data_7Y1P # _entry.id 7Y1P # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7Y1P pdb_00007y1p 10.2210/pdb7y1p/pdb WWPDB D_1300030093 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7Y1P _pdbx_database_status.recvd_initial_deposition_date 2022-06-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'He, Z.' 1 ? 'Yuchi, Z.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'CRYSTAL STRUCTURE OF THE RGS-HOMOLOGOUS DOMAIN OF AXIN IN COMPLEX WITH LZ-22Na' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'He, Z.' 1 ? primary 'Yuchi, Z.' 2 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7Y1P _cell.details ? _cell.formula_units_Z ? _cell.length_a 155.343 _cell.length_a_esd ? _cell.length_b 155.343 _cell.length_b_esd ? _cell.length_c 107.061 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 32 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 7Y1P _symmetry.cell_setting ? _symmetry.Int_Tables_number 79 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 4' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Axin-1 16794.104 4 ? ? 'RGS-homologous domain' ? 2 non-polymer syn '(2~{Z},4~{Z})-2-methyl-5-(8-oxidanyldibenzofuran-4-yl)penta-2,4-dienal' 278.302 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Axis inhibition protein 1,hAxin' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACTGFRKLEPCDSNEEKRLKLARAIYRKYILDNN GIVSRQTKPATKSFIKGCIMKQLIDPAMFDQAQTEIQATMEENTYPSFLKSDIYLEYTRTGSESPKV ; _entity_poly.pdbx_seq_one_letter_code_can ;GSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACTGFRKLEPCDSNEEKRLKLARAIYRKYILDNN GIVSRQTKPATKSFIKGCIMKQLIDPAMFDQAQTEIQATMEENTYPSFLKSDIYLEYTRTGSESPKV ; _entity_poly.pdbx_strand_id A,B,C,D _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ALA n 1 4 SER n 1 5 PRO n 1 6 THR n 1 7 PRO n 1 8 PRO n 1 9 TYR n 1 10 LEU n 1 11 LYS n 1 12 TRP n 1 13 ALA n 1 14 GLU n 1 15 SER n 1 16 LEU n 1 17 HIS n 1 18 SER n 1 19 LEU n 1 20 LEU n 1 21 ASP n 1 22 ASP n 1 23 GLN n 1 24 ASP n 1 25 GLY n 1 26 ILE n 1 27 SER n 1 28 LEU n 1 29 PHE n 1 30 ARG n 1 31 THR n 1 32 PHE n 1 33 LEU n 1 34 LYS n 1 35 GLN n 1 36 GLU n 1 37 GLY n 1 38 CYS n 1 39 ALA n 1 40 ASP n 1 41 LEU n 1 42 LEU n 1 43 ASP n 1 44 PHE n 1 45 TRP n 1 46 PHE n 1 47 ALA n 1 48 CYS n 1 49 THR n 1 50 GLY n 1 51 PHE n 1 52 ARG n 1 53 LYS n 1 54 LEU n 1 55 GLU n 1 56 PRO n 1 57 CYS n 1 58 ASP n 1 59 SER n 1 60 ASN n 1 61 GLU n 1 62 GLU n 1 63 LYS n 1 64 ARG n 1 65 LEU n 1 66 LYS n 1 67 LEU n 1 68 ALA n 1 69 ARG n 1 70 ALA n 1 71 ILE n 1 72 TYR n 1 73 ARG n 1 74 LYS n 1 75 TYR n 1 76 ILE n 1 77 LEU n 1 78 ASP n 1 79 ASN n 1 80 ASN n 1 81 GLY n 1 82 ILE n 1 83 VAL n 1 84 SER n 1 85 ARG n 1 86 GLN n 1 87 THR n 1 88 LYS n 1 89 PRO n 1 90 ALA n 1 91 THR n 1 92 LYS n 1 93 SER n 1 94 PHE n 1 95 ILE n 1 96 LYS n 1 97 GLY n 1 98 CYS n 1 99 ILE n 1 100 MET n 1 101 LYS n 1 102 GLN n 1 103 LEU n 1 104 ILE n 1 105 ASP n 1 106 PRO n 1 107 ALA n 1 108 MET n 1 109 PHE n 1 110 ASP n 1 111 GLN n 1 112 ALA n 1 113 GLN n 1 114 THR n 1 115 GLU n 1 116 ILE n 1 117 GLN n 1 118 ALA n 1 119 THR n 1 120 MET n 1 121 GLU n 1 122 GLU n 1 123 ASN n 1 124 THR n 1 125 TYR n 1 126 PRO n 1 127 SER n 1 128 PHE n 1 129 LEU n 1 130 LYS n 1 131 SER n 1 132 ASP n 1 133 ILE n 1 134 TYR n 1 135 LEU n 1 136 GLU n 1 137 TYR n 1 138 THR n 1 139 ARG n 1 140 THR n 1 141 GLY n 1 142 SER n 1 143 GLU n 1 144 SER n 1 145 PRO n 1 146 LYS n 1 147 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 147 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'AXIN1, AXIN' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AXIN1_HUMAN _struct_ref.pdbx_db_accession O15169 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACTGFRKLEPCDSNEEKRLKLARAIYRKYILDNN GIVSRQTKPATKSFIKGCIMKQLIDPAMFDQAQTEIQATMEENTYPSFLKSDIYLEYTRTGSESPKV ; _struct_ref.pdbx_align_begin 74 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 7Y1P A 1 ? 147 ? O15169 74 ? 220 ? 74 220 2 1 7Y1P B 1 ? 147 ? O15169 74 ? 220 ? 74 220 3 1 7Y1P C 1 ? 147 ? O15169 74 ? 220 ? 74 220 4 1 7Y1P D 1 ? 147 ? O15169 74 ? 220 ? 74 220 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 I5L non-polymer . '(2~{Z},4~{Z})-2-methyl-5-(8-oxidanyldibenzofuran-4-yl)penta-2,4-dienal' ? 'C18 H14 O3' 278.302 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7Y1P _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.81 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 74.41 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.4 M sodium malonate pH 7.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 193.15 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-11-15 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL18U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9792 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL18U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7Y1P _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.600 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 39114 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.000 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.800 _reflns.pdbx_Rmerge_I_obs 0.100 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 4.700 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.584 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.108 _reflns.pdbx_Rpim_I_all 0.041 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 265978 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.600 2.640 ? ? ? ? ? ? 1950 100.000 ? ? ? ? 0.895 ? ? ? ? ? ? ? ? 6.800 ? 0.447 ? ? 0.969 0.369 ? 1 1 0.768 ? ? ? ? ? ? ? ? ? ? 2.640 2.690 ? ? ? ? ? ? 1957 100.000 ? ? ? ? 0.707 ? ? ? ? ? ? ? ? 6.700 ? 0.458 ? ? 0.767 0.294 ? 2 1 0.841 ? ? ? ? ? ? ? ? ? ? 2.690 2.740 ? ? ? ? ? ? 1929 99.900 ? ? ? ? 0.620 ? ? ? ? ? ? ? ? 6.600 ? 0.449 ? ? 0.672 0.258 ? 3 1 0.833 ? ? ? ? ? ? ? ? ? ? 2.740 2.800 ? ? ? ? ? ? 1921 100.000 ? ? ? ? 0.515 ? ? ? ? ? ? ? ? 6.000 ? 0.456 ? ? 0.565 0.229 ? 4 1 0.846 ? ? ? ? ? ? ? ? ? ? 2.800 2.860 ? ? ? ? ? ? 1972 100.000 ? ? ? ? 0.444 ? ? ? ? ? ? ? ? 6.500 ? 0.459 ? ? 0.483 0.189 ? 5 1 0.929 ? ? ? ? ? ? ? ? ? ? 2.860 2.930 ? ? ? ? ? ? 1944 100.000 ? ? ? ? 0.402 ? ? ? ? ? ? ? ? 7.100 ? 0.467 ? ? 0.433 0.161 ? 6 1 0.935 ? ? ? ? ? ? ? ? ? ? 2.930 3.000 ? ? ? ? ? ? 1961 100.000 ? ? ? ? 0.342 ? ? ? ? ? ? ? ? 7.100 ? 0.470 ? ? 0.369 0.138 ? 7 1 0.953 ? ? ? ? ? ? ? ? ? ? 3.000 3.080 ? ? ? ? ? ? 1921 100.000 ? ? ? ? 0.298 ? ? ? ? ? ? ? ? 7.100 ? 0.489 ? ? 0.322 0.120 ? 8 1 0.965 ? ? ? ? ? ? ? ? ? ? 3.080 3.170 ? ? ? ? ? ? 1950 100.000 ? ? ? ? 0.236 ? ? ? ? ? ? ? ? 7.000 ? 0.496 ? ? 0.255 0.096 ? 9 1 0.978 ? ? ? ? ? ? ? ? ? ? 3.170 3.280 ? ? ? ? ? ? 1943 100.000 ? ? ? ? 0.181 ? ? ? ? ? ? ? ? 7.000 ? 0.539 ? ? 0.196 0.074 ? 10 1 0.984 ? ? ? ? ? ? ? ? ? ? 3.280 3.390 ? ? ? ? ? ? 1992 100.000 ? ? ? ? 0.143 ? ? ? ? ? ? ? ? 6.900 ? 0.582 ? ? 0.155 0.059 ? 11 1 0.994 ? ? ? ? ? ? ? ? ? ? 3.390 3.530 ? ? ? ? ? ? 1944 100.000 ? ? ? ? 0.119 ? ? ? ? ? ? ? ? 6.800 ? 0.694 ? ? 0.129 0.049 ? 12 1 0.991 ? ? ? ? ? ? ? ? ? ? 3.530 3.690 ? ? ? ? ? ? 1954 99.900 ? ? ? ? 0.093 ? ? ? ? ? ? ? ? 6.100 ? 0.716 ? ? 0.102 0.041 ? 13 1 0.995 ? ? ? ? ? ? ? ? ? ? 3.690 3.880 ? ? ? ? ? ? 1943 100.000 ? ? ? ? 0.085 ? ? ? ? ? ? ? ? 7.100 ? 0.733 ? ? 0.092 0.034 ? 14 1 0.995 ? ? ? ? ? ? ? ? ? ? 3.880 4.130 ? ? ? ? ? ? 1953 100.000 ? ? ? ? 0.078 ? ? ? ? ? ? ? ? 7.200 ? 0.788 ? ? 0.084 0.031 ? 15 1 0.996 ? ? ? ? ? ? ? ? ? ? 4.130 4.450 ? ? ? ? ? ? 1960 100.000 ? ? ? ? 0.067 ? ? ? ? ? ? ? ? 7.100 ? 0.798 ? ? 0.072 0.027 ? 16 1 0.996 ? ? ? ? ? ? ? ? ? ? 4.450 4.890 ? ? ? ? ? ? 1966 99.900 ? ? ? ? 0.061 ? ? ? ? ? ? ? ? 7.000 ? 0.763 ? ? 0.066 0.025 ? 17 1 0.997 ? ? ? ? ? ? ? ? ? ? 4.890 5.600 ? ? ? ? ? ? 1963 99.900 ? ? ? ? 0.056 ? ? ? ? ? ? ? ? 6.200 ? 0.664 ? ? 0.061 0.024 ? 18 1 0.996 ? ? ? ? ? ? ? ? ? ? 5.600 7.050 ? ? ? ? ? ? 1968 99.900 ? ? ? ? 0.055 ? ? ? ? ? ? ? ? 7.200 ? 0.567 ? ? 0.059 0.022 ? 19 1 0.997 ? ? ? ? ? ? ? ? ? ? 7.050 50.000 ? ? ? ? ? ? 2023 99.800 ? ? ? ? 0.038 ? ? ? ? ? ? ? ? 6.500 ? 0.613 ? ? 0.042 0.016 ? 20 1 0.999 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 115.990 _refine.B_iso_mean 54.5658 _refine.B_iso_min 23.360 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7Y1P _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.6020 _refine.ls_d_res_low 38.8360 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 39030 _refine.ls_number_reflns_R_free 1996 _refine.ls_number_reflns_R_work 37034 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.7700 _refine.ls_percent_reflns_R_free 5.1100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2089 _refine.ls_R_factor_R_free 0.2275 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2079 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1dk8 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.8900 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3100 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.6020 _refine_hist.d_res_low 38.8360 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 4383 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 556 _refine_hist.pdbx_B_iso_mean_ligand 82.40 _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 4362 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 21 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.pdbx_asym_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id 'X-RAY DIFFRACTION' 1 ? ? ? ? ? 1 TORSIONAL ? A 1676 5.695 ? 1 'X-RAY DIFFRACTION' 2 ? ? ? ? ? 2 TORSIONAL ? B 1676 5.695 ? 1 'X-RAY DIFFRACTION' 3 ? ? ? ? ? 3 TORSIONAL ? C 1676 5.695 ? 1 'X-RAY DIFFRACTION' 4 ? ? ? ? ? 4 TORSIONAL ? D 1676 5.695 ? 1 # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.6020 2.6668 . . 146 2667 100.0000 . . . 0.2908 0.0000 0.2778 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6668 2.7389 . . 140 2614 100.0000 . . . 0.2879 0.0000 0.2568 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7389 2.8194 . . 144 2639 100.0000 . . . 0.2621 0.0000 0.2558 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8194 2.9104 . . 142 2638 100.0000 . . . 0.3126 0.0000 0.2529 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9104 3.0144 . . 141 2614 100.0000 . . . 0.2837 0.0000 0.2614 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0144 3.1350 . . 146 2671 100.0000 . . . 0.3077 0.0000 0.2588 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1350 3.2777 . . 142 2601 100.0000 . . . 0.2754 0.0000 0.2362 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2777 3.4504 . . 141 2675 100.0000 . . . 0.2732 0.0000 0.2310 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4504 3.6664 . . 142 2648 100.0000 . . . 0.2427 0.0000 0.2123 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6664 3.9492 . . 142 2645 100.0000 . . . 0.2026 0.0000 0.1960 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.9492 4.3462 . . 142 2656 100.0000 . . . 0.2207 0.0000 0.1861 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.3462 4.9740 . . 144 2655 100.0000 . . . 0.1868 0.0000 0.1711 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.9740 6.2624 . . 142 2668 100.0000 . . . 0.1922 0.0000 0.2064 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.2624 38.8360 . . 142 2643 97.0000 . . . 0.1709 0.0000 0.1671 . . . . . . . . . . . # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 ;(chain A and (resid 114 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 162 or (resid 163 through 165 and (name N or name CA or name C or name O or name CB )) or resid 166 or (resid 167 through 169 and (name N or name CA or name C or name O or name CB )) or resid 170 or (resid 171 through 174 and (name N or name CA or name C or name O or name CB )) or resid 175 or (resid 176 and (name N or name CA or name C or name O or name CB )) or resid 177 through 197 or (resid 198 and (name N or name CA or name C or name O or name CB )) or resid 199 through 205 or (resid 206 and (name N or name CA or name C or name O or name CB )) or resid 207 through 212 or (resid 213 and (name N or name CA or name C or name O or name CB )) or resid 214 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 252)) ; 1 2 ;(chain B and (resid 114 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 162 or (resid 163 through 165 and (name N or name CA or name C or name O or name CB )) or resid 166 or (resid 167 through 169 and (name N or name CA or name C or name O or name CB )) or resid 170 or (resid 171 through 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 197 or (resid 198 and (name N or name CA or name C or name O or name CB )) or resid 199 through 205 or (resid 206 and (name N or name CA or name C or name O or name CB )) or resid 207 through 212 or (resid 213 and (name N or name CA or name C or name O or name CB )) or resid 214 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 252)) ; 1 3 ;(chain C and (resid 114 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 171 or (resid 172 through 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 205 or (resid 206 and (name N or name CA or name C or name O or name CB )) or resid 207 through 252)) ; 1 4 ;(chain D and (resid 114 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 163 or (resid 164 through 165 and (name N or name CA or name C or name O or name CB )) or resid 166 or (resid 167 through 169 and (name N or name CA or name C or name O or name CB )) or resid 170 or (resid 171 through 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 197 or (resid 198 and (name N or name CA or name C or name O or name CB )) or resid 199 through 212 or (resid 213 and (name N or name CA or name C or name O or name CB )) or resid 214 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 252)) ; # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 A LEU 41 . A LYS 66 . A LEU 114 A LYS 139 ? ;(chain A and (resid 114 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 162 or (resid 163 through 165 and (name N or name CA or name C or name O or name CB )) or resid 166 or (resid 167 through 169 and (name N or name CA or name C or name O or name CB )) or resid 170 or (resid 171 through 174 and (name N or name CA or name C or name O or name CB )) or resid 175 or (resid 176 and (name N or name CA or name C or name O or name CB )) or resid 177 through 197 or (resid 198 and (name N or name CA or name C or name O or name CB )) or resid 199 through 205 or (resid 206 and (name N or name CA or name C or name O or name CB )) or resid 207 through 212 or (resid 213 and (name N or name CA or name C or name O or name CB )) or resid 214 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 252)) ; 1 1 2 A LEU 67 . A LEU 67 . A LEU 140 A LEU 140 ? ;(chain A and (resid 114 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 162 or (resid 163 through 165 and (name N or name CA or name C or name O or name CB )) or resid 166 or (resid 167 through 169 and (name N or name CA or name C or name O or name CB )) or resid 170 or (resid 171 through 174 and (name N or name CA or name C or name O or name CB )) or resid 175 or (resid 176 and (name N or name CA or name C or name O or name CB )) or resid 177 through 197 or (resid 198 and (name N or name CA or name C or name O or name CB )) or resid 199 through 205 or (resid 206 and (name N or name CA or name C or name O or name CB )) or resid 207 through 212 or (resid 213 and (name N or name CA or name C or name O or name CB )) or resid 214 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 252)) ; 1 1 3 A SER 4 . A SER 142 . A SER 77 A SER 215 ? ;(chain A and (resid 114 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 162 or (resid 163 through 165 and (name N or name CA or name C or name O or name CB )) or resid 166 or (resid 167 through 169 and (name N or name CA or name C or name O or name CB )) or resid 170 or (resid 171 through 174 and (name N or name CA or name C or name O or name CB )) or resid 175 or (resid 176 and (name N or name CA or name C or name O or name CB )) or resid 177 through 197 or (resid 198 and (name N or name CA or name C or name O or name CB )) or resid 199 through 205 or (resid 206 and (name N or name CA or name C or name O or name CB )) or resid 207 through 212 or (resid 213 and (name N or name CA or name C or name O or name CB )) or resid 214 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 252)) ; 1 1 4 A SER 4 . A SER 142 . A SER 77 A SER 215 ? ;(chain A and (resid 114 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 162 or (resid 163 through 165 and (name N or name CA or name C or name O or name CB )) or resid 166 or (resid 167 through 169 and (name N or name CA or name C or name O or name CB )) or resid 170 or (resid 171 through 174 and (name N or name CA or name C or name O or name CB )) or resid 175 or (resid 176 and (name N or name CA or name C or name O or name CB )) or resid 177 through 197 or (resid 198 and (name N or name CA or name C or name O or name CB )) or resid 199 through 205 or (resid 206 and (name N or name CA or name C or name O or name CB )) or resid 207 through 212 or (resid 213 and (name N or name CA or name C or name O or name CB )) or resid 214 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 252)) ; 1 1 5 A SER 4 . A SER 142 . A SER 77 A SER 215 ? ;(chain A and (resid 114 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 162 or (resid 163 through 165 and (name N or name CA or name C or name O or name CB )) or resid 166 or (resid 167 through 169 and (name N or name CA or name C or name O or name CB )) or resid 170 or (resid 171 through 174 and (name N or name CA or name C or name O or name CB )) or resid 175 or (resid 176 and (name N or name CA or name C or name O or name CB )) or resid 177 through 197 or (resid 198 and (name N or name CA or name C or name O or name CB )) or resid 199 through 205 or (resid 206 and (name N or name CA or name C or name O or name CB )) or resid 207 through 212 or (resid 213 and (name N or name CA or name C or name O or name CB )) or resid 214 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 252)) ; 1 1 6 A SER 4 . A SER 142 . A SER 77 A SER 215 ? ;(chain A and (resid 114 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 162 or (resid 163 through 165 and (name N or name CA or name C or name O or name CB )) or resid 166 or (resid 167 through 169 and (name N or name CA or name C or name O or name CB )) or resid 170 or (resid 171 through 174 and (name N or name CA or name C or name O or name CB )) or resid 175 or (resid 176 and (name N or name CA or name C or name O or name CB )) or resid 177 through 197 or (resid 198 and (name N or name CA or name C or name O or name CB )) or resid 199 through 205 or (resid 206 and (name N or name CA or name C or name O or name CB )) or resid 207 through 212 or (resid 213 and (name N or name CA or name C or name O or name CB )) or resid 214 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 252)) ; 1 2 1 B LEU 41 . B LYS 66 . B LEU 114 B LYS 139 ? ;(chain B and (resid 114 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 162 or (resid 163 through 165 and (name N or name CA or name C or name O or name CB )) or resid 166 or (resid 167 through 169 and (name N or name CA or name C or name O or name CB )) or resid 170 or (resid 171 through 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 197 or (resid 198 and (name N or name CA or name C or name O or name CB )) or resid 199 through 205 or (resid 206 and (name N or name CA or name C or name O or name CB )) or resid 207 through 212 or (resid 213 and (name N or name CA or name C or name O or name CB )) or resid 214 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 252)) ; 1 2 2 B LEU 67 . B LEU 67 . B LEU 140 B LEU 140 ? ;(chain B and (resid 114 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 162 or (resid 163 through 165 and (name N or name CA or name C or name O or name CB )) or resid 166 or (resid 167 through 169 and (name N or name CA or name C or name O or name CB )) or resid 170 or (resid 171 through 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 197 or (resid 198 and (name N or name CA or name C or name O or name CB )) or resid 199 through 205 or (resid 206 and (name N or name CA or name C or name O or name CB )) or resid 207 through 212 or (resid 213 and (name N or name CA or name C or name O or name CB )) or resid 214 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 252)) ; 1 2 3 B SER 4 . B SER 142 . B SER 77 B SER 215 ? ;(chain B and (resid 114 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 162 or (resid 163 through 165 and (name N or name CA or name C or name O or name CB )) or resid 166 or (resid 167 through 169 and (name N or name CA or name C or name O or name CB )) or resid 170 or (resid 171 through 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 197 or (resid 198 and (name N or name CA or name C or name O or name CB )) or resid 199 through 205 or (resid 206 and (name N or name CA or name C or name O or name CB )) or resid 207 through 212 or (resid 213 and (name N or name CA or name C or name O or name CB )) or resid 214 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 252)) ; 1 2 4 B SER 4 . B SER 142 . B SER 77 B SER 215 ? ;(chain B and (resid 114 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 162 or (resid 163 through 165 and (name N or name CA or name C or name O or name CB )) or resid 166 or (resid 167 through 169 and (name N or name CA or name C or name O or name CB )) or resid 170 or (resid 171 through 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 197 or (resid 198 and (name N or name CA or name C or name O or name CB )) or resid 199 through 205 or (resid 206 and (name N or name CA or name C or name O or name CB )) or resid 207 through 212 or (resid 213 and (name N or name CA or name C or name O or name CB )) or resid 214 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 252)) ; 1 2 5 B SER 4 . B SER 142 . B SER 77 B SER 215 ? ;(chain B and (resid 114 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 162 or (resid 163 through 165 and (name N or name CA or name C or name O or name CB )) or resid 166 or (resid 167 through 169 and (name N or name CA or name C or name O or name CB )) or resid 170 or (resid 171 through 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 197 or (resid 198 and (name N or name CA or name C or name O or name CB )) or resid 199 through 205 or (resid 206 and (name N or name CA or name C or name O or name CB )) or resid 207 through 212 or (resid 213 and (name N or name CA or name C or name O or name CB )) or resid 214 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 252)) ; 1 2 6 B SER 4 . B SER 142 . B SER 77 B SER 215 ? ;(chain B and (resid 114 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 162 or (resid 163 through 165 and (name N or name CA or name C or name O or name CB )) or resid 166 or (resid 167 through 169 and (name N or name CA or name C or name O or name CB )) or resid 170 or (resid 171 through 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 197 or (resid 198 and (name N or name CA or name C or name O or name CB )) or resid 199 through 205 or (resid 206 and (name N or name CA or name C or name O or name CB )) or resid 207 through 212 or (resid 213 and (name N or name CA or name C or name O or name CB )) or resid 214 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 252)) ; 1 3 1 C LEU 41 . C LYS 66 . C LEU 114 C LYS 139 ? ;(chain C and (resid 114 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 171 or (resid 172 through 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 205 or (resid 206 and (name N or name CA or name C or name O or name CB )) or resid 207 through 252)) ; 1 3 2 C LEU 67 . C LEU 67 . C LEU 140 C LEU 140 ? ;(chain C and (resid 114 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 171 or (resid 172 through 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 205 or (resid 206 and (name N or name CA or name C or name O or name CB )) or resid 207 through 252)) ; 1 3 3 C SER 4 . C SER 142 . C SER 77 C SER 215 ? ;(chain C and (resid 114 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 171 or (resid 172 through 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 205 or (resid 206 and (name N or name CA or name C or name O or name CB )) or resid 207 through 252)) ; 1 3 4 C SER 4 . C SER 142 . C SER 77 C SER 215 ? ;(chain C and (resid 114 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 171 or (resid 172 through 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 205 or (resid 206 and (name N or name CA or name C or name O or name CB )) or resid 207 through 252)) ; 1 3 5 C SER 4 . C SER 142 . C SER 77 C SER 215 ? ;(chain C and (resid 114 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 171 or (resid 172 through 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 205 or (resid 206 and (name N or name CA or name C or name O or name CB )) or resid 207 through 252)) ; 1 3 6 C SER 4 . C SER 142 . C SER 77 C SER 215 ? ;(chain C and (resid 114 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 171 or (resid 172 through 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 205 or (resid 206 and (name N or name CA or name C or name O or name CB )) or resid 207 through 252)) ; 1 4 1 D LEU 41 . D ALA 70 . D LEU 114 D ALA 143 ? ;(chain D and (resid 114 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 163 or (resid 164 through 165 and (name N or name CA or name C or name O or name CB )) or resid 166 or (resid 167 through 169 and (name N or name CA or name C or name O or name CB )) or resid 170 or (resid 171 through 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 197 or (resid 198 and (name N or name CA or name C or name O or name CB )) or resid 199 through 212 or (resid 213 and (name N or name CA or name C or name O or name CB )) or resid 214 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 252)) ; 1 4 2 D ILE 71 . D ILE 71 . D ILE 144 D ILE 144 ? ;(chain D and (resid 114 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 163 or (resid 164 through 165 and (name N or name CA or name C or name O or name CB )) or resid 166 or (resid 167 through 169 and (name N or name CA or name C or name O or name CB )) or resid 170 or (resid 171 through 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 197 or (resid 198 and (name N or name CA or name C or name O or name CB )) or resid 199 through 212 or (resid 213 and (name N or name CA or name C or name O or name CB )) or resid 214 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 252)) ; 1 4 3 D SER 4 . D SER 142 . D SER 77 D SER 215 ? ;(chain D and (resid 114 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 163 or (resid 164 through 165 and (name N or name CA or name C or name O or name CB )) or resid 166 or (resid 167 through 169 and (name N or name CA or name C or name O or name CB )) or resid 170 or (resid 171 through 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 197 or (resid 198 and (name N or name CA or name C or name O or name CB )) or resid 199 through 212 or (resid 213 and (name N or name CA or name C or name O or name CB )) or resid 214 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 252)) ; 1 4 4 D SER 4 . D SER 142 . D SER 77 D SER 215 ? ;(chain D and (resid 114 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 163 or (resid 164 through 165 and (name N or name CA or name C or name O or name CB )) or resid 166 or (resid 167 through 169 and (name N or name CA or name C or name O or name CB )) or resid 170 or (resid 171 through 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 197 or (resid 198 and (name N or name CA or name C or name O or name CB )) or resid 199 through 212 or (resid 213 and (name N or name CA or name C or name O or name CB )) or resid 214 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 252)) ; 1 4 5 D SER 4 . D SER 142 . D SER 77 D SER 215 ? ;(chain D and (resid 114 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 163 or (resid 164 through 165 and (name N or name CA or name C or name O or name CB )) or resid 166 or (resid 167 through 169 and (name N or name CA or name C or name O or name CB )) or resid 170 or (resid 171 through 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 197 or (resid 198 and (name N or name CA or name C or name O or name CB )) or resid 199 through 212 or (resid 213 and (name N or name CA or name C or name O or name CB )) or resid 214 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 252)) ; 1 4 6 D SER 4 . D SER 142 . D SER 77 D SER 215 ? ;(chain D and (resid 114 through 143 or (resid 144 and (name N or name CA or name C or name O or name CB )) or resid 145 through 163 or (resid 164 through 165 and (name N or name CA or name C or name O or name CB )) or resid 166 or (resid 167 through 169 and (name N or name CA or name C or name O or name CB )) or resid 170 or (resid 171 through 174 and (name N or name CA or name C or name O or name CB )) or resid 175 through 197 or (resid 198 and (name N or name CA or name C or name O or name CB )) or resid 199 through 212 or (resid 213 and (name N or name CA or name C or name O or name CB )) or resid 214 through 241 or (resid 242 and (name N or name CA or name C or name O or name CB )) or resid 243 through 252)) ; # _struct_ncs_ens.id 1 _struct_ncs_ens.details ? # _struct.entry_id 7Y1P _struct.title 'CRYSTAL STRUCTURE OF THE RGS-HOMOLOGOUS DOMAIN OF AXIN IN COMPLEX WITH LZ-22Na' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7Y1P _struct_keywords.text 'Signaling protein, Wint/beta-catenin signaling pathway' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 7 ? SER A 15 ? PRO A 80 SER A 88 1 ? 9 HELX_P HELX_P2 AA2 SER A 15 ? LEU A 20 ? SER A 88 LEU A 93 1 ? 6 HELX_P HELX_P3 AA3 ASP A 22 ? GLY A 37 ? ASP A 95 GLY A 110 1 ? 16 HELX_P HELX_P4 AA4 CYS A 38 ? LYS A 53 ? CYS A 111 LYS A 126 1 ? 16 HELX_P HELX_P5 AA5 CYS A 57 ? SER A 59 ? CYS A 130 SER A 132 5 ? 3 HELX_P HELX_P6 AA6 ASN A 60 ? ILE A 76 ? ASN A 133 ILE A 149 1 ? 17 HELX_P HELX_P7 AA7 GLY A 81 ? THR A 87 ? GLY A 154 THR A 160 1 ? 7 HELX_P HELX_P8 AA8 LYS A 88 ? GLN A 102 ? LYS A 161 GLN A 175 1 ? 15 HELX_P HELX_P9 AA9 PHE A 109 ? ASN A 123 ? PHE A 182 ASN A 196 1 ? 15 HELX_P HELX_P10 AB1 ASN A 123 ? LYS A 130 ? ASN A 196 LYS A 203 1 ? 8 HELX_P HELX_P11 AB2 SER A 131 ? GLY A 141 ? SER A 204 GLY A 214 1 ? 11 HELX_P HELX_P12 AB3 PRO B 7 ? SER B 15 ? PRO B 80 SER B 88 1 ? 9 HELX_P HELX_P13 AB4 SER B 15 ? ASP B 21 ? SER B 88 ASP B 94 1 ? 7 HELX_P HELX_P14 AB5 ASP B 22 ? GLY B 37 ? ASP B 95 GLY B 110 1 ? 16 HELX_P HELX_P15 AB6 CYS B 38 ? LYS B 53 ? CYS B 111 LYS B 126 1 ? 16 HELX_P HELX_P16 AB7 CYS B 57 ? SER B 59 ? CYS B 130 SER B 132 5 ? 3 HELX_P HELX_P17 AB8 ASN B 60 ? ILE B 76 ? ASN B 133 ILE B 149 1 ? 17 HELX_P HELX_P18 AB9 GLY B 81 ? THR B 87 ? GLY B 154 THR B 160 1 ? 7 HELX_P HELX_P19 AC1 LYS B 88 ? LYS B 101 ? LYS B 161 LYS B 174 1 ? 14 HELX_P HELX_P20 AC2 PHE B 109 ? ASN B 123 ? PHE B 182 ASN B 196 1 ? 15 HELX_P HELX_P21 AC3 ASN B 123 ? LYS B 130 ? ASN B 196 LYS B 203 1 ? 8 HELX_P HELX_P22 AC4 SER B 131 ? THR B 140 ? SER B 204 THR B 213 1 ? 10 HELX_P HELX_P23 AC5 PRO C 7 ? SER C 15 ? PRO C 80 SER C 88 1 ? 9 HELX_P HELX_P24 AC6 SER C 15 ? ASP C 21 ? SER C 88 ASP C 94 1 ? 7 HELX_P HELX_P25 AC7 ASP C 22 ? GLY C 37 ? ASP C 95 GLY C 110 1 ? 16 HELX_P HELX_P26 AC8 CYS C 38 ? LEU C 54 ? CYS C 111 LEU C 127 1 ? 17 HELX_P HELX_P27 AC9 GLU C 61 ? ILE C 76 ? GLU C 134 ILE C 149 1 ? 16 HELX_P HELX_P28 AD1 GLY C 81 ? THR C 87 ? GLY C 154 THR C 160 1 ? 7 HELX_P HELX_P29 AD2 LYS C 88 ? LYS C 101 ? LYS C 161 LYS C 174 1 ? 14 HELX_P HELX_P30 AD3 PHE C 109 ? ASN C 123 ? PHE C 182 ASN C 196 1 ? 15 HELX_P HELX_P31 AD4 ASN C 123 ? LYS C 130 ? ASN C 196 LYS C 203 1 ? 8 HELX_P HELX_P32 AD5 SER C 131 ? THR C 140 ? SER C 204 THR C 213 1 ? 10 HELX_P HELX_P33 AD6 PRO D 7 ? SER D 15 ? PRO D 80 SER D 88 1 ? 9 HELX_P HELX_P34 AD7 SER D 15 ? LEU D 20 ? SER D 88 LEU D 93 1 ? 6 HELX_P HELX_P35 AD8 ASP D 22 ? GLY D 37 ? ASP D 95 GLY D 110 1 ? 16 HELX_P HELX_P36 AD9 CYS D 38 ? LEU D 54 ? CYS D 111 LEU D 127 1 ? 17 HELX_P HELX_P37 AE1 ASN D 60 ? ILE D 76 ? ASN D 133 ILE D 149 1 ? 17 HELX_P HELX_P38 AE2 GLY D 81 ? THR D 87 ? GLY D 154 THR D 160 1 ? 7 HELX_P HELX_P39 AE3 LYS D 88 ? LYS D 101 ? LYS D 161 LYS D 174 1 ? 14 HELX_P HELX_P40 AE4 PHE D 109 ? ASN D 123 ? PHE D 182 ASN D 196 1 ? 15 HELX_P HELX_P41 AE5 ASN D 123 ? LYS D 130 ? ASN D 196 LYS D 203 1 ? 8 HELX_P HELX_P42 AE6 SER D 131 ? THR D 140 ? SER D 204 THR D 213 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 7Y1P _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.006437 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006437 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009340 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 74 ? ? ? A . n A 1 2 SER 2 75 ? ? ? A . n A 1 3 ALA 3 76 ? ? ? A . n A 1 4 SER 4 77 77 SER SER A . n A 1 5 PRO 5 78 78 PRO PRO A . n A 1 6 THR 6 79 79 THR THR A . n A 1 7 PRO 7 80 80 PRO PRO A . n A 1 8 PRO 8 81 81 PRO PRO A . n A 1 9 TYR 9 82 82 TYR TYR A . n A 1 10 LEU 10 83 83 LEU LEU A . n A 1 11 LYS 11 84 84 LYS LYS A . n A 1 12 TRP 12 85 85 TRP TRP A . n A 1 13 ALA 13 86 86 ALA ALA A . n A 1 14 GLU 14 87 87 GLU GLU A . n A 1 15 SER 15 88 88 SER SER A . n A 1 16 LEU 16 89 89 LEU LEU A . n A 1 17 HIS 17 90 90 HIS HIS A . n A 1 18 SER 18 91 91 SER SER A . n A 1 19 LEU 19 92 92 LEU LEU A . n A 1 20 LEU 20 93 93 LEU LEU A . n A 1 21 ASP 21 94 94 ASP ASP A . n A 1 22 ASP 22 95 95 ASP ASP A . n A 1 23 GLN 23 96 96 GLN GLN A . n A 1 24 ASP 24 97 97 ASP ASP A . n A 1 25 GLY 25 98 98 GLY GLY A . n A 1 26 ILE 26 99 99 ILE ILE A . n A 1 27 SER 27 100 100 SER SER A . n A 1 28 LEU 28 101 101 LEU LEU A . n A 1 29 PHE 29 102 102 PHE PHE A . n A 1 30 ARG 30 103 103 ARG ARG A . n A 1 31 THR 31 104 104 THR THR A . n A 1 32 PHE 32 105 105 PHE PHE A . n A 1 33 LEU 33 106 106 LEU LEU A . n A 1 34 LYS 34 107 107 LYS LYS A . n A 1 35 GLN 35 108 108 GLN GLN A . n A 1 36 GLU 36 109 109 GLU GLU A . n A 1 37 GLY 37 110 110 GLY GLY A . n A 1 38 CYS 38 111 111 CYS CYS A . n A 1 39 ALA 39 112 112 ALA ALA A . n A 1 40 ASP 40 113 113 ASP ASP A . n A 1 41 LEU 41 114 114 LEU LEU A . n A 1 42 LEU 42 115 115 LEU LEU A . n A 1 43 ASP 43 116 116 ASP ASP A . n A 1 44 PHE 44 117 117 PHE PHE A . n A 1 45 TRP 45 118 118 TRP TRP A . n A 1 46 PHE 46 119 119 PHE PHE A . n A 1 47 ALA 47 120 120 ALA ALA A . n A 1 48 CYS 48 121 121 CYS CYS A . n A 1 49 THR 49 122 122 THR THR A . n A 1 50 GLY 50 123 123 GLY GLY A . n A 1 51 PHE 51 124 124 PHE PHE A . n A 1 52 ARG 52 125 125 ARG ARG A . n A 1 53 LYS 53 126 126 LYS LYS A . n A 1 54 LEU 54 127 127 LEU LEU A . n A 1 55 GLU 55 128 128 GLU GLU A . n A 1 56 PRO 56 129 129 PRO PRO A . n A 1 57 CYS 57 130 130 CYS CYS A . n A 1 58 ASP 58 131 131 ASP ASP A . n A 1 59 SER 59 132 132 SER SER A . n A 1 60 ASN 60 133 133 ASN ASN A . n A 1 61 GLU 61 134 134 GLU GLU A . n A 1 62 GLU 62 135 135 GLU GLU A . n A 1 63 LYS 63 136 136 LYS LYS A . n A 1 64 ARG 64 137 137 ARG ARG A . n A 1 65 LEU 65 138 138 LEU LEU A . n A 1 66 LYS 66 139 139 LYS LYS A . n A 1 67 LEU 67 140 140 LEU LEU A . n A 1 68 ALA 68 141 141 ALA ALA A . n A 1 69 ARG 69 142 142 ARG ARG A . n A 1 70 ALA 70 143 143 ALA ALA A . n A 1 71 ILE 71 144 144 ILE ILE A . n A 1 72 TYR 72 145 145 TYR TYR A . n A 1 73 ARG 73 146 146 ARG ARG A . n A 1 74 LYS 74 147 147 LYS LYS A . n A 1 75 TYR 75 148 148 TYR TYR A . n A 1 76 ILE 76 149 149 ILE ILE A . n A 1 77 LEU 77 150 150 LEU LEU A . n A 1 78 ASP 78 151 151 ASP ASP A . n A 1 79 ASN 79 152 152 ASN ASN A . n A 1 80 ASN 80 153 153 ASN ASN A . n A 1 81 GLY 81 154 154 GLY GLY A . n A 1 82 ILE 82 155 155 ILE ILE A . n A 1 83 VAL 83 156 156 VAL VAL A . n A 1 84 SER 84 157 157 SER SER A . n A 1 85 ARG 85 158 158 ARG ARG A . n A 1 86 GLN 86 159 159 GLN GLN A . n A 1 87 THR 87 160 160 THR THR A . n A 1 88 LYS 88 161 161 LYS LYS A . n A 1 89 PRO 89 162 162 PRO PRO A . n A 1 90 ALA 90 163 163 ALA ALA A . n A 1 91 THR 91 164 164 THR THR A . n A 1 92 LYS 92 165 165 LYS LYS A . n A 1 93 SER 93 166 166 SER SER A . n A 1 94 PHE 94 167 167 PHE PHE A . n A 1 95 ILE 95 168 168 ILE ILE A . n A 1 96 LYS 96 169 169 LYS LYS A . n A 1 97 GLY 97 170 170 GLY GLY A . n A 1 98 CYS 98 171 171 CYS CYS A . n A 1 99 ILE 99 172 172 ILE ILE A . n A 1 100 MET 100 173 173 MET MET A . n A 1 101 LYS 101 174 174 LYS LYS A . n A 1 102 GLN 102 175 175 GLN GLN A . n A 1 103 LEU 103 176 176 LEU LEU A . n A 1 104 ILE 104 177 177 ILE ILE A . n A 1 105 ASP 105 178 178 ASP ASP A . n A 1 106 PRO 106 179 179 PRO PRO A . n A 1 107 ALA 107 180 180 ALA ALA A . n A 1 108 MET 108 181 181 MET MET A . n A 1 109 PHE 109 182 182 PHE PHE A . n A 1 110 ASP 110 183 183 ASP ASP A . n A 1 111 GLN 111 184 184 GLN GLN A . n A 1 112 ALA 112 185 185 ALA ALA A . n A 1 113 GLN 113 186 186 GLN GLN A . n A 1 114 THR 114 187 187 THR THR A . n A 1 115 GLU 115 188 188 GLU GLU A . n A 1 116 ILE 116 189 189 ILE ILE A . n A 1 117 GLN 117 190 190 GLN GLN A . n A 1 118 ALA 118 191 191 ALA ALA A . n A 1 119 THR 119 192 192 THR THR A . n A 1 120 MET 120 193 193 MET MET A . n A 1 121 GLU 121 194 194 GLU GLU A . n A 1 122 GLU 122 195 195 GLU GLU A . n A 1 123 ASN 123 196 196 ASN ASN A . n A 1 124 THR 124 197 197 THR THR A . n A 1 125 TYR 125 198 198 TYR TYR A . n A 1 126 PRO 126 199 199 PRO PRO A . n A 1 127 SER 127 200 200 SER SER A . n A 1 128 PHE 128 201 201 PHE PHE A . n A 1 129 LEU 129 202 202 LEU LEU A . n A 1 130 LYS 130 203 203 LYS LYS A . n A 1 131 SER 131 204 204 SER SER A . n A 1 132 ASP 132 205 205 ASP ASP A . n A 1 133 ILE 133 206 206 ILE ILE A . n A 1 134 TYR 134 207 207 TYR TYR A . n A 1 135 LEU 135 208 208 LEU LEU A . n A 1 136 GLU 136 209 209 GLU GLU A . n A 1 137 TYR 137 210 210 TYR TYR A . n A 1 138 THR 138 211 211 THR THR A . n A 1 139 ARG 139 212 212 ARG ARG A . n A 1 140 THR 140 213 213 THR THR A . n A 1 141 GLY 141 214 214 GLY GLY A . n A 1 142 SER 142 215 215 SER SER A . n A 1 143 GLU 143 216 ? ? ? A . n A 1 144 SER 144 217 ? ? ? A . n A 1 145 PRO 145 218 ? ? ? A . n A 1 146 LYS 146 219 ? ? ? A . n A 1 147 VAL 147 220 ? ? ? A . n B 1 1 GLY 1 74 ? ? ? B . n B 1 2 SER 2 75 ? ? ? B . n B 1 3 ALA 3 76 ? ? ? B . n B 1 4 SER 4 77 77 SER SER B . n B 1 5 PRO 5 78 78 PRO PRO B . n B 1 6 THR 6 79 79 THR THR B . n B 1 7 PRO 7 80 80 PRO PRO B . n B 1 8 PRO 8 81 81 PRO PRO B . n B 1 9 TYR 9 82 82 TYR TYR B . n B 1 10 LEU 10 83 83 LEU LEU B . n B 1 11 LYS 11 84 84 LYS LYS B . n B 1 12 TRP 12 85 85 TRP TRP B . n B 1 13 ALA 13 86 86 ALA ALA B . n B 1 14 GLU 14 87 87 GLU GLU B . n B 1 15 SER 15 88 88 SER SER B . n B 1 16 LEU 16 89 89 LEU LEU B . n B 1 17 HIS 17 90 90 HIS HIS B . n B 1 18 SER 18 91 91 SER SER B . n B 1 19 LEU 19 92 92 LEU LEU B . n B 1 20 LEU 20 93 93 LEU LEU B . n B 1 21 ASP 21 94 94 ASP ASP B . n B 1 22 ASP 22 95 95 ASP ASP B . n B 1 23 GLN 23 96 96 GLN GLN B . n B 1 24 ASP 24 97 97 ASP ASP B . n B 1 25 GLY 25 98 98 GLY GLY B . n B 1 26 ILE 26 99 99 ILE ILE B . n B 1 27 SER 27 100 100 SER SER B . n B 1 28 LEU 28 101 101 LEU LEU B . n B 1 29 PHE 29 102 102 PHE PHE B . n B 1 30 ARG 30 103 103 ARG ARG B . n B 1 31 THR 31 104 104 THR THR B . n B 1 32 PHE 32 105 105 PHE PHE B . n B 1 33 LEU 33 106 106 LEU LEU B . n B 1 34 LYS 34 107 107 LYS LYS B . n B 1 35 GLN 35 108 108 GLN GLN B . n B 1 36 GLU 36 109 109 GLU GLU B . n B 1 37 GLY 37 110 110 GLY GLY B . n B 1 38 CYS 38 111 111 CYS CYS B . n B 1 39 ALA 39 112 112 ALA ALA B . n B 1 40 ASP 40 113 113 ASP ASP B . n B 1 41 LEU 41 114 114 LEU LEU B . n B 1 42 LEU 42 115 115 LEU LEU B . n B 1 43 ASP 43 116 116 ASP ASP B . n B 1 44 PHE 44 117 117 PHE PHE B . n B 1 45 TRP 45 118 118 TRP TRP B . n B 1 46 PHE 46 119 119 PHE PHE B . n B 1 47 ALA 47 120 120 ALA ALA B . n B 1 48 CYS 48 121 121 CYS CYS B . n B 1 49 THR 49 122 122 THR THR B . n B 1 50 GLY 50 123 123 GLY GLY B . n B 1 51 PHE 51 124 124 PHE PHE B . n B 1 52 ARG 52 125 125 ARG ARG B . n B 1 53 LYS 53 126 126 LYS LYS B . n B 1 54 LEU 54 127 127 LEU LEU B . n B 1 55 GLU 55 128 128 GLU GLU B . n B 1 56 PRO 56 129 129 PRO PRO B . n B 1 57 CYS 57 130 130 CYS CYS B . n B 1 58 ASP 58 131 131 ASP ASP B . n B 1 59 SER 59 132 132 SER SER B . n B 1 60 ASN 60 133 133 ASN ASN B . n B 1 61 GLU 61 134 134 GLU GLU B . n B 1 62 GLU 62 135 135 GLU GLU B . n B 1 63 LYS 63 136 136 LYS LYS B . n B 1 64 ARG 64 137 137 ARG ARG B . n B 1 65 LEU 65 138 138 LEU LEU B . n B 1 66 LYS 66 139 139 LYS LYS B . n B 1 67 LEU 67 140 140 LEU LEU B . n B 1 68 ALA 68 141 141 ALA ALA B . n B 1 69 ARG 69 142 142 ARG ARG B . n B 1 70 ALA 70 143 143 ALA ALA B . n B 1 71 ILE 71 144 144 ILE ILE B . n B 1 72 TYR 72 145 145 TYR TYR B . n B 1 73 ARG 73 146 146 ARG ARG B . n B 1 74 LYS 74 147 147 LYS LYS B . n B 1 75 TYR 75 148 148 TYR TYR B . n B 1 76 ILE 76 149 149 ILE ILE B . n B 1 77 LEU 77 150 150 LEU LEU B . n B 1 78 ASP 78 151 151 ASP ASP B . n B 1 79 ASN 79 152 152 ASN ASN B . n B 1 80 ASN 80 153 153 ASN ASN B . n B 1 81 GLY 81 154 154 GLY GLY B . n B 1 82 ILE 82 155 155 ILE ILE B . n B 1 83 VAL 83 156 156 VAL VAL B . n B 1 84 SER 84 157 157 SER SER B . n B 1 85 ARG 85 158 158 ARG ARG B . n B 1 86 GLN 86 159 159 GLN GLN B . n B 1 87 THR 87 160 160 THR THR B . n B 1 88 LYS 88 161 161 LYS LYS B . n B 1 89 PRO 89 162 162 PRO PRO B . n B 1 90 ALA 90 163 163 ALA ALA B . n B 1 91 THR 91 164 164 THR THR B . n B 1 92 LYS 92 165 165 LYS LYS B . n B 1 93 SER 93 166 166 SER SER B . n B 1 94 PHE 94 167 167 PHE PHE B . n B 1 95 ILE 95 168 168 ILE ILE B . n B 1 96 LYS 96 169 169 LYS LYS B . n B 1 97 GLY 97 170 170 GLY GLY B . n B 1 98 CYS 98 171 171 CYS CYS B . n B 1 99 ILE 99 172 172 ILE ILE B . n B 1 100 MET 100 173 173 MET MET B . n B 1 101 LYS 101 174 174 LYS LYS B . n B 1 102 GLN 102 175 175 GLN GLN B . n B 1 103 LEU 103 176 176 LEU LEU B . n B 1 104 ILE 104 177 177 ILE ILE B . n B 1 105 ASP 105 178 178 ASP ASP B . n B 1 106 PRO 106 179 179 PRO PRO B . n B 1 107 ALA 107 180 180 ALA ALA B . n B 1 108 MET 108 181 181 MET MET B . n B 1 109 PHE 109 182 182 PHE PHE B . n B 1 110 ASP 110 183 183 ASP ASP B . n B 1 111 GLN 111 184 184 GLN GLN B . n B 1 112 ALA 112 185 185 ALA ALA B . n B 1 113 GLN 113 186 186 GLN GLN B . n B 1 114 THR 114 187 187 THR THR B . n B 1 115 GLU 115 188 188 GLU GLU B . n B 1 116 ILE 116 189 189 ILE ILE B . n B 1 117 GLN 117 190 190 GLN GLN B . n B 1 118 ALA 118 191 191 ALA ALA B . n B 1 119 THR 119 192 192 THR THR B . n B 1 120 MET 120 193 193 MET MET B . n B 1 121 GLU 121 194 194 GLU GLU B . n B 1 122 GLU 122 195 195 GLU GLU B . n B 1 123 ASN 123 196 196 ASN ASN B . n B 1 124 THR 124 197 197 THR THR B . n B 1 125 TYR 125 198 198 TYR TYR B . n B 1 126 PRO 126 199 199 PRO PRO B . n B 1 127 SER 127 200 200 SER SER B . n B 1 128 PHE 128 201 201 PHE PHE B . n B 1 129 LEU 129 202 202 LEU LEU B . n B 1 130 LYS 130 203 203 LYS LYS B . n B 1 131 SER 131 204 204 SER SER B . n B 1 132 ASP 132 205 205 ASP ASP B . n B 1 133 ILE 133 206 206 ILE ILE B . n B 1 134 TYR 134 207 207 TYR TYR B . n B 1 135 LEU 135 208 208 LEU LEU B . n B 1 136 GLU 136 209 209 GLU GLU B . n B 1 137 TYR 137 210 210 TYR TYR B . n B 1 138 THR 138 211 211 THR THR B . n B 1 139 ARG 139 212 212 ARG ARG B . n B 1 140 THR 140 213 213 THR THR B . n B 1 141 GLY 141 214 214 GLY GLY B . n B 1 142 SER 142 215 215 SER SER B . n B 1 143 GLU 143 216 ? ? ? B . n B 1 144 SER 144 217 ? ? ? B . n B 1 145 PRO 145 218 ? ? ? B . n B 1 146 LYS 146 219 ? ? ? B . n B 1 147 VAL 147 220 ? ? ? B . n C 1 1 GLY 1 74 ? ? ? C . n C 1 2 SER 2 75 ? ? ? C . n C 1 3 ALA 3 76 ? ? ? C . n C 1 4 SER 4 77 77 SER SER C . n C 1 5 PRO 5 78 78 PRO PRO C . n C 1 6 THR 6 79 79 THR THR C . n C 1 7 PRO 7 80 80 PRO PRO C . n C 1 8 PRO 8 81 81 PRO PRO C . n C 1 9 TYR 9 82 82 TYR TYR C . n C 1 10 LEU 10 83 83 LEU LEU C . n C 1 11 LYS 11 84 84 LYS LYS C . n C 1 12 TRP 12 85 85 TRP TRP C . n C 1 13 ALA 13 86 86 ALA ALA C . n C 1 14 GLU 14 87 87 GLU GLU C . n C 1 15 SER 15 88 88 SER SER C . n C 1 16 LEU 16 89 89 LEU LEU C . n C 1 17 HIS 17 90 90 HIS HIS C . n C 1 18 SER 18 91 91 SER SER C . n C 1 19 LEU 19 92 92 LEU LEU C . n C 1 20 LEU 20 93 93 LEU LEU C . n C 1 21 ASP 21 94 94 ASP ASP C . n C 1 22 ASP 22 95 95 ASP ASP C . n C 1 23 GLN 23 96 96 GLN GLN C . n C 1 24 ASP 24 97 97 ASP ASP C . n C 1 25 GLY 25 98 98 GLY GLY C . n C 1 26 ILE 26 99 99 ILE ILE C . n C 1 27 SER 27 100 100 SER SER C . n C 1 28 LEU 28 101 101 LEU LEU C . n C 1 29 PHE 29 102 102 PHE PHE C . n C 1 30 ARG 30 103 103 ARG ARG C . n C 1 31 THR 31 104 104 THR THR C . n C 1 32 PHE 32 105 105 PHE PHE C . n C 1 33 LEU 33 106 106 LEU LEU C . n C 1 34 LYS 34 107 107 LYS LYS C . n C 1 35 GLN 35 108 108 GLN GLN C . n C 1 36 GLU 36 109 109 GLU GLU C . n C 1 37 GLY 37 110 110 GLY GLY C . n C 1 38 CYS 38 111 111 CYS CYS C . n C 1 39 ALA 39 112 112 ALA ALA C . n C 1 40 ASP 40 113 113 ASP ASP C . n C 1 41 LEU 41 114 114 LEU LEU C . n C 1 42 LEU 42 115 115 LEU LEU C . n C 1 43 ASP 43 116 116 ASP ASP C . n C 1 44 PHE 44 117 117 PHE PHE C . n C 1 45 TRP 45 118 118 TRP TRP C . n C 1 46 PHE 46 119 119 PHE PHE C . n C 1 47 ALA 47 120 120 ALA ALA C . n C 1 48 CYS 48 121 121 CYS CYS C . n C 1 49 THR 49 122 122 THR THR C . n C 1 50 GLY 50 123 123 GLY GLY C . n C 1 51 PHE 51 124 124 PHE PHE C . n C 1 52 ARG 52 125 125 ARG ARG C . n C 1 53 LYS 53 126 126 LYS LYS C . n C 1 54 LEU 54 127 127 LEU LEU C . n C 1 55 GLU 55 128 128 GLU GLU C . n C 1 56 PRO 56 129 129 PRO PRO C . n C 1 57 CYS 57 130 130 CYS CYS C . n C 1 58 ASP 58 131 131 ASP ASP C . n C 1 59 SER 59 132 132 SER SER C . n C 1 60 ASN 60 133 133 ASN ASN C . n C 1 61 GLU 61 134 134 GLU GLU C . n C 1 62 GLU 62 135 135 GLU GLU C . n C 1 63 LYS 63 136 136 LYS LYS C . n C 1 64 ARG 64 137 137 ARG ARG C . n C 1 65 LEU 65 138 138 LEU LEU C . n C 1 66 LYS 66 139 139 LYS LYS C . n C 1 67 LEU 67 140 140 LEU LEU C . n C 1 68 ALA 68 141 141 ALA ALA C . n C 1 69 ARG 69 142 142 ARG ARG C . n C 1 70 ALA 70 143 143 ALA ALA C . n C 1 71 ILE 71 144 144 ILE ILE C . n C 1 72 TYR 72 145 145 TYR TYR C . n C 1 73 ARG 73 146 146 ARG ARG C . n C 1 74 LYS 74 147 147 LYS LYS C . n C 1 75 TYR 75 148 148 TYR TYR C . n C 1 76 ILE 76 149 149 ILE ILE C . n C 1 77 LEU 77 150 150 LEU LEU C . n C 1 78 ASP 78 151 151 ASP ASP C . n C 1 79 ASN 79 152 152 ASN ASN C . n C 1 80 ASN 80 153 153 ASN ASN C . n C 1 81 GLY 81 154 154 GLY GLY C . n C 1 82 ILE 82 155 155 ILE ILE C . n C 1 83 VAL 83 156 156 VAL VAL C . n C 1 84 SER 84 157 157 SER SER C . n C 1 85 ARG 85 158 158 ARG ARG C . n C 1 86 GLN 86 159 159 GLN GLN C . n C 1 87 THR 87 160 160 THR THR C . n C 1 88 LYS 88 161 161 LYS LYS C . n C 1 89 PRO 89 162 162 PRO PRO C . n C 1 90 ALA 90 163 163 ALA ALA C . n C 1 91 THR 91 164 164 THR THR C . n C 1 92 LYS 92 165 165 LYS LYS C . n C 1 93 SER 93 166 166 SER SER C . n C 1 94 PHE 94 167 167 PHE PHE C . n C 1 95 ILE 95 168 168 ILE ILE C . n C 1 96 LYS 96 169 169 LYS LYS C . n C 1 97 GLY 97 170 170 GLY GLY C . n C 1 98 CYS 98 171 171 CYS CYS C . n C 1 99 ILE 99 172 172 ILE ILE C . n C 1 100 MET 100 173 173 MET MET C . n C 1 101 LYS 101 174 174 LYS LYS C . n C 1 102 GLN 102 175 175 GLN GLN C . n C 1 103 LEU 103 176 176 LEU LEU C . n C 1 104 ILE 104 177 177 ILE ILE C . n C 1 105 ASP 105 178 178 ASP ASP C . n C 1 106 PRO 106 179 179 PRO PRO C . n C 1 107 ALA 107 180 180 ALA ALA C . n C 1 108 MET 108 181 181 MET MET C . n C 1 109 PHE 109 182 182 PHE PHE C . n C 1 110 ASP 110 183 183 ASP ASP C . n C 1 111 GLN 111 184 184 GLN GLN C . n C 1 112 ALA 112 185 185 ALA ALA C . n C 1 113 GLN 113 186 186 GLN GLN C . n C 1 114 THR 114 187 187 THR THR C . n C 1 115 GLU 115 188 188 GLU GLU C . n C 1 116 ILE 116 189 189 ILE ILE C . n C 1 117 GLN 117 190 190 GLN GLN C . n C 1 118 ALA 118 191 191 ALA ALA C . n C 1 119 THR 119 192 192 THR THR C . n C 1 120 MET 120 193 193 MET MET C . n C 1 121 GLU 121 194 194 GLU GLU C . n C 1 122 GLU 122 195 195 GLU GLU C . n C 1 123 ASN 123 196 196 ASN ASN C . n C 1 124 THR 124 197 197 THR THR C . n C 1 125 TYR 125 198 198 TYR TYR C . n C 1 126 PRO 126 199 199 PRO PRO C . n C 1 127 SER 127 200 200 SER SER C . n C 1 128 PHE 128 201 201 PHE PHE C . n C 1 129 LEU 129 202 202 LEU LEU C . n C 1 130 LYS 130 203 203 LYS LYS C . n C 1 131 SER 131 204 204 SER SER C . n C 1 132 ASP 132 205 205 ASP ASP C . n C 1 133 ILE 133 206 206 ILE ILE C . n C 1 134 TYR 134 207 207 TYR TYR C . n C 1 135 LEU 135 208 208 LEU LEU C . n C 1 136 GLU 136 209 209 GLU GLU C . n C 1 137 TYR 137 210 210 TYR TYR C . n C 1 138 THR 138 211 211 THR THR C . n C 1 139 ARG 139 212 212 ARG ARG C . n C 1 140 THR 140 213 213 THR THR C . n C 1 141 GLY 141 214 214 GLY GLY C . n C 1 142 SER 142 215 215 SER SER C . n C 1 143 GLU 143 216 ? ? ? C . n C 1 144 SER 144 217 ? ? ? C . n C 1 145 PRO 145 218 ? ? ? C . n C 1 146 LYS 146 219 ? ? ? C . n C 1 147 VAL 147 220 ? ? ? C . n D 1 1 GLY 1 74 ? ? ? D . n D 1 2 SER 2 75 ? ? ? D . n D 1 3 ALA 3 76 ? ? ? D . n D 1 4 SER 4 77 77 SER SER D . n D 1 5 PRO 5 78 78 PRO PRO D . n D 1 6 THR 6 79 79 THR THR D . n D 1 7 PRO 7 80 80 PRO PRO D . n D 1 8 PRO 8 81 81 PRO PRO D . n D 1 9 TYR 9 82 82 TYR TYR D . n D 1 10 LEU 10 83 83 LEU LEU D . n D 1 11 LYS 11 84 84 LYS LYS D . n D 1 12 TRP 12 85 85 TRP TRP D . n D 1 13 ALA 13 86 86 ALA ALA D . n D 1 14 GLU 14 87 87 GLU GLU D . n D 1 15 SER 15 88 88 SER SER D . n D 1 16 LEU 16 89 89 LEU LEU D . n D 1 17 HIS 17 90 90 HIS HIS D . n D 1 18 SER 18 91 91 SER SER D . n D 1 19 LEU 19 92 92 LEU LEU D . n D 1 20 LEU 20 93 93 LEU LEU D . n D 1 21 ASP 21 94 94 ASP ASP D . n D 1 22 ASP 22 95 95 ASP ASP D . n D 1 23 GLN 23 96 96 GLN GLN D . n D 1 24 ASP 24 97 97 ASP ASP D . n D 1 25 GLY 25 98 98 GLY GLY D . n D 1 26 ILE 26 99 99 ILE ILE D . n D 1 27 SER 27 100 100 SER SER D . n D 1 28 LEU 28 101 101 LEU LEU D . n D 1 29 PHE 29 102 102 PHE PHE D . n D 1 30 ARG 30 103 103 ARG ARG D . n D 1 31 THR 31 104 104 THR THR D . n D 1 32 PHE 32 105 105 PHE PHE D . n D 1 33 LEU 33 106 106 LEU LEU D . n D 1 34 LYS 34 107 107 LYS LYS D . n D 1 35 GLN 35 108 108 GLN GLN D . n D 1 36 GLU 36 109 109 GLU GLU D . n D 1 37 GLY 37 110 110 GLY GLY D . n D 1 38 CYS 38 111 111 CYS CYS D . n D 1 39 ALA 39 112 112 ALA ALA D . n D 1 40 ASP 40 113 113 ASP ASP D . n D 1 41 LEU 41 114 114 LEU LEU D . n D 1 42 LEU 42 115 115 LEU LEU D . n D 1 43 ASP 43 116 116 ASP ASP D . n D 1 44 PHE 44 117 117 PHE PHE D . n D 1 45 TRP 45 118 118 TRP TRP D . n D 1 46 PHE 46 119 119 PHE PHE D . n D 1 47 ALA 47 120 120 ALA ALA D . n D 1 48 CYS 48 121 121 CYS CYS D . n D 1 49 THR 49 122 122 THR THR D . n D 1 50 GLY 50 123 123 GLY GLY D . n D 1 51 PHE 51 124 124 PHE PHE D . n D 1 52 ARG 52 125 125 ARG ARG D . n D 1 53 LYS 53 126 126 LYS LYS D . n D 1 54 LEU 54 127 127 LEU LEU D . n D 1 55 GLU 55 128 128 GLU GLU D . n D 1 56 PRO 56 129 129 PRO PRO D . n D 1 57 CYS 57 130 130 CYS CYS D . n D 1 58 ASP 58 131 131 ASP ASP D . n D 1 59 SER 59 132 132 SER SER D . n D 1 60 ASN 60 133 133 ASN ASN D . n D 1 61 GLU 61 134 134 GLU GLU D . n D 1 62 GLU 62 135 135 GLU GLU D . n D 1 63 LYS 63 136 136 LYS LYS D . n D 1 64 ARG 64 137 137 ARG ARG D . n D 1 65 LEU 65 138 138 LEU LEU D . n D 1 66 LYS 66 139 139 LYS LYS D . n D 1 67 LEU 67 140 140 LEU LEU D . n D 1 68 ALA 68 141 141 ALA ALA D . n D 1 69 ARG 69 142 142 ARG ARG D . n D 1 70 ALA 70 143 143 ALA ALA D . n D 1 71 ILE 71 144 144 ILE ILE D . n D 1 72 TYR 72 145 145 TYR TYR D . n D 1 73 ARG 73 146 146 ARG ARG D . n D 1 74 LYS 74 147 147 LYS LYS D . n D 1 75 TYR 75 148 148 TYR TYR D . n D 1 76 ILE 76 149 149 ILE ILE D . n D 1 77 LEU 77 150 150 LEU LEU D . n D 1 78 ASP 78 151 151 ASP ASP D . n D 1 79 ASN 79 152 152 ASN ASN D . n D 1 80 ASN 80 153 153 ASN ASN D . n D 1 81 GLY 81 154 154 GLY GLY D . n D 1 82 ILE 82 155 155 ILE ILE D . n D 1 83 VAL 83 156 156 VAL VAL D . n D 1 84 SER 84 157 157 SER SER D . n D 1 85 ARG 85 158 158 ARG ARG D . n D 1 86 GLN 86 159 159 GLN GLN D . n D 1 87 THR 87 160 160 THR THR D . n D 1 88 LYS 88 161 161 LYS LYS D . n D 1 89 PRO 89 162 162 PRO PRO D . n D 1 90 ALA 90 163 163 ALA ALA D . n D 1 91 THR 91 164 164 THR THR D . n D 1 92 LYS 92 165 165 LYS LYS D . n D 1 93 SER 93 166 166 SER SER D . n D 1 94 PHE 94 167 167 PHE PHE D . n D 1 95 ILE 95 168 168 ILE ILE D . n D 1 96 LYS 96 169 169 LYS LYS D . n D 1 97 GLY 97 170 170 GLY GLY D . n D 1 98 CYS 98 171 171 CYS CYS D . n D 1 99 ILE 99 172 172 ILE ILE D . n D 1 100 MET 100 173 173 MET MET D . n D 1 101 LYS 101 174 174 LYS LYS D . n D 1 102 GLN 102 175 175 GLN GLN D . n D 1 103 LEU 103 176 176 LEU LEU D . n D 1 104 ILE 104 177 177 ILE ILE D . n D 1 105 ASP 105 178 178 ASP ASP D . n D 1 106 PRO 106 179 179 PRO PRO D . n D 1 107 ALA 107 180 180 ALA ALA D . n D 1 108 MET 108 181 181 MET MET D . n D 1 109 PHE 109 182 182 PHE PHE D . n D 1 110 ASP 110 183 183 ASP ASP D . n D 1 111 GLN 111 184 184 GLN GLN D . n D 1 112 ALA 112 185 185 ALA ALA D . n D 1 113 GLN 113 186 186 GLN GLN D . n D 1 114 THR 114 187 187 THR THR D . n D 1 115 GLU 115 188 188 GLU GLU D . n D 1 116 ILE 116 189 189 ILE ILE D . n D 1 117 GLN 117 190 190 GLN GLN D . n D 1 118 ALA 118 191 191 ALA ALA D . n D 1 119 THR 119 192 192 THR THR D . n D 1 120 MET 120 193 193 MET MET D . n D 1 121 GLU 121 194 194 GLU GLU D . n D 1 122 GLU 122 195 195 GLU GLU D . n D 1 123 ASN 123 196 196 ASN ASN D . n D 1 124 THR 124 197 197 THR THR D . n D 1 125 TYR 125 198 198 TYR TYR D . n D 1 126 PRO 126 199 199 PRO PRO D . n D 1 127 SER 127 200 200 SER SER D . n D 1 128 PHE 128 201 201 PHE PHE D . n D 1 129 LEU 129 202 202 LEU LEU D . n D 1 130 LYS 130 203 203 LYS LYS D . n D 1 131 SER 131 204 204 SER SER D . n D 1 132 ASP 132 205 205 ASP ASP D . n D 1 133 ILE 133 206 206 ILE ILE D . n D 1 134 TYR 134 207 207 TYR TYR D . n D 1 135 LEU 135 208 208 LEU LEU D . n D 1 136 GLU 136 209 209 GLU GLU D . n D 1 137 TYR 137 210 210 TYR TYR D . n D 1 138 THR 138 211 211 THR THR D . n D 1 139 ARG 139 212 212 ARG ARG D . n D 1 140 THR 140 213 213 THR THR D . n D 1 141 GLY 141 214 214 GLY GLY D . n D 1 142 SER 142 215 215 SER SER D . n D 1 143 GLU 143 216 ? ? ? D . n D 1 144 SER 144 217 ? ? ? D . n D 1 145 PRO 145 218 ? ? ? D . n D 1 146 LYS 146 219 ? ? ? D . n D 1 147 VAL 147 220 ? ? ? D . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email yuchi@tju.edu.cn _pdbx_contact_author.name_first Zhiguang _pdbx_contact_author.name_last Yuchi _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2595-9106 # _pdbx_nonpoly_scheme.asym_id E _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id I5L _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 301 _pdbx_nonpoly_scheme.auth_seq_num 5 _pdbx_nonpoly_scheme.pdb_mon_id I5L _pdbx_nonpoly_scheme.auth_mon_id LIG _pdbx_nonpoly_scheme.pdb_strand_id B _pdbx_nonpoly_scheme.pdb_ins_code . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? monomeric 1 2 author_defined_assembly ? monomeric 1 3 author_defined_assembly ? monomeric 1 4 author_defined_assembly ? monomeric 1 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A 2 1 B,E 3 1 C 4 1 D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2023-12-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.14_3247 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _pdbx_entry_details.entry_id 7Y1P _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OH _pdbx_validate_close_contact.auth_asym_id_1 B _pdbx_validate_close_contact.auth_comp_id_1 TYR _pdbx_validate_close_contact.auth_seq_id_1 148 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O19 _pdbx_validate_close_contact.auth_asym_id_2 B _pdbx_validate_close_contact.auth_comp_id_2 I5L _pdbx_validate_close_contact.auth_seq_id_2 301 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.02 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CB A CYS 111 ? ? SG A CYS 111 ? ? 1.700 1.812 -0.112 0.016 N 2 1 CB B CYS 111 ? ? SG B CYS 111 ? ? 1.708 1.812 -0.104 0.016 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A GLU 87 ? ? CB A GLU 87 ? ? CG A GLU 87 ? ? 139.05 113.40 25.65 2.20 N 2 1 N D HIS 90 ? ? CA D HIS 90 ? ? CB D HIS 90 ? ? 98.40 110.60 -12.20 1.80 N 3 1 CB D ASN 133 ? ? CA D ASN 133 ? ? C D ASN 133 ? ? 93.04 110.40 -17.36 2.00 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 177 ? ? -102.09 62.12 2 1 ASN A 196 ? ? -140.48 -63.87 3 1 ASN B 196 ? ? -139.88 -65.08 4 1 LYS C 126 ? ? -73.73 -76.76 5 1 LEU C 127 ? ? -17.94 124.88 6 1 PRO C 129 ? ? -66.42 49.31 7 1 CYS C 130 ? ? -66.69 -127.23 8 1 ASP C 131 ? ? -162.66 -20.53 9 1 GLU C 134 ? ? -149.62 -33.28 10 1 ASN C 196 ? ? -142.47 -59.72 11 1 THR C 213 ? ? -111.80 61.74 12 1 ASN D 196 ? ? -141.60 -64.34 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 ASN _pdbx_validate_peptide_omega.auth_asym_id_1 D _pdbx_validate_peptide_omega.auth_seq_id_1 133 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 GLU _pdbx_validate_peptide_omega.auth_asym_id_2 D _pdbx_validate_peptide_omega.auth_seq_id_2 134 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -142.26 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id HIS _pdbx_validate_planes.auth_asym_id D _pdbx_validate_planes.auth_seq_id 90 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.073 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A THR 79 ? OG1 ? A THR 6 OG1 2 1 Y 1 A THR 79 ? CG2 ? A THR 6 CG2 3 1 Y 1 A GLN 96 ? CG ? A GLN 23 CG 4 1 Y 1 A GLN 96 ? CD ? A GLN 23 CD 5 1 Y 1 A GLN 96 ? OE1 ? A GLN 23 OE1 6 1 Y 1 A GLN 96 ? NE2 ? A GLN 23 NE2 7 1 Y 1 A GLU 128 ? CG ? A GLU 55 CG 8 1 Y 1 A GLU 128 ? CD ? A GLU 55 CD 9 1 Y 1 A GLU 128 ? OE1 ? A GLU 55 OE1 10 1 Y 1 A GLU 128 ? OE2 ? A GLU 55 OE2 11 1 Y 1 A GLU 195 ? CG ? A GLU 122 CG 12 1 Y 1 A GLU 195 ? CD ? A GLU 122 CD 13 1 Y 1 A GLU 195 ? OE1 ? A GLU 122 OE1 14 1 Y 1 A GLU 195 ? OE2 ? A GLU 122 OE2 15 1 Y 1 A SER 215 ? OG ? A SER 142 OG 16 1 Y 1 B THR 79 ? OG1 ? B THR 6 OG1 17 1 Y 1 B THR 79 ? CG2 ? B THR 6 CG2 18 1 Y 1 B GLN 96 ? CG ? B GLN 23 CG 19 1 Y 1 B GLN 96 ? CD ? B GLN 23 CD 20 1 Y 1 B GLN 96 ? OE1 ? B GLN 23 OE1 21 1 Y 1 B GLN 96 ? NE2 ? B GLN 23 NE2 22 1 Y 1 B GLU 128 ? CG ? B GLU 55 CG 23 1 Y 1 B GLU 128 ? CD ? B GLU 55 CD 24 1 Y 1 B GLU 128 ? OE1 ? B GLU 55 OE1 25 1 Y 1 B GLU 128 ? OE2 ? B GLU 55 OE2 26 1 Y 1 B LYS 139 ? CG ? B LYS 66 CG 27 1 Y 1 B LYS 139 ? CD ? B LYS 66 CD 28 1 Y 1 B LYS 139 ? CE ? B LYS 66 CE 29 1 Y 1 B LYS 139 ? NZ ? B LYS 66 NZ 30 1 Y 1 B GLU 195 ? CG ? B GLU 122 CG 31 1 Y 1 B GLU 195 ? CD ? B GLU 122 CD 32 1 Y 1 B GLU 195 ? OE1 ? B GLU 122 OE1 33 1 Y 1 B GLU 195 ? OE2 ? B GLU 122 OE2 34 1 Y 1 B SER 215 ? OG ? B SER 142 OG 35 1 Y 1 C THR 79 ? OG1 ? C THR 6 OG1 36 1 Y 1 C THR 79 ? CG2 ? C THR 6 CG2 37 1 Y 1 C GLN 96 ? CG ? C GLN 23 CG 38 1 Y 1 C GLN 96 ? CD ? C GLN 23 CD 39 1 Y 1 C GLN 96 ? OE1 ? C GLN 23 OE1 40 1 Y 1 C GLN 96 ? NE2 ? C GLN 23 NE2 41 1 Y 1 C LYS 107 ? CG ? C LYS 34 CG 42 1 Y 1 C LYS 107 ? CD ? C LYS 34 CD 43 1 Y 1 C LYS 107 ? CE ? C LYS 34 CE 44 1 Y 1 C LYS 107 ? NZ ? C LYS 34 NZ 45 1 Y 1 C LYS 126 ? CG ? C LYS 53 CG 46 1 Y 1 C LYS 126 ? CD ? C LYS 53 CD 47 1 Y 1 C LYS 126 ? CE ? C LYS 53 CE 48 1 Y 1 C LYS 126 ? NZ ? C LYS 53 NZ 49 1 Y 1 C LEU 127 ? CG ? C LEU 54 CG 50 1 Y 1 C LEU 127 ? CD1 ? C LEU 54 CD1 51 1 Y 1 C LEU 127 ? CD2 ? C LEU 54 CD2 52 1 Y 1 C GLU 128 ? CG ? C GLU 55 CG 53 1 Y 1 C GLU 128 ? CD ? C GLU 55 CD 54 1 Y 1 C GLU 128 ? OE1 ? C GLU 55 OE1 55 1 Y 1 C GLU 128 ? OE2 ? C GLU 55 OE2 56 1 Y 1 C CYS 130 ? SG ? C CYS 57 SG 57 1 Y 1 C ASP 131 ? CG ? C ASP 58 CG 58 1 Y 1 C ASP 131 ? OD1 ? C ASP 58 OD1 59 1 Y 1 C ASP 131 ? OD2 ? C ASP 58 OD2 60 1 Y 1 C SER 132 ? OG ? C SER 59 OG 61 1 Y 1 C GLU 134 ? CG ? C GLU 61 CG 62 1 Y 1 C GLU 134 ? CD ? C GLU 61 CD 63 1 Y 1 C GLU 134 ? OE1 ? C GLU 61 OE1 64 1 Y 1 C GLU 134 ? OE2 ? C GLU 61 OE2 65 1 Y 1 C LYS 136 ? CG ? C LYS 63 CG 66 1 Y 1 C LYS 136 ? CD ? C LYS 63 CD 67 1 Y 1 C LYS 136 ? CE ? C LYS 63 CE 68 1 Y 1 C LYS 136 ? NZ ? C LYS 63 NZ 69 1 Y 1 C LYS 139 ? CG ? C LYS 66 CG 70 1 Y 1 C LYS 139 ? CD ? C LYS 66 CD 71 1 Y 1 C LYS 139 ? CE ? C LYS 66 CE 72 1 Y 1 C LYS 139 ? NZ ? C LYS 66 NZ 73 1 Y 1 C LYS 161 ? CG ? C LYS 88 CG 74 1 Y 1 C LYS 161 ? CD ? C LYS 88 CD 75 1 Y 1 C LYS 161 ? CE ? C LYS 88 CE 76 1 Y 1 C LYS 161 ? NZ ? C LYS 88 NZ 77 1 Y 1 C LEU 176 ? CG ? C LEU 103 CG 78 1 Y 1 C LEU 176 ? CD1 ? C LEU 103 CD1 79 1 Y 1 C LEU 176 ? CD2 ? C LEU 103 CD2 80 1 Y 1 C GLU 195 ? CG ? C GLU 122 CG 81 1 Y 1 C GLU 195 ? CD ? C GLU 122 CD 82 1 Y 1 C GLU 195 ? OE1 ? C GLU 122 OE1 83 1 Y 1 C GLU 195 ? OE2 ? C GLU 122 OE2 84 1 Y 1 C ASP 205 ? CG ? C ASP 132 CG 85 1 Y 1 C ASP 205 ? OD1 ? C ASP 132 OD1 86 1 Y 1 C ASP 205 ? OD2 ? C ASP 132 OD2 87 1 Y 1 C SER 215 ? OG ? C SER 142 OG 88 1 Y 1 D THR 79 ? OG1 ? D THR 6 OG1 89 1 Y 1 D THR 79 ? CG2 ? D THR 6 CG2 90 1 Y 1 D GLN 96 ? CG ? D GLN 23 CG 91 1 Y 1 D GLN 96 ? CD ? D GLN 23 CD 92 1 Y 1 D GLN 96 ? OE1 ? D GLN 23 OE1 93 1 Y 1 D GLN 96 ? NE2 ? D GLN 23 NE2 94 1 Y 1 D ARG 103 ? CG ? D ARG 30 CG 95 1 Y 1 D ARG 103 ? CD ? D ARG 30 CD 96 1 Y 1 D ARG 103 ? NE ? D ARG 30 NE 97 1 Y 1 D ARG 103 ? CZ ? D ARG 30 CZ 98 1 Y 1 D ARG 103 ? NH1 ? D ARG 30 NH1 99 1 Y 1 D ARG 103 ? NH2 ? D ARG 30 NH2 100 1 Y 1 D LYS 126 ? CG ? D LYS 53 CG 101 1 Y 1 D LYS 126 ? CD ? D LYS 53 CD 102 1 Y 1 D LYS 126 ? CE ? D LYS 53 CE 103 1 Y 1 D LYS 126 ? NZ ? D LYS 53 NZ 104 1 Y 1 D GLU 128 ? CG ? D GLU 55 CG 105 1 Y 1 D GLU 128 ? CD ? D GLU 55 CD 106 1 Y 1 D GLU 128 ? OE1 ? D GLU 55 OE1 107 1 Y 1 D GLU 128 ? OE2 ? D GLU 55 OE2 108 1 Y 1 D GLU 135 ? CG ? D GLU 62 CG 109 1 Y 1 D GLU 135 ? CD ? D GLU 62 CD 110 1 Y 1 D GLU 135 ? OE1 ? D GLU 62 OE1 111 1 Y 1 D GLU 135 ? OE2 ? D GLU 62 OE2 112 1 Y 1 D LYS 136 ? CG ? D LYS 63 CG 113 1 Y 1 D LYS 136 ? CD ? D LYS 63 CD 114 1 Y 1 D LYS 136 ? CE ? D LYS 63 CE 115 1 Y 1 D LYS 136 ? NZ ? D LYS 63 NZ 116 1 Y 1 D ARG 137 ? CG ? D ARG 64 CG 117 1 Y 1 D ARG 137 ? CD ? D ARG 64 CD 118 1 Y 1 D ARG 137 ? NE ? D ARG 64 NE 119 1 Y 1 D ARG 137 ? CZ ? D ARG 64 CZ 120 1 Y 1 D ARG 137 ? NH1 ? D ARG 64 NH1 121 1 Y 1 D ARG 137 ? NH2 ? D ARG 64 NH2 122 1 Y 1 D LYS 139 ? CG ? D LYS 66 CG 123 1 Y 1 D LYS 139 ? CD ? D LYS 66 CD 124 1 Y 1 D LYS 139 ? CE ? D LYS 66 CE 125 1 Y 1 D LYS 139 ? NZ ? D LYS 66 NZ 126 1 Y 1 D LYS 169 ? CG ? D LYS 96 CG 127 1 Y 1 D LYS 169 ? CD ? D LYS 96 CD 128 1 Y 1 D LYS 169 ? CE ? D LYS 96 CE 129 1 Y 1 D LYS 169 ? NZ ? D LYS 96 NZ 130 1 Y 1 D GLU 195 ? CG ? D GLU 122 CG 131 1 Y 1 D GLU 195 ? CD ? D GLU 122 CD 132 1 Y 1 D GLU 195 ? OE1 ? D GLU 122 OE1 133 1 Y 1 D GLU 195 ? OE2 ? D GLU 122 OE2 134 1 Y 1 D GLU 209 ? CG ? D GLU 136 CG 135 1 Y 1 D GLU 209 ? CD ? D GLU 136 CD 136 1 Y 1 D GLU 209 ? OE1 ? D GLU 136 OE1 137 1 Y 1 D GLU 209 ? OE2 ? D GLU 136 OE2 138 1 Y 1 D SER 215 ? OG ? D SER 142 OG # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 74 ? A GLY 1 2 1 Y 1 A SER 75 ? A SER 2 3 1 Y 1 A ALA 76 ? A ALA 3 4 1 Y 1 A GLU 216 ? A GLU 143 5 1 Y 1 A SER 217 ? A SER 144 6 1 Y 1 A PRO 218 ? A PRO 145 7 1 Y 1 A LYS 219 ? A LYS 146 8 1 Y 1 A VAL 220 ? A VAL 147 9 1 Y 1 B GLY 74 ? B GLY 1 10 1 Y 1 B SER 75 ? B SER 2 11 1 Y 1 B ALA 76 ? B ALA 3 12 1 Y 1 B GLU 216 ? B GLU 143 13 1 Y 1 B SER 217 ? B SER 144 14 1 Y 1 B PRO 218 ? B PRO 145 15 1 Y 1 B LYS 219 ? B LYS 146 16 1 Y 1 B VAL 220 ? B VAL 147 17 1 Y 1 C GLY 74 ? C GLY 1 18 1 Y 1 C SER 75 ? C SER 2 19 1 Y 1 C ALA 76 ? C ALA 3 20 1 Y 1 C GLU 216 ? C GLU 143 21 1 Y 1 C SER 217 ? C SER 144 22 1 Y 1 C PRO 218 ? C PRO 145 23 1 Y 1 C LYS 219 ? C LYS 146 24 1 Y 1 C VAL 220 ? C VAL 147 25 1 Y 1 D GLY 74 ? D GLY 1 26 1 Y 1 D SER 75 ? D SER 2 27 1 Y 1 D ALA 76 ? D ALA 3 28 1 Y 1 D GLU 216 ? D GLU 143 29 1 Y 1 D SER 217 ? D SER 144 30 1 Y 1 D PRO 218 ? D PRO 145 31 1 Y 1 D LYS 219 ? D LYS 146 32 1 Y 1 D VAL 220 ? D VAL 147 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 I5L C10 C Y N 158 I5L C13 C Y N 159 I5L C15 C N N 160 I5L C17 C N N 161 I5L C20 C N N 162 I5L C01 C Y N 163 I5L C02 C Y N 164 I5L C03 C Y N 165 I5L C04 C Y N 166 I5L C05 C Y N 167 I5L C06 C Y N 168 I5L C08 C Y N 169 I5L C09 C Y N 170 I5L C11 C Y N 171 I5L C12 C Y N 172 I5L C14 C N N 173 I5L C16 C N N 174 I5L C18 C N N 175 I5L O07 O Y N 176 I5L O19 O N N 177 I5L O21 O N N 178 I5L H1 H N N 179 I5L H2 H N N 180 I5L H3 H N N 181 I5L H4 H N N 182 I5L H5 H N N 183 I5L H6 H N N 184 I5L H7 H N N 185 I5L H8 H N N 186 I5L H9 H N N 187 I5L H10 H N N 188 I5L H11 H N N 189 I5L H12 H N N 190 I5L H13 H N N 191 I5L H14 H N N 192 ILE N N N N 193 ILE CA C N S 194 ILE C C N N 195 ILE O O N N 196 ILE CB C N S 197 ILE CG1 C N N 198 ILE CG2 C N N 199 ILE CD1 C N N 200 ILE OXT O N N 201 ILE H H N N 202 ILE H2 H N N 203 ILE HA H N N 204 ILE HB H N N 205 ILE HG12 H N N 206 ILE HG13 H N N 207 ILE HG21 H N N 208 ILE HG22 H N N 209 ILE HG23 H N N 210 ILE HD11 H N N 211 ILE HD12 H N N 212 ILE HD13 H N N 213 ILE HXT H N N 214 LEU N N N N 215 LEU CA C N S 216 LEU C C N N 217 LEU O O N N 218 LEU CB C N N 219 LEU CG C N N 220 LEU CD1 C N N 221 LEU CD2 C N N 222 LEU OXT O N N 223 LEU H H N N 224 LEU H2 H N N 225 LEU HA H N N 226 LEU HB2 H N N 227 LEU HB3 H N N 228 LEU HG H N N 229 LEU HD11 H N N 230 LEU HD12 H N N 231 LEU HD13 H N N 232 LEU HD21 H N N 233 LEU HD22 H N N 234 LEU HD23 H N N 235 LEU HXT H N N 236 LYS N N N N 237 LYS CA C N S 238 LYS C C N N 239 LYS O O N N 240 LYS CB C N N 241 LYS CG C N N 242 LYS CD C N N 243 LYS CE C N N 244 LYS NZ N N N 245 LYS OXT O N N 246 LYS H H N N 247 LYS H2 H N N 248 LYS HA H N N 249 LYS HB2 H N N 250 LYS HB3 H N N 251 LYS HG2 H N N 252 LYS HG3 H N N 253 LYS HD2 H N N 254 LYS HD3 H N N 255 LYS HE2 H N N 256 LYS HE3 H N N 257 LYS HZ1 H N N 258 LYS HZ2 H N N 259 LYS HZ3 H N N 260 LYS HXT H N N 261 MET N N N N 262 MET CA C N S 263 MET C C N N 264 MET O O N N 265 MET CB C N N 266 MET CG C N N 267 MET SD S N N 268 MET CE C N N 269 MET OXT O N N 270 MET H H N N 271 MET H2 H N N 272 MET HA H N N 273 MET HB2 H N N 274 MET HB3 H N N 275 MET HG2 H N N 276 MET HG3 H N N 277 MET HE1 H N N 278 MET HE2 H N N 279 MET HE3 H N N 280 MET HXT H N N 281 PHE N N N N 282 PHE CA C N S 283 PHE C C N N 284 PHE O O N N 285 PHE CB C N N 286 PHE CG C Y N 287 PHE CD1 C Y N 288 PHE CD2 C Y N 289 PHE CE1 C Y N 290 PHE CE2 C Y N 291 PHE CZ C Y N 292 PHE OXT O N N 293 PHE H H N N 294 PHE H2 H N N 295 PHE HA H N N 296 PHE HB2 H N N 297 PHE HB3 H N N 298 PHE HD1 H N N 299 PHE HD2 H N N 300 PHE HE1 H N N 301 PHE HE2 H N N 302 PHE HZ H N N 303 PHE HXT H N N 304 PRO N N N N 305 PRO CA C N S 306 PRO C C N N 307 PRO O O N N 308 PRO CB C N N 309 PRO CG C N N 310 PRO CD C N N 311 PRO OXT O N N 312 PRO H H N N 313 PRO HA H N N 314 PRO HB2 H N N 315 PRO HB3 H N N 316 PRO HG2 H N N 317 PRO HG3 H N N 318 PRO HD2 H N N 319 PRO HD3 H N N 320 PRO HXT H N N 321 SER N N N N 322 SER CA C N S 323 SER C C N N 324 SER O O N N 325 SER CB C N N 326 SER OG O N N 327 SER OXT O N N 328 SER H H N N 329 SER H2 H N N 330 SER HA H N N 331 SER HB2 H N N 332 SER HB3 H N N 333 SER HG H N N 334 SER HXT H N N 335 THR N N N N 336 THR CA C N S 337 THR C C N N 338 THR O O N N 339 THR CB C N R 340 THR OG1 O N N 341 THR CG2 C N N 342 THR OXT O N N 343 THR H H N N 344 THR H2 H N N 345 THR HA H N N 346 THR HB H N N 347 THR HG1 H N N 348 THR HG21 H N N 349 THR HG22 H N N 350 THR HG23 H N N 351 THR HXT H N N 352 TRP N N N N 353 TRP CA C N S 354 TRP C C N N 355 TRP O O N N 356 TRP CB C N N 357 TRP CG C Y N 358 TRP CD1 C Y N 359 TRP CD2 C Y N 360 TRP NE1 N Y N 361 TRP CE2 C Y N 362 TRP CE3 C Y N 363 TRP CZ2 C Y N 364 TRP CZ3 C Y N 365 TRP CH2 C Y N 366 TRP OXT O N N 367 TRP H H N N 368 TRP H2 H N N 369 TRP HA H N N 370 TRP HB2 H N N 371 TRP HB3 H N N 372 TRP HD1 H N N 373 TRP HE1 H N N 374 TRP HE3 H N N 375 TRP HZ2 H N N 376 TRP HZ3 H N N 377 TRP HH2 H N N 378 TRP HXT H N N 379 TYR N N N N 380 TYR CA C N S 381 TYR C C N N 382 TYR O O N N 383 TYR CB C N N 384 TYR CG C Y N 385 TYR CD1 C Y N 386 TYR CD2 C Y N 387 TYR CE1 C Y N 388 TYR CE2 C Y N 389 TYR CZ C Y N 390 TYR OH O N N 391 TYR OXT O N N 392 TYR H H N N 393 TYR H2 H N N 394 TYR HA H N N 395 TYR HB2 H N N 396 TYR HB3 H N N 397 TYR HD1 H N N 398 TYR HD2 H N N 399 TYR HE1 H N N 400 TYR HE2 H N N 401 TYR HH H N N 402 TYR HXT H N N 403 VAL N N N N 404 VAL CA C N S 405 VAL C C N N 406 VAL O O N N 407 VAL CB C N N 408 VAL CG1 C N N 409 VAL CG2 C N N 410 VAL OXT O N N 411 VAL H H N N 412 VAL H2 H N N 413 VAL HA H N N 414 VAL HB H N N 415 VAL HG11 H N N 416 VAL HG12 H N N 417 VAL HG13 H N N 418 VAL HG21 H N N 419 VAL HG22 H N N 420 VAL HG23 H N N 421 VAL HXT H N N 422 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 I5L C12 C11 doub Y N 150 I5L C12 C13 sing Y N 151 I5L C18 C17 sing N N 152 I5L C11 C10 sing Y N 153 I5L C13 C09 doub Y N 154 I5L C17 C16 doub N Z 155 I5L C17 C20 sing N N 156 I5L C16 C15 sing N N 157 I5L C10 C14 sing N N 158 I5L C10 C08 doub Y N 159 I5L C09 C08 sing Y N 160 I5L C09 C05 sing Y N 161 I5L O21 C20 doub N N 162 I5L C15 C14 doub N Z 163 I5L C08 O07 sing Y N 164 I5L C06 C05 doub Y N 165 I5L C06 C01 sing Y N 166 I5L C05 C04 sing Y N 167 I5L O07 C04 sing Y N 168 I5L C04 C03 doub Y N 169 I5L C01 O19 sing N N 170 I5L C01 C02 doub Y N 171 I5L C02 C03 sing Y N 172 I5L C13 H1 sing N N 173 I5L C15 H2 sing N N 174 I5L C20 H3 sing N N 175 I5L C02 H4 sing N N 176 I5L C03 H5 sing N N 177 I5L C06 H6 sing N N 178 I5L C11 H7 sing N N 179 I5L C12 H8 sing N N 180 I5L C14 H9 sing N N 181 I5L C16 H10 sing N N 182 I5L C18 H11 sing N N 183 I5L C18 H12 sing N N 184 I5L C18 H13 sing N N 185 I5L O19 H14 sing N N 186 ILE N CA sing N N 187 ILE N H sing N N 188 ILE N H2 sing N N 189 ILE CA C sing N N 190 ILE CA CB sing N N 191 ILE CA HA sing N N 192 ILE C O doub N N 193 ILE C OXT sing N N 194 ILE CB CG1 sing N N 195 ILE CB CG2 sing N N 196 ILE CB HB sing N N 197 ILE CG1 CD1 sing N N 198 ILE CG1 HG12 sing N N 199 ILE CG1 HG13 sing N N 200 ILE CG2 HG21 sing N N 201 ILE CG2 HG22 sing N N 202 ILE CG2 HG23 sing N N 203 ILE CD1 HD11 sing N N 204 ILE CD1 HD12 sing N N 205 ILE CD1 HD13 sing N N 206 ILE OXT HXT sing N N 207 LEU N CA sing N N 208 LEU N H sing N N 209 LEU N H2 sing N N 210 LEU CA C sing N N 211 LEU CA CB sing N N 212 LEU CA HA sing N N 213 LEU C O doub N N 214 LEU C OXT sing N N 215 LEU CB CG sing N N 216 LEU CB HB2 sing N N 217 LEU CB HB3 sing N N 218 LEU CG CD1 sing N N 219 LEU CG CD2 sing N N 220 LEU CG HG sing N N 221 LEU CD1 HD11 sing N N 222 LEU CD1 HD12 sing N N 223 LEU CD1 HD13 sing N N 224 LEU CD2 HD21 sing N N 225 LEU CD2 HD22 sing N N 226 LEU CD2 HD23 sing N N 227 LEU OXT HXT sing N N 228 LYS N CA sing N N 229 LYS N H sing N N 230 LYS N H2 sing N N 231 LYS CA C sing N N 232 LYS CA CB sing N N 233 LYS CA HA sing N N 234 LYS C O doub N N 235 LYS C OXT sing N N 236 LYS CB CG sing N N 237 LYS CB HB2 sing N N 238 LYS CB HB3 sing N N 239 LYS CG CD sing N N 240 LYS CG HG2 sing N N 241 LYS CG HG3 sing N N 242 LYS CD CE sing N N 243 LYS CD HD2 sing N N 244 LYS CD HD3 sing N N 245 LYS CE NZ sing N N 246 LYS CE HE2 sing N N 247 LYS CE HE3 sing N N 248 LYS NZ HZ1 sing N N 249 LYS NZ HZ2 sing N N 250 LYS NZ HZ3 sing N N 251 LYS OXT HXT sing N N 252 MET N CA sing N N 253 MET N H sing N N 254 MET N H2 sing N N 255 MET CA C sing N N 256 MET CA CB sing N N 257 MET CA HA sing N N 258 MET C O doub N N 259 MET C OXT sing N N 260 MET CB CG sing N N 261 MET CB HB2 sing N N 262 MET CB HB3 sing N N 263 MET CG SD sing N N 264 MET CG HG2 sing N N 265 MET CG HG3 sing N N 266 MET SD CE sing N N 267 MET CE HE1 sing N N 268 MET CE HE2 sing N N 269 MET CE HE3 sing N N 270 MET OXT HXT sing N N 271 PHE N CA sing N N 272 PHE N H sing N N 273 PHE N H2 sing N N 274 PHE CA C sing N N 275 PHE CA CB sing N N 276 PHE CA HA sing N N 277 PHE C O doub N N 278 PHE C OXT sing N N 279 PHE CB CG sing N N 280 PHE CB HB2 sing N N 281 PHE CB HB3 sing N N 282 PHE CG CD1 doub Y N 283 PHE CG CD2 sing Y N 284 PHE CD1 CE1 sing Y N 285 PHE CD1 HD1 sing N N 286 PHE CD2 CE2 doub Y N 287 PHE CD2 HD2 sing N N 288 PHE CE1 CZ doub Y N 289 PHE CE1 HE1 sing N N 290 PHE CE2 CZ sing Y N 291 PHE CE2 HE2 sing N N 292 PHE CZ HZ sing N N 293 PHE OXT HXT sing N N 294 PRO N CA sing N N 295 PRO N CD sing N N 296 PRO N H sing N N 297 PRO CA C sing N N 298 PRO CA CB sing N N 299 PRO CA HA sing N N 300 PRO C O doub N N 301 PRO C OXT sing N N 302 PRO CB CG sing N N 303 PRO CB HB2 sing N N 304 PRO CB HB3 sing N N 305 PRO CG CD sing N N 306 PRO CG HG2 sing N N 307 PRO CG HG3 sing N N 308 PRO CD HD2 sing N N 309 PRO CD HD3 sing N N 310 PRO OXT HXT sing N N 311 SER N CA sing N N 312 SER N H sing N N 313 SER N H2 sing N N 314 SER CA C sing N N 315 SER CA CB sing N N 316 SER CA HA sing N N 317 SER C O doub N N 318 SER C OXT sing N N 319 SER CB OG sing N N 320 SER CB HB2 sing N N 321 SER CB HB3 sing N N 322 SER OG HG sing N N 323 SER OXT HXT sing N N 324 THR N CA sing N N 325 THR N H sing N N 326 THR N H2 sing N N 327 THR CA C sing N N 328 THR CA CB sing N N 329 THR CA HA sing N N 330 THR C O doub N N 331 THR C OXT sing N N 332 THR CB OG1 sing N N 333 THR CB CG2 sing N N 334 THR CB HB sing N N 335 THR OG1 HG1 sing N N 336 THR CG2 HG21 sing N N 337 THR CG2 HG22 sing N N 338 THR CG2 HG23 sing N N 339 THR OXT HXT sing N N 340 TRP N CA sing N N 341 TRP N H sing N N 342 TRP N H2 sing N N 343 TRP CA C sing N N 344 TRP CA CB sing N N 345 TRP CA HA sing N N 346 TRP C O doub N N 347 TRP C OXT sing N N 348 TRP CB CG sing N N 349 TRP CB HB2 sing N N 350 TRP CB HB3 sing N N 351 TRP CG CD1 doub Y N 352 TRP CG CD2 sing Y N 353 TRP CD1 NE1 sing Y N 354 TRP CD1 HD1 sing N N 355 TRP CD2 CE2 doub Y N 356 TRP CD2 CE3 sing Y N 357 TRP NE1 CE2 sing Y N 358 TRP NE1 HE1 sing N N 359 TRP CE2 CZ2 sing Y N 360 TRP CE3 CZ3 doub Y N 361 TRP CE3 HE3 sing N N 362 TRP CZ2 CH2 doub Y N 363 TRP CZ2 HZ2 sing N N 364 TRP CZ3 CH2 sing Y N 365 TRP CZ3 HZ3 sing N N 366 TRP CH2 HH2 sing N N 367 TRP OXT HXT sing N N 368 TYR N CA sing N N 369 TYR N H sing N N 370 TYR N H2 sing N N 371 TYR CA C sing N N 372 TYR CA CB sing N N 373 TYR CA HA sing N N 374 TYR C O doub N N 375 TYR C OXT sing N N 376 TYR CB CG sing N N 377 TYR CB HB2 sing N N 378 TYR CB HB3 sing N N 379 TYR CG CD1 doub Y N 380 TYR CG CD2 sing Y N 381 TYR CD1 CE1 sing Y N 382 TYR CD1 HD1 sing N N 383 TYR CD2 CE2 doub Y N 384 TYR CD2 HD2 sing N N 385 TYR CE1 CZ doub Y N 386 TYR CE1 HE1 sing N N 387 TYR CE2 CZ sing Y N 388 TYR CE2 HE2 sing N N 389 TYR CZ OH sing N N 390 TYR OH HH sing N N 391 TYR OXT HXT sing N N 392 VAL N CA sing N N 393 VAL N H sing N N 394 VAL N H2 sing N N 395 VAL CA C sing N N 396 VAL CA CB sing N N 397 VAL CA HA sing N N 398 VAL C O doub N N 399 VAL C OXT sing N N 400 VAL CB CG1 sing N N 401 VAL CB CG2 sing N N 402 VAL CB HB sing N N 403 VAL CG1 HG11 sing N N 404 VAL CG1 HG12 sing N N 405 VAL CG1 HG13 sing N N 406 VAL CG2 HG21 sing N N 407 VAL CG2 HG22 sing N N 408 VAL CG2 HG23 sing N N 409 VAL OXT HXT sing N N 410 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Natural Science Foundation of China (NSFC)' China 32022073 1 'National Natural Science Foundation of China (NSFC)' China 31972287 2 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id I5L _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id I5L _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name '(2~{Z},4~{Z})-2-methyl-5-(8-oxidanyldibenzofuran-4-yl)penta-2,4-dienal' _pdbx_entity_nonpoly.comp_id I5L # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #