1 67 TYR n 1 68 TRP n 1 69 GLY n 1 70 ASP n 1 71 GLU n 1 72 SER n 1 73 GLN n 1 74 GLY n 1 75 GLY n 1 76 ARG n 1 77 ARG n 1 78 LYS n 1 79 TYR n 1 80 TYR n 1 81 ARG n 1 82 LEU n 1 83 THR n 1 84 GLU n 1 85 ILE n 1 86 GLY n 1 87 HIS n 1 88 GLU n 1 89 ASN n 1 90 MET n 1 91 ARG n 1 92 LEU n 1 93 ALA n 1 94 DFF n 1 95 GLU n 1 96 SER n 1 97 LEU n 1 98 SER n 1 99 ARG n 1 100 VAL n 1 101 ASP n 1 102 LYS n 1 103 ILE n 1 104 ILE n 1 105 GLU n 1 106 ASN n 1 107 LEU n 1 108 GLU n 1 109 ALA n 1 110 ASN n 1 111 LYS n 1 112 LYS n 1 113 SER n 1 114 GLU n 1 115 ALA n 1 116 ILE n 1 117 LYS n 1 118 SER n 1 119 ARG n 1 120 GLY n 1 121 GLY n 1 122 SER n 1 123 GLY n 1 124 GLY n 1 125 TRP n 1 126 SER n 1 127 HIS n 1 128 PRO n 1 129 GLN n 1 130 PHE n 1 131 GLU n 1 132 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 132 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene llmg_0323 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain MG1363 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lactococcus lactis subsp. cremoris MG1363' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 416870 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 DFF 'D-peptide linking' . 4-benzoyl-D-phenylalanine ? 'C16 H15 N O3' 269.295 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 I1A non-polymer . 'dimethyl 2-[[2-methyl-1-[(2-methylpropan-2-yl)oxycarbonyl]indol-3-yl]methyl]-2-prop-2-enyl-propanedioate' ? 'C23 H29 N O6' 415.479 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 GLY 2 1 ? ? ? A . n A 1 3 ALA 3 2 ? ? ? A . n A 1 4 GLU 4 3 ? ? ? A . n A 1 5 ILE 5 4 4 ILE ILE A . n A 1 6 PRO 6 5 5 PRO PRO A . n A 1 7 LYS 7 6 6 LYS LYS A . n A 1 8 GLU 8 7 7 GLU GLU A . n A 1 9 LEU 9 8 8 LEU LEU A . n A 1 10 LEU 10 9 9 LEU LEU A . n A 1 11 ARG 11 10 10 ARG ARG A . n A 1 12 ALA 12 11 11 ALA ALA A . n A 1 13 GLN 13 12 12 GLN GLN A . n A 1 14 THR 14 13 13 THR THR A . n A 1 15 ASN 15 14 14 ASN ASN A . n A 1 16 VAL 16 15 15 VAL VAL A . n A 1 17 ILE 17 16 16 ILE ILE A . n A 1 18 LEU 18 17 17 LEU LEU A . n A 1 19 LEU 19 18 18 LEU LEU A . n A 1 20 ASN 20 19 19 ASN ASN A . n A 1 21 VAL 21 20 20 VAL VAL A . n A 1 22 LEU 22 21 21 LEU LEU A . n A 1 23 LYS 23 22 22 LYS LYS A . n A 1 24 GLN 24 23 23 GLN GLN A . n A 1 25 GLY 25 24 24 GLY GLY A . n A 1 26 ASP 26 25 25 ASP ASP A . n A 1 27 ASN 27 26 26 ASN ASN A . n A 1 28 TYR 28 27 27 TYR TYR A . n A 1 29 VAL 29 28 28 VAL VAL A . n A 1 30 TYR 30 29 29 TYR TYR A . n A 1 31 GLY 31 30 30 GLY GLY A . n A 1 32 ILE 32 31 31 ILE ILE A . n A 1 33 ILE 33 32 32 ILE ILE A . n A 1 34 LYS 34 33 33 LYS LYS A . n A 1 35 GLN 35 34 34 GLN GLN A . n A 1 36 VAL 36 35 35 VAL VAL A . n A 1 37 LYS 37 36 36 LYS LYS A . n A 1 38 GLU 38 37 37 GLU GLU A . n A 1 39 ALA 39 38 38 ALA ALA A . n A 1 40 SER 40 39 39 SER SER A . n A 1 41 ASN 41 40 40 ASN ASN A . n A 1 42 GLY 42 41 41 GLY GLY A . n A 1 43 GLU 43 42 42 GLU GLU A . n A 1 44 MET 44 43 43 MET MET A . n A 1 45 GLU 45 44 44 GLU GLU A . n A 1 46 LEU 46 45 45 LEU LEU A . n A 1 47 ASN 47 46 46 ASN ASN A . n A 1 48 GLU 48 47 47 GLU GLU A . n A 1 49 ALA 49 48 48 ALA ALA A . n A 1 50 THR 50 49 49 THR THR A . n A 1 51 LEU 51 50 50 LEU LEU A . n A 1 52 TYR 52 51 51 TYR TYR A . n A 1 53 THR 53 52 52 THR THR A . n A 1 54 ILE 54 53 53 ILE ILE A . n A 1 55 PHE 55 54 54 PHE PHE A . n A 1 56 ASP 56 55 55 ASP ASP A . n A 1 57 ARG 57 56 56 ARG ARG A . n A 1 58 LEU 58 57 57 LEU LEU A . n A 1 59 GLU 59 58 58 GLU GLU A . n A 1 60 GLN 60 59 59 GLN GLN A . n A 1 61 ASP 61 60 60 ASP ASP A . n A 1 62 GLY 62 61 61 GLY GLY A . n A 1 63 ILE 63 62 62 ILE ILE A . n A 1 64 ILE 64 63 63 ILE ILE A . n A 1 65 SER 65 64 64 SER SER A . n A 1 66 SER 66 65 65 SER SER A . n A 1 67 TYR 67 66 66 TYR TYR A . n A 1 68 TRP 68 67 67 TRP TRP A . n A 1 69 GLY 69 68 68 GLY GLY A . n A 1 70 ASP 70 69 69 ASP ASP A . n A 1 71 GLU 71 70 70 GLU GLU A . n A 1 72 SER 72 71 71 SER SER A . n A 1 73 GLN 73 72 72 GLN GLN A . n A 1 74 GLY 74 73 73 GLY GLY A . n A 1 75 GLY 75 74 74 GLY GLY A . n A 1 76 ARG 76 75 75 ARG ARG A . n A 1 77 ARG 77 76 76 ARG ARG A . n A 1 78 LYS 78 77 77 LYS LYS A . n A 1 79 TYR 79 78 78 TYR TYR A . n A 1 80 TYR 80 79 79 TYR TYR A . n A 1 81 ARG 81 80 80 ARG ARG A . n A 1 82 LEU 82 81 81 LEU LEU A . n A 1 83 THR 83 82 82 THR THR A . n A 1 84 GLU 84 83 83 GLU GLU A . n A 1 85 ILE 85 84 84 ILE ILE A . n A 1 86 GLY 86 85 85 GLY GLY A . n A 1 87 HIS 87 86 86 HIS HIS A . n A 1 88 GLU 88 87 87 GLU GLU A . n A 1 89 ASN 89 88 88 ASN ASN A . n A 1 90 MET 90 89 89 MET MET A . n A 1 91 ARG 91 90 90 ARG ARG A . n A 1 92 LEU 92 91 91 LEU LEU A . n A 1 93 ALA 93 92 92 ALA ALA A . n A 1 94 DFF 94 93 93 DFF UNA A . n A 1 95 GLU 95 94 94 GLU GLU A . n A 1 96 SER 96 95 95 SER SER A . n A 1 97 LEU 97 96 96 LEU LEU A . n A 1 98 SER 98 97 97 SER SER A . n A 1 99 ARG 99 98 98 ARG ARG A . n A 1 100 VAL 100 99 99 VAL VAL A . n A 1 101 ASP 101 100 100 ASP ASP A . n A 1 102 LYS 102 101 101 LYS LYS A . n A 1 103 ILE 103 102 102 ILE ILE A . n A 1 104 ILE 104 103 103 ILE ILE A . n A 1 105 GLU 105 104 104 GLU GLU A . n A 1 106 ASN 106 105 105 ASN ASN A . n A 1 107 LEU 107 106 106 LEU LEU A . n A 1 108 GLU 108 107 107 GLU GLU A . n A 1 109 ALA 109 108 108 ALA ALA A . n A 1 110 ASN 110 109 109 ASN ASN A . n A 1 111 LYS 111 110 110 LYS LYS A . n A 1 112 LYS 112 111 111 LYS LYS A . n A 1 113 SER 113 112 112 SER SER A . n A 1 114 GLU 114 113 113 GLU GLU A . n A 1 115 ALA 115 114 114 ALA ALA A . n A 1 116 ILE 116 115 115 ILE ILE A . n A 1 117 LYS 117 116 116 LYS LYS A . n A 1 118 SER 118 117 ? ? ? A . n A 1 119 ARG 119 118 ? ? ? A . n A 1 120 GLY 120 119 ? ? ? A . n A 1 121 GLY 121 120 ? ? ? A . n A 1 122 SER 122 121 ? ? ? A . n A 1 123 GLY 123 122 ? ? ? A . n A 1 124 GLY 124 123 ? ? ? A . n A 1 125 TRP 125 124 ? ? ? A . n A 1 126 SER 126 125 ? ? ? A . n A 1 127 HIS 127 126 ? ? ? A . n A 1 128 PRO 128 127 ? ? ? A . n A 1 129 GLN 129 128 ? ? ? A . n A 1 130 PHE 130 129 ? ? ? A . n A 1 131 GLU 131 130 ? ? ? A . n A 1 132 LYS 132 131 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 I1A 1 301 301 I1A WYS A . C 3 HOH 1 401 11 HOH HOH A . C 3 HOH 2 402 8 HOH HOH A . C 3 HOH 3 403 4 HOH HOH A . C 3 HOH 4 404 1 HOH HOH A . C 3 HOH 5 405 10 HOH HOH A . C 3 HOH 6 406 6 HOH HOH A . C 3 HOH 7 407 3 HOH HOH A . C 3 HOH 8 408 5 HOH HOH A . C 3 HOH 9 409 2 HOH HOH A . C 3 HOH 10 410 9 HOH HOH A . C 3 HOH 11 411 7 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.16_3549 1 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7XUQ _cell.details ? _cell.formula_units_Z ? _cell.length_a 68.764 _cell.length_a_esd ? _cell.length_b 68.764 _cell.length_b_esd ? _cell.length_c 60.386 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 7XUQ _symmetry.cell_setting ? _symmetry.Int_Tables_number 153 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 1 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7XUQ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.71 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 54.66 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M MgCl2, 0.1 M Tris-HCl, pH 8.5, 25% (w/v) PEG3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-10-07 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97915 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL18U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97915 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL18U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7XUQ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.50 _reflns.d_resolution_low 59.5510 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5745 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20.1 _reflns.pdbx_Rmerge_I_obs 0.139 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 16.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.01 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.143 _reflns.pdbx_Rpim_I_all 0.032 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 2.50 _reflns_shell.d_res_low 2.60 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.0 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 640 _reflns_shell.percent_possible_all 99.5 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.955 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 21.2 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared 0.98 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 2.001 _reflns_shell.pdbx_Rpim_I_all 0.428 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.736 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 138.080 _refine.B_iso_mean 69.2381 _refine.B_iso_min 36.820 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7XUQ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.5000 _refine.ls_d_res_low 59.5510 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5736 _refine.ls_number_reflns_R_free 268 _refine.ls_number_reflns_R_work 5468 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.9800 _refine.ls_percent_reflns_R_free 4.6700 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2194 _refine.ls_R_factor_R_free 0.2441 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2180 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3F8F _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.7800 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1800 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.5000 _refine_hist.d_res_low 59.5510 _refine_hist.number_atoms_solvent 11 _refine_hist.number_atoms_total 965 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 113 _refine_hist.pdbx_B_iso_mean_ligand 65.91 _refine_hist.pdbx_B_iso_mean_solvent 55.47 _refine_hist.pdbx_number_atoms_protein 924 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 30 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.5001 3.1499 . . 143 2710 99.0000 . . . 0.3388 0.0000 0.3062 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1499 59.5510 . . 125 2758 99.0000 . . . 0.2164 0.0000 0.1932 . . . . . . . . . . . # _struct.entry_id 7XUQ _struct.title 'Crystal structure of Tpe3.0 complexed with N-Boc-3-alkenylindole' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7XUQ _struct_keywords.text 'triplet photoenzyme, photocatalysis, energy transfer, photocycloaddition, unnatural amino acid, PHOTOSYNTHESIS' _struct_keywords.pdbx_keywords PHOTOSYNTHESIS # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A2RI36_LACLM _struct_ref.pdbx_db_accession A2RI36 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AEIPKEMLRAQTNVILLNVLKQGDNYVYGIIKQVKEASNGEMELNEATLYTIFKRLEKDGIISSYWGDESQGGRRKYYRL TEIGHENMRLAFESWSRVDKIIENLEANKKSEAIK ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7XUQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 117 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A2RI36 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 116 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 116 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7XUQ MET A 1 ? UNP A2RI36 ? ? 'initiating methionine' 0 1 1 7XUQ GLY A 2 ? UNP A2RI36 ? ? 'expression tag' 1 2 1 7XUQ LEU A 9 ? UNP A2RI36 MET 8 'engineered mutation' 8 3 1 7XUQ ASP A 56 ? UNP A2RI36 LYS 55 'engineered mutation' 55 4 1 7XUQ GLN A 60 ? UNP A2RI36 LYS 59 'engineered mutation' 59 5 1 7XUQ DFF A 94 ? UNP A2RI36 PHE 93 conflict 93 6 1 7XUQ LEU A 97 ? UNP A2RI36 TRP 96 'engineered mutation' 96 7 1 7XUQ SER A 118 ? UNP A2RI36 ? ? 'expression tag' 117 8 1 7XUQ ARG A 119 ? UNP A2RI36 ? ? 'expression tag' 118 9 1 7XUQ GLY A 120 ? UNP A2RI36 ? ? 'expression tag' 119 10 1 7XUQ GLY A 121 ? UNP A2RI36 ? ? 'expression tag' 120 11 1 7XUQ SER A 122 ? UNP A2RI36 ? ? 'expression tag' 121 12 1 7XUQ GLY A 123 ? UNP A2RI36 ? ? 'expression tag' 122 13 1 7XUQ GLY A 124 ? UNP A2RI36 ? ? 'expression tag' 123 14 1 7XUQ TRP A 125 ? UNP A2RI36 ? ? 'expression tag' 124 15 1 7XUQ SER A 126 ? UNP A2RI36 ? ? 'expression tag' 125 16 1 7XUQ HIS A 127 ? UNP A2RI36 ? ? 'expression tag' 126 17 1 7XUQ PRO A 128 ? UNP A2RI36 ? ? 'expression tag' 127 18 1 7XUQ GLN A 129 ? UNP A2RI36 ? ? 'expression tag' 128 19 1 7XUQ PHE A 130 ? UNP A2RI36 ? ? 'expression tag' 129 20 1 7XUQ GLU A 131 ? UNP A2RI36 ? ? 'expression tag' 130 21 1 7XUQ LYS A 132 ? UNP A2RI36 ? ? 'expression tag' 131 22 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 8160 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 6 ? GLY A 25 ? PRO A 5 GLY A 24 1 ? 20 HELX_P HELX_P2 AA2 TYR A 28 ? SER A 40 ? TYR A 27 SER A 39 1 ? 13 HELX_P HELX_P3 AA3 ASN A 47 ? ASP A 61 ? ASN A 46 ASP A 60 1 ? 15 HELX_P HELX_P4 AA4 THR A 83 ? ILE A 116 ? THR A 82 ILE A 115 1 ? 34 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ALA 93 C ? ? ? 1_555 A DFF 94 N ? ? A ALA 92 A DFF 93 1_555 ? ? ? ? ? ? ? 1.431 ? ? covale2 covale both ? A DFF 94 C ? ? ? 1_555 A GLU 95 N ? ? A DFF 93 A GLU 94 1_555 ? ? ? ? ? ? ? 1.430 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 64 ? TRP A 68 ? ILE A 63 TRP A 67 AA1 2 LYS A 78 ? LEU A 82 ? LYS A 77 LEU A 81 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 67 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 66 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 79 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 78 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 O A ALA 92 ? ? C A ALA 92 ? ? N A DFF 93 ? ? 110.13 122.70 -12.57 1.60 Y 2 1 O A DFF 93 ? ? C A DFF 93 ? ? N A GLU 94 ? ? 134.59 122.70 11.89 1.60 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 75 ? ? 61.88 87.15 2 1 DFF A 93 ? ? 39.75 -104.26 3 1 SER A 112 ? ? -67.29 1.00 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 ALA _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 92 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 DFF _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 93 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 105.22 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 408 ? C HOH . 2 1 A HOH 409 ? C HOH . # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -9.9601 _pdbx_refine_tls.origin_y 16.9460 _pdbx_refine_tls.origin_z -8.8075 _pdbx_refine_tls.T[1][1] 0.2683 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.1182 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0276 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.7761 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] -0.0482 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.3850 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 5.3705 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -2.4770 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -1.5359 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 2.4335 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.4472 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 1.6086 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.1643 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.2444 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.1606 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0527 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.1198 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.2114 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] -0.0612 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.1330 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.0688 _pdbx_refine_tls.S[3][3]_esd ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 4 ? ? ? A 116 ? ? all 2 'X-RAY DIFFRACTION' 1 ? ? A 301 ? ? ? A 301 ? ? all 3 'X-RAY DIFFRACTION' 1 ? ? S 1 ? ? ? S 11 ? ? all # _pdbx_entry_details.entry_id 7XUQ _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A GLY 1 ? A GLY 2 3 1 Y 1 A ALA 2 ? A ALA 3 4 1 Y 1 A GLU 3 ? A GLU 4 5 1 Y 1 A SER 117 ? A SER 118 6 1 Y 1 A ARG 118 ? A ARG 119 7 1 Y 1 A GLY 119 ? A GLY 120 8 1 Y 1 A GLY 120 ? A GLY 121 9 1 Y 1 A SER 121 ? A SER 122 10 1 Y 1 A GLY 122 ? A GLY 123 11 1 Y 1 A GLY 123 ? A GLY 124 12 1 Y 1 A TRP 124 ? A TRP 125 13 1 Y 1 A SER 125 ? A SER 126 14 1 Y 1 A HIS 126 ? A HIS 127 15 1 Y 1 A PRO 127 ? A PRO 128 16 1 Y 1 A GLN 128 ? A GLN 129 17 1 Y 1 A PHE 129 ? A PHE 130 18 1 Y 1 A GLU 130 ? A GLU 131 19 1 Y 1 A LYS 131 ? A LYS 132 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 DFF CZ C Y N 74 DFF C7 C N N 75 DFF C5 C Y N 76 DFF CD1 C Y N 77 DFF CE1 C Y N 78 DFF C2 C Y N 79 DFF C1 C Y N 80 DFF O1 O N N 81 DFF O O N N 82 DFF C3 C Y N 83 DFF C4 C Y N 84 DFF N N N N 85 DFF C6 C Y N 86 DFF CG C Y N 87 DFF CD2 C Y N 88 DFF CE2 C Y N 89 DFF CB C N N 90 DFF CA C N R 91 DFF C C N N 92 DFF H1 H N N 93 DFF H12 H N N 94 DFF H3 H N N 95 DFF H5 H N N 96 DFF H6 H N N 97 DFF H8 H N N 98 DFF H H N N 99 DFF H10 H N N 100 DFF H13 H N N 101 DFF H14 H N N 102 DFF H15 H N N 103 DFF H16 H N N 104 DFF HA H N N 105 DFF OXT O N N 106 DFF HXT H N N 107 DFF H2 H N N 108 GLN N N N N 109 GLN CA C N S 110 GLN C C N N 111 GLN O O N N 112 GLN CB C N N 113 GLN CG C N N 114 GLN CD C N N 115 GLN OE1 O N N 116 GLN NE2 N N N 117 GLN OXT O N N 118 GLN H H N N 119 GLN H2 H N N 120 GLN HA H N N 121 GLN HB2 H N N 122 GLN HB3 H N N 123 GLN HG2 H N N 124 GLN HG3 H N N 125 GLN HE21 H N N 126 GLN HE22 H N N 127 GLN HXT H N N 128 GLU N N N N 129 GLU CA C N S 130 GLU C C N N 131 GLU O O N N 132 GLU CB C N N 133 GLU CG C N N 134 GLU CD C N N 135 GLU OE1 O N N 136 GLU OE2 O N N 137 GLU OXT O N N 138 GLU H H N N 139 GLU H2 H N N 140 GLU HA H N N 141 GLU HB2 H N N 142 GLU HB3 H N N 143 GLU HG2 H N N 144 GLU HG3 H N N 145 GLU HE2 H N N 146 GLU HXT H N N 147 GLY N N N N 148 GLY CA C N N 149 GLY C C N N 150 GLY O O N N 151 GLY OXT O N N 152 GLY H H N N 153 GLY H2 H N N 154 GLY HA2 H N N 155 GLY HA3 H N N 156 GLY HXT H N N 157 HIS N N N N 158 HIS CA C N S 159 HIS C C N N 160 HIS O O N N 161 HIS CB C N N 162 HIS CG C Y N 163 HIS ND1 N Y N 164 HIS CD2 C Y N 165 HIS CE1 C Y N 166 HIS NE2 N Y N 167 HIS OXT O N N 168 HIS H H N N 169 HIS H2 H N N 170 HIS HA H N N 171 HIS HB2 H N N 172 HIS HB3 H N N 173 HIS HD1 H N N 174 HIS HD2 H N N 175 HIS HE1 H N N 176 HIS HE2 H N N 177 HIS HXT H N N 178 HOH O O N N 179 HOH H1 H N N 180 HOH H2 H N N 181 I1A C01 C Y N 182 I1A C02 C Y N 183 I1A C03 C Y N 184 I1A C04 C Y N 185 I1A C05 C Y N 186 I1A C06 C Y N 187 I1A C08 C Y N 188 I1A C09 C Y N 189 I1A C10 C N N 190 I1A C11 C N N 191 I1A C12 C N N 192 I1A C13 C N N 193 I1A C14 C N N 194 I1A C15 C N N 195 I1A C16 C N N 196 I1A C19 C N N 197 I1A C20 C N N 198 I1A C21 C N N 199 I1A C22 C N N 200 I1A C23 C N N 201 I1A C26 C N N 202 I1A C27 C N N 203 I1A C30 C N N 204 I1A N07 N Y N 205 I1A O17 O N N 206 I1A O18 O N N 207 I1A O24 O N N 208 I1A O25 O N N 209 I1A O28 O N N 210 I1A O29 O N N 211 I1A H1 H N N 212 I1A H2 H N N 213 I1A H3 H N N 214 I1A H4 H N N 215 I1A H5 H N N 216 I1A H6 H N N 217 I1A H7 H N N 218 I1A H8 H N N 219 I1A H9 H N N 220 I1A H10 H N N 221 I1A H11 H N N 222 I1A H12 H N N 223 I1A H13 H N N 224 I1A H14 H N N 225 I1A H15 H N N 226 I1A H16 H N N 227 I1A H17 H N N 228 I1A H18 H N N 229 I1A H19 H N N 230 I1A H20 H N N 231 I1A H21 H N N 232 I1A H22 H N N 233 I1A H23 H N N 234 I1A H24 H N N 235 I1A H25 H N N 236 I1A H26 H N N 237 I1A H27 H N N 238 I1A H28 H N N 239 I1A H29 H N N 240 ILE N N N N 241 ILE CA C N S 242 ILE C C N N 243 ILE O O N N 244 ILE CB C N S 245 ILE CG1 C N N 246 ILE CG2 C N N 247 ILE CD1 C N N 248 ILE OXT O N N 249 ILE H H N N 250 ILE H2 H N N 251 ILE HA H N N 252 ILE HB H N N 253 ILE HG12 H N N 254 ILE HG13 H N N 255 ILE HG21 H N N 256 ILE HG22 H N N 257 ILE HG23 H N N 258 ILE HD11 H N N 259 ILE HD12 H N N 260 ILE HD13 H N N 261 ILE HXT H N N 262 LEU N N N N 263 LEU CA C N S 264 LEU C C N N 265 LEU O O N N 266 LEU CB C N N 267 LEU CG C N N 268 LEU CD1 C N N 269 LEU CD2 C N N 270 LEU OXT O N N 271 LEU H H N N 272 LEU H2 H N N 273 LEU HA H N N 274 LEU HB2 H N N 275 LEU HB3 H N N 276 LEU HG H N N 277 LEU HD11 H N N 278 LEU HD12 H N N 279 LEU HD13 H N N 280 LEU HD21 H N N 281 LEU HD22 H N N 282 LEU HD23 H N N 283 LEU HXT H N N 284 LYS N N N N 285 LYS CA C N S 286 LYS C C N N 287 LYS O O N N 288 LYS CB C N N 289 LYS CG C N N 290 LYS CD C N N 291 LYS CE C N N 292 LYS NZ N N N 293 LYS OXT O N N 294 LYS H H N N 295 LYS H2 H N N 296 LYS HA H N N 297 LYS HB2 H N N 298 LYS HB3 H N N 299 LYS HG2 H N N 300 LYS HG3 H N N 301 LYS HD2 H N N 302 LYS HD3 H N N 303 LYS HE2 H N N 304 LYS HE3 H N N 305 LYS HZ1 H N N 306 LYS HZ2 H N N 307 LYS HZ3 H N N 308 LYS HXT H N N 309 MET N N N N 310 MET CA C N S 311 MET C C N N 312 MET O O N N 313 MET CB C N N 314 MET CG C N N 315 MET SD S N N 316 MET CE C N N 317 MET OXT O N N 318 MET H H N N 319 MET H2 H N N 320 MET HA H N N 321 MET HB2 H N N 322 MET HB3 H N N 323 MET HG2 H N N 324 MET HG3 H N N 325 MET HE1 H N N 326 MET HE2 H N N 327 MET HE3 H N N 328 MET HXT H N N 329 PHE N N N N 330 PHE CA C N S 331 PHE C C N N 332 PHE O O N N 333 PHE CB C N N 334 PHE CG C Y N 335 PHE CD1 C Y N 336 PHE CD2 C Y N 337 PHE CE1 C Y N 338 PHE CE2 C Y N 339 PHE CZ C Y N 340 PHE OXT O N N 341 PHE H H N N 342 PHE H2 H N N 343 PHE HA H N N 344 PHE HB2 H N N 345 PHE HB3 H N N 346 PHE HD1 H N N 347 PHE HD2 H N N 348 PHE HE1 H N N 349 PHE HE2 H N N 350 PHE HZ H N N 351 PHE HXT H N N 352 PRO N N N N 353 PRO CA C N S 354 PRO C C N N 355 PRO O O N N 356 PRO CB C N N 357 PRO CG C N N 358 PRO CD C N N 359 PRO OXT O N N 360 PRO H H N N 361 PRO HA H N N 362 PRO HB2 H N N 363 PRO HB3 H N N 364 PRO HG2 H N N 365 PRO HG3 H N N 366 PRO HD2 H N N 367 PRO HD3 H N N 368 PRO HXT H N N 369 SER N N N N 370 SER CA C N S 371 SER C C N N 372 SER O O N N 373 SER CB C N N 374 SER OG O N N 375 SER OXT O N N 376 SER H H N N 377 SER H2 H N N 378 SER HA H N N 379 SER HB2 H N N 380 SER HB3 H N N 381 SER HG H N N 382 SER HXT H N N 383 THR N N N N 384 THR CA C N S 385 THR C C N N 386 THR O O N N 387 THR CB C N R 388 THR OG1 O N N 389 THR CG2 C N N 390 THR OXT O N N 391 THR H H N N 392 THR H2 H N N 393 THR HA H N N 394 THR HB H N N 395 THR HG1 H N N 396 THR HG21 H N N 397 THR HG22 H N N 398 THR HG23 H N N 399 THR HXT H N N 400 TRP N N N N 401 TRP CA C N S 402 TRP C C N N 403 TRP O O N N 404 TRP CB C N N 405 TRP CG C Y N 406 TRP CD1 C Y N 407 TRP CD2 C Y N 408 TRP NE1 N Y N 409 TRP CE2 C Y N 410 TRP CE3 C Y N 411 TRP CZ2 C Y N 412 TRP CZ3 C Y N 413 TRP CH2 C Y N 414 TRP OXT O N N 415 TRP H H N N 416 TRP H2 H N N 417 TRP HA H N N 418 TRP HB2 H N N 419 TRP HB3 H N N 420 TRP HD1 H N N 421 TRP HE1 H N N 422 TRP HE3 H N N 423 TRP HZ2 H N N 424 TRP HZ3 H N N 425 TRP HH2 H N N 426 TRP HXT H N N 427 TYR N N N N 428 TYR CA C N S 429 TYR C C N N 430 TYR O O N N 431 TYR CB C N N 432 TYR CG C Y N 433 TYR CD1 C Y N 434 TYR CD2 C Y N 435 TYR CE1 C Y N 436 TYR CE2 C Y N 437 TYR CZ C Y N 438 TYR OH O N N 439 TYR OXT O N N 440 TYR H H N N 441 TYR H2 H N N 442 TYR HA H N N 443 TYR HB2 H N N 444 TYR HB3 H N N 445 TYR HD1 H N N 446 TYR HD2 H N N 447 TYR HE1 H N N 448 TYR HE2 H N N 449 TYR HH H N N 450 TYR HXT H N N 451 VAL N N N N 452 VAL CA C N S 453 VAL C C N N 454 VAL O O N N 455 VAL CB C N N 456 VAL CG1 C N N 457 VAL CG2 C N N 458 VAL OXT O N N 459 VAL H H N N 460 VAL H2 H N N 461 VAL HA H N N 462 VAL HB H N N 463 VAL HG11 H N N 464 VAL HG12 H N N 465 VAL HG13 H N N 466 VAL HG21 H N N 467 VAL HG22 H N N 468 VAL HG23 H N N 469 VAL HXT H N N 470 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 DFF O C doub N N 70 DFF C CA sing N N 71 DFF N CA sing N N 72 DFF CA CB sing N N 73 DFF CB CG sing N N 74 DFF CG CD2 doub Y N 75 DFF CG CD1 sing Y N 76 DFF CD2 CE2 sing Y N 77 DFF CD1 CE1 doub Y N 78 DFF CE2 CZ doub Y N 79 DFF CE1 CZ sing Y N 80 DFF CZ C7 sing N N 81 DFF C7 O1 doub N N 82 DFF C7 C4 sing N N 83 DFF C3 C4 doub Y N 84 DFF C3 C2 sing Y N 85 DFF C4 C5 sing Y N 86 DFF C2 C1 doub Y N 87 DFF C5 C6 doub Y N 88 DFF C1 C6 sing Y N 89 DFF C5 H1 sing N N 90 DFF CD1 H12 sing N N 91 DFF CE1 H3 sing N N 92 DFF C2 H5 sing N N 93 DFF C1 H6 sing N N 94 DFF C3 H8 sing N N 95 DFF N H sing N N 96 DFF C6 H10 sing N N 97 DFF CD2 H13 sing N N 98 DFF CE2 H14 sing N N 99 DFF CB H15 sing N N 100 DFF CB H16 sing N N 101 DFF CA HA sing N N 102 DFF C OXT sing N N 103 DFF OXT HXT sing N N 104 DFF N H2 sing N N 105 GLN N CA sing N N 106 GLN N H sing N N 107 GLN N H2 sing N N 108 GLN CA C sing N N 109 GLN CA CB sing N N 110 GLN CA HA sing N N 111 GLN C O doub N N 112 GLN C OXT sing N N 113 GLN CB CG sing N N 114 GLN CB HB2 sing N N 115 GLN CB HB3 sing N N 116 GLN CG CD sing N N 117 GLN CG HG2 sing N N 118 GLN CG HG3 sing N N 119 GLN CD OE1 doub N N 120 GLN CD NE2 sing N N 121 GLN NE2 HE21 sing N N 122 GLN NE2 HE22 sing N N 123 GLN OXT HXT sing N N 124 GLU N CA sing N N 125 GLU N H sing N N 126 GLU N H2 sing N N 127 GLU CA C sing N N 128 GLU CA CB sing N N 129 GLU CA HA sing N N 130 GLU C O doub N N 131 GLU C OXT sing N N 132 GLU CB CG sing N N 133 GLU CB HB2 sing N N 134 GLU CB HB3 sing N N 135 GLU CG CD sing N N 136 GLU CG HG2 sing N N 137 GLU CG HG3 sing N N 138 GLU CD OE1 doub N N 139 GLU CD OE2 sing N N 140 GLU OE2 HE2 sing N N 141 GLU OXT HXT sing N N 142 GLY N CA sing N N 143 GLY N H sing N N 144 GLY N H2 sing N N 145 GLY CA C sing N N 146 GLY CA HA2 sing N N 147 GLY CA HA3 sing N N 148 GLY C O doub N N 149 GLY C OXT sing N N 150 GLY OXT HXT sing N N 151 HIS N CA sing N N 152 HIS N H sing N N 153 HIS N H2 sing N N 154 HIS CA C sing N N 155 HIS CA CB sing N N 156 HIS CA HA sing N N 157 HIS C O doub N N 158 HIS C OXT sing N N 159 HIS CB CG sing N N 160 HIS CB HB2 sing N N 161 HIS CB HB3 sing N N 162 HIS CG ND1 sing Y N 163 HIS CG CD2 doub Y N 164 HIS ND1 CE1 doub Y N 165 HIS ND1 HD1 sing N N 166 HIS CD2 NE2 sing Y N 167 HIS CD2 HD2 sing N N 168 HIS CE1 NE2 sing Y N 169 HIS CE1 HE1 sing N N 170 HIS NE2 HE2 sing N N 171 HIS OXT HXT sing N N 172 HOH O H1 sing N N 173 HOH O H2 sing N N 174 I1A C30 O29 sing N N 175 I1A O28 C27 doub N N 176 I1A O29 C27 sing N N 177 I1A C27 C12 sing N N 178 I1A C14 C15 doub N N 179 I1A C14 C13 sing N N 180 I1A C11 C12 sing N N 181 I1A C11 C09 sing N N 182 I1A C12 C13 sing N N 183 I1A C12 C23 sing N N 184 I1A C06 C01 doub Y N 185 I1A C06 C05 sing Y N 186 I1A C26 O25 sing N N 187 I1A O25 C23 sing N N 188 I1A C01 C02 sing Y N 189 I1A C23 O24 doub N N 190 I1A C09 C05 sing Y N 191 I1A C09 C08 doub Y N 192 I1A C05 C04 doub Y N 193 I1A C02 C03 doub Y N 194 I1A C08 C10 sing N N 195 I1A C08 N07 sing Y N 196 I1A C04 C03 sing Y N 197 I1A C04 N07 sing Y N 198 I1A N07 C16 sing N N 199 I1A C16 O18 doub N N 200 I1A C16 O17 sing N N 201 I1A O17 C19 sing N N 202 I1A C19 C22 sing N N 203 I1A C19 C21 sing N N 204 I1A C19 C20 sing N N 205 I1A C01 H1 sing N N 206 I1A C02 H2 sing N N 207 I1A C03 H3 sing N N 208 I1A C06 H4 sing N N 209 I1A C10 H5 sing N N 210 I1A C10 H6 sing N N 211 I1A C10 H7 sing N N 212 I1A C11 H8 sing N N 213 I1A C11 H9 sing N N 214 I1A C13 H10 sing N N 215 I1A C13 H11 sing N N 216 I1A C14 H12 sing N N 217 I1A C15 H13 sing N N 218 I1A C15 H14 sing N N 219 I1A C20 H15 sing N N 220 I1A C20 H16 sing N N 221 I1A C20 H17 sing N N 222 I1A C21 H18 sing N N 223 I1A C21 H19 sing N N 224 I1A C21 H20 sing N N 225 I1A C22 H21 sing N N 226 I1A C22 H22 sing N N 227 I1A C22 H23 sing N N 228 I1A C26 H24 sing N N 229 I1A C26 H25 sing N N 230 I1A C26 H26 sing N N 231 I1A C30 H27 sing N N 232 I1A C30 H28 sing N N 233 I1A C30 H29 sing N N 234 ILE N CA sing N N 235 ILE N H sing N N 236 ILE N H2 sing N N 237 ILE CA C sing N N 238 ILE CA CB sing N N 239 ILE CA HA sing N N 240 ILE C O doub N N 241 ILE C OXT sing N N 242 ILE CB CG1 sing N N 243 ILE CB CG2 sing N N 244 ILE CB HB sing N N 245 ILE CG1 CD1 sing N N 246 ILE CG1 HG12 sing N N 247 ILE CG1 HG13 sing N N 248 ILE CG2 HG21 sing N N 249 ILE CG2 HG22 sing N N 250 ILE CG2 HG23 sing N N 251 ILE CD1 HD11 sing N N 252 ILE CD1 HD12 sing N N 253 ILE CD1 HD13 sing N N 254 ILE OXT HXT sing N N 255 LEU N CA sing N N 256 LEU N H sing N N 257 LEU N H2 sing N N 258 LEU CA C sing N N 259 LEU CA CB sing N N 260 LEU CA HA sing N N 261 LEU C O doub N N 262 LEU C OXT sing N N 263 LEU CB CG sing N N 264 LEU CB HB2 sing N N 265 LEU CB HB3 sing N N 266 LEU CG CD1 sing N N 267 LEU CG CD2 sing N N 268 LEU CG HG sing N N 269 LEU CD1 HD11 sing N N 270 LEU CD1 HD12 sing N N 271 LEU CD1 HD13 sing N N 272 LEU CD2 HD21 sing N N 273 LEU CD2 HD22 sing N N 274 LEU CD2 HD23 sing N N 275 LEU OXT HXT sing N N 276 LYS N CA sing N N 277 LYS N H sing N N 278 LYS N H2 sing N N 279 LYS CA C sing N N 280 LYS CA CB sing N N 281 LYS CA HA sing N N 282 LYS C O doub N N 283 LYS C OXT sing N N 284 LYS CB CG sing N N 285 LYS CB HB2 sing N N 286 LYS CB HB3 sing N N 287 LYS CG CD sing N N 288 LYS CG HG2 sing N N 289 LYS CG HG3 sing N N 290 LYS CD CE sing N N 291 LYS CD HD2 sing N N 292 LYS CD HD3 sing N N 293 LYS CE NZ sing N N 294 LYS CE HE2 sing N N 295 LYS CE HE3 sing N N 296 LYS NZ HZ1 sing N N 297 LYS NZ HZ2 sing N N 298 LYS NZ HZ3 sing N N 299 LYS OXT HXT sing N N 300 MET N CA sing N N 301 MET N H sing N N 302 MET N H2 sing N N 303 MET CA C sing N N 304 MET CA CB sing N N 305 MET CA HA sing N N 306 MET C O doub N N 307 MET C OXT sing N N 308 MET CB CG sing N N 309 MET CB HB2 sing N N 310 MET CB HB3 sing N N 311 MET CG SD sing N N 312 MET CG HG2 sing N N 313 MET CG HG3 sing N N 314 MET SD CE sing N N 315 MET CE HE1 sing N N 316 MET CE HE2 sing N N 317 MET CE HE3 sing N N 318 MET OXT HXT sing N N 319 PHE N CA sing N N 320 PHE N H sing N N 321 PHE N H2 sing N N 322 PHE CA C sing N N 323 PHE CA CB sing N N 324 PHE CA HA sing N N 325 PHE C O doub N N 326 PHE C OXT sing N N 327 PHE CB CG sing N N 328 PHE CB HB2 sing N N 329 PHE CB HB3 sing N N 330 PHE CG CD1 doub Y N 331 PHE CG CD2 sing Y N 332 PHE CD1 CE1 sing Y N 333 PHE CD1 HD1 sing N N 334 PHE CD2 CE2 doub Y N 335 PHE CD2 HD2 sing N N 336 PHE CE1 CZ doub Y N 337 PHE CE1 HE1 sing N N 338 PHE CE2 CZ sing Y N 339 PHE CE2 HE2 sing N N 340 PHE CZ HZ sing N N 341 PHE OXT HXT sing N N 342 PRO N CA sing N N 343 PRO N CD sing N N 344 PRO N H sing N N 345 PRO CA C sing N N 346 PRO CA CB sing N N 347 PRO CA HA sing N N 348 PRO C O doub N N 349 PRO C OXT sing N N 350 PRO CB CG sing N N 351 PRO CB HB2 sing N N 352 PRO CB HB3 sing N N 353 PRO CG CD sing N N 354 PRO CG HG2 sing N N 355 PRO CG HG3 sing N N 356 PRO CD HD2 sing N N 357 PRO CD HD3 sing N N 358 PRO OXT HXT sing N N 359 SER N CA sing N N 360 SER N H sing N N 361 SER N H2 sing N N 362 SER CA C sing N N 363 SER CA CB sing N N 364 SER CA HA sing N N 365 SER C O doub N N 366 SER C OXT sing N N 367 SER CB OG sing N N 368 SER CB HB2 sing N N 369 SER CB HB3 sing N N 370 SER OG HG sing N N 371 SER OXT HXT sing N N 372 THR N CA sing N N 373 THR N H sing N N 374 THR N H2 sing N N 375 THR CA C sing N N 376 THR CA CB sing N N 377 THR CA HA sing N N 378 THR C O doub N N 379 THR C OXT sing N N 380 THR CB OG1 sing N N 381 THR CB CG2 sing N N 382 THR CB HB sing N N 383 THR OG1 HG1 sing N N 384 THR CG2 HG21 sing N N 385 THR CG2 HG22 sing N N 386 THR CG2 HG23 sing N N 387 THR OXT HXT sing N N 388 TRP N CA sing N N 389 TRP N H sing N N 390 TRP N H2 sing N N 391 TRP CA C sing N N 392 TRP CA CB sing N N 393 TRP CA HA sing N N 394 TRP C O doub N N 395 TRP C OXT sing N N 396 TRP CB CG sing N N 397 TRP CB HB2 sing N N 398 TRP CB HB3 sing N N 399 TRP CG CD1 doub Y N 400 TRP CG CD2 sing Y N 401 TRP CD1 NE1 sing Y N 402 TRP CD1 HD1 sing N N 403 TRP CD2 CE2 doub Y N 404 TRP CD2 CE3 sing Y N 405 TRP NE1 CE2 sing Y N 406 TRP NE1 HE1 sing N N 407 TRP CE2 CZ2 sing Y N 408 TRP CE3 CZ3 doub Y N 409 TRP CE3 HE3 sing N N 410 TRP CZ2 CH2 doub Y N 411 TRP CZ2 HZ2 sing N N 412 TRP CZ3 CH2 sing Y N 413 TRP CZ3 HZ3 sing N N 414 TRP CH2 HH2 sing N N 415 TRP OXT HXT sing N N 416 TYR N CA sing N N 417 TYR N H sing N N 418 TYR N H2 sing N N 419 TYR CA C sing N N 420 TYR CA CB sing N N 421 TYR CA HA sing N N 422 TYR C O doub N N 423 TYR C OXT sing N N 424 TYR CB CG sing N N 425 TYR CB HB2 sing N N 426 TYR CB HB3 sing N N 427 TYR CG CD1 doub Y N 428 TYR CG CD2 sing Y N 429 TYR CD1 CE1 sing Y N 430 TYR CD1 HD1 sing N N 431 TYR CD2 CE2 doub Y N 432 TYR CD2 HD2 sing N N 433 TYR CE1 CZ doub Y N 434 TYR CE1 HE1 sing N N 435 TYR CE2 CZ sing Y N 436 TYR CE2 HE2 sing N N 437 TYR CZ OH sing N N 438 TYR OH HH sing N N 439 TYR OXT HXT sing N N 440 VAL N CA sing N N 441 VAL N H sing N N 442 VAL N H2 sing N N 443 VAL CA C sing N N 444 VAL CA CB sing N N 445 VAL CA HA sing N N 446 VAL C O doub N N 447 VAL C OXT sing N N 448 VAL CB CG1 sing N N 449 VAL CB CG2 sing N N 450 VAL CB HB sing N N 451 VAL CG1 HG11 sing N N 452 VAL CG1 HG12 sing N N 453 VAL CG1 HG13 sing N N 454 VAL CG2 HG21 sing N N 455 VAL CG2 HG22 sing N N 456 VAL CG2 HG23 sing N N 457 VAL OXT HXT sing N N 458 # _pdbx_audit_support.funding_organization 'National Natural Science Foundation of China (NSFC)' _pdbx_audit_support.country China _pdbx_audit_support.grant_number 21807088 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 DFF ? ? DFF ? ? 'SUBJECT OF INVESTIGATION' ? 2 I1A ? ? I1A ? ? 'SUBJECT OF INVESTIGATION' ? # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3F8F _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 7XUQ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014542 _atom_sites.fract_transf_matrix[1][2] 0.008396 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016792 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016560 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ # loop_ #