data_7Y51 # _entry.id 7Y51 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7Y51 pdb_00007y51 10.2210/pdb7y51/pdb WWPDB D_1300030273 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7Y51 _pdbx_database_status.recvd_initial_deposition_date 2022-06-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Sasamoto, K.' 1 ? 'Himiyama, T.' 2 ? 'Moriyoshi, K.' 3 ? 'Ohmoto, T.' 4 ? 'Uegaki, K.' 5 ? 'Nakamura, T.' 6 ? 'Nishiya, Y.' 7 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country NE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Febs Open Bio' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2211-5463 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 12 _citation.language ? _citation.page_first 1875 _citation.page_last 1885 _citation.title 'Functional analysis of the N-terminal region of acetylxylan esterase from Caldanaerobacter subterraneus subsp. tengcongensis.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/2211-5463.13476 _citation.pdbx_database_id_PubMed 36054591 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sasamoto, K.' 1 ? primary 'Himiyama, T.' 2 ? primary 'Moriyoshi, K.' 3 ? primary 'Ohmoto, T.' 4 ? primary 'Uegaki, K.' 5 ? primary 'Nakamura, T.' 6 ? primary 'Nishiya, Y.' 7 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7Y51 _cell.details ? _cell.formula_units_Z ? _cell.length_a 63.090 _cell.length_a_esd ? _cell.length_b 106.400 _cell.length_b_esd ? _cell.length_c 117.780 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 7Y51 _symmetry.cell_setting ? _symmetry.Int_Tables_number 24 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Predicted xylanase/chitin deacetylase' 22974.529 1 ? ? ? ? 2 non-polymer syn GLYCEROL 92.094 1 ? ? ? ? 3 non-polymer syn 'NICKEL (II) ION' 58.693 1 ? ? ? ? 4 water nat water 18.015 34 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Acetylxylan esterase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPAFSKKVLGSNPSSGKEVALTFDDGPFPIYTEKYVDILKSMDVKATFFVIGKHAEKHPELLKYIVENGNEIGLHSYSHF NMKKLKPEKMVEELYKTQQIIVEATGIKPTLFRPPFGAYNSTLIEISNALGLKVVLWNVDPDDWRNPSVESVVNRVLSHT RDGSIILMHEGKPSTLAALPQIIKKLKEEGYKFVTVSELLEKRD ; _entity_poly.pdbx_seq_one_letter_code_can ;GPAFSKKVLGSNPSSGKEVALTFDDGPFPIYTEKYVDILKSMDVKATFFVIGKHAEKHPELLKYIVENGNEIGLHSYSHF NMKKLKPEKMVEELYKTQQIIVEATGIKPTLFRPPFGAYNSTLIEISNALGLKVVLWNVDPDDWRNPSVESVVNRVLSHT RDGSIILMHEGKPSTLAALPQIIKKLKEEGYKFVTVSELLEKRD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 ALA n 1 4 PHE n 1 5 SER n 1 6 LYS n 1 7 LYS n 1 8 VAL n 1 9 LEU n 1 10 GLY n 1 11 SER n 1 12 ASN n 1 13 PRO n 1 14 SER n 1 15 SER n 1 16 GLY n 1 17 LYS n 1 18 GLU n 1 19 VAL n 1 20 ALA n 1 21 LEU n 1 22 THR n 1 23 PHE n 1 24 ASP n 1 25 ASP n 1 26 GLY n 1 27 PRO n 1 28 PHE n 1 29 PRO n 1 30 ILE n 1 31 TYR n 1 32 THR n 1 33 GLU n 1 34 LYS n 1 35 TYR n 1 36 VAL n 1 37 ASP n 1 38 ILE n 1 39 LEU n 1 40 LYS n 1 41 SER n 1 42 MET n 1 43 ASP n 1 44 VAL n 1 45 LYS n 1 46 ALA n 1 47 THR n 1 48 PHE n 1 49 PHE n 1 50 VAL n 1 51 ILE n 1 52 GLY n 1 53 LYS n 1 54 HIS n 1 55 ALA n 1 56 GLU n 1 57 LYS n 1 58 HIS n 1 59 PRO n 1 60 GLU n 1 61 LEU n 1 62 LEU n 1 63 LYS n 1 64 TYR n 1 65 ILE n 1 66 VAL n 1 67 GLU n 1 68 ASN n 1 69 GLY n 1 70 ASN n 1 71 GLU n 1 72 ILE n 1 73 GLY n 1 74 LEU n 1 75 HIS n 1 76 SER n 1 77 TYR n 1 78 SER n 1 79 HIS n 1 80 PHE n 1 81 ASN n 1 82 MET n 1 83 LYS n 1 84 LYS n 1 85 LEU n 1 86 LYS n 1 87 PRO n 1 88 GLU n 1 89 LYS n 1 90 MET n 1 91 VAL n 1 92 GLU n 1 93 GLU n 1 94 LEU n 1 95 TYR n 1 96 LYS n 1 97 THR n 1 98 GLN n 1 99 GLN n 1 100 ILE n 1 101 ILE n 1 102 VAL n 1 103 GLU n 1 104 ALA n 1 105 THR n 1 106 GLY n 1 107 ILE n 1 108 LYS n 1 109 PRO n 1 110 THR n 1 111 LEU n 1 112 PHE n 1 113 ARG n 1 114 PRO n 1 115 PRO n 1 116 PHE n 1 117 GLY n 1 118 ALA n 1 119 TYR n 1 120 ASN n 1 121 SER n 1 122 THR n 1 123 LEU n 1 124 ILE n 1 125 GLU n 1 126 ILE n 1 127 SER n 1 128 ASN n 1 129 ALA n 1 130 LEU n 1 131 GLY n 1 132 LEU n 1 133 LYS n 1 134 VAL n 1 135 VAL n 1 136 LEU n 1 137 TRP n 1 138 ASN n 1 139 VAL n 1 140 ASP n 1 141 PRO n 1 142 ASP n 1 143 ASP n 1 144 TRP n 1 145 ARG n 1 146 ASN n 1 147 PRO n 1 148 SER n 1 149 VAL n 1 150 GLU n 1 151 SER n 1 152 VAL n 1 153 VAL n 1 154 ASN n 1 155 ARG n 1 156 VAL n 1 157 LEU n 1 158 SER n 1 159 HIS n 1 160 THR n 1 161 ARG n 1 162 ASP n 1 163 GLY n 1 164 SER n 1 165 ILE n 1 166 ILE n 1 167 LEU n 1 168 MET n 1 169 HIS n 1 170 GLU n 1 171 GLY n 1 172 LYS n 1 173 PRO n 1 174 SER n 1 175 THR n 1 176 LEU n 1 177 ALA n 1 178 ALA n 1 179 LEU n 1 180 PRO n 1 181 GLN n 1 182 ILE n 1 183 ILE n 1 184 LYS n 1 185 LYS n 1 186 LEU n 1 187 LYS n 1 188 GLU n 1 189 GLU n 1 190 GLY n 1 191 TYR n 1 192 LYS n 1 193 PHE n 1 194 VAL n 1 195 THR n 1 196 VAL n 1 197 SER n 1 198 GLU n 1 199 LEU n 1 200 LEU n 1 201 GLU n 1 202 LYS n 1 203 ARG n 1 204 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 204 _entity_src_gen.gene_src_common_name 'Thermoanaerobacter tengcongensis' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Cda1, TTE0866' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'DSM 15242 / JCM 11007 / NBRC 100824 / MB4' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Caldanaerobacter subterraneus subsp. tengcongensis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 273068 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8RBF4_CALS4 _struct_ref.pdbx_db_accession Q8RBF4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AFSKKVLGSNPSSGKEVALTFDDGPFPIYTEKYVDILKSMDVKATFFVIGKHAEKHPELLKYIVENGNEIGLHSYSHFNM KKLKPEKMVEELYKTQQIIVEATGIKPTLFRPPFGAYNSTLIEISNALGLKVVLWNVDPDDWRNPSVESVVNRVLSHTRD GSIILMHEGKPSTLAALPQIIKKLKEEGYKFVTVSELLEKRD ; _struct_ref.pdbx_align_begin 123 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7Y51 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 204 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8RBF4 _struct_ref_seq.db_align_beg 123 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 324 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 123 _struct_ref_seq.pdbx_auth_seq_align_end 324 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7Y51 GLY A 1 ? UNP Q8RBF4 ? ? 'expression tag' 121 1 1 7Y51 PRO A 2 ? UNP Q8RBF4 ? ? 'expression tag' 122 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NI non-polymer . 'NICKEL (II) ION' ? 'Ni 2' 58.693 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7Y51 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 4.30 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 71.41 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'EVAPORATION, RECRYSTALLIZATION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20 mM Tris-HCl (pH8.0) 100 mM NaCl' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment Y # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-10-16 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL45XU' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL45XU _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 7Y51 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.45 _reflns.d_resolution_low 39.91 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14957 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.0 _reflns.pdbx_Rmerge_I_obs 0.170 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 14.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.993 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 2.45 _reflns_shell.d_res_low 2.55 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1651 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.912 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.840 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 0.066 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][2] -0.036 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] -0.030 _refine.B_iso_max ? _refine.B_iso_mean 38.227 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.945 _refine.correlation_coeff_Fo_to_Fc_free 0.927 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7Y51 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.450 _refine.ls_d_res_low 39.91 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14956 _refine.ls_number_reflns_R_free 722 _refine.ls_number_reflns_R_work 14234 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.906 _refine.ls_percent_reflns_R_free 4.827 _refine.ls_R_factor_all 0.193 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2301 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1907 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 7FBW _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.206 _refine.pdbx_overall_ESU_R_Free 0.188 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 5.681 _refine.overall_SU_ML 0.128 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1488 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 7 _refine_hist.number_atoms_solvent 34 _refine_hist.number_atoms_total 1529 _refine_hist.d_res_high 2.450 _refine_hist.d_res_low 39.91 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.012 0.013 1528 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.017 1494 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.868 1.642 2067 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.344 1.579 3468 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.524 5.000 185 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 39.021 24.179 67 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 21.027 15.000 282 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 18.244 15.000 4 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.105 0.200 199 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 0.020 1660 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 308 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 0.204 0.200 295 ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.181 0.200 1346 ? r_symmetry_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.173 0.200 732 ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? 0.085 0.200 776 ? r_symmetry_nbtor_other ? ? 'X-RAY DIFFRACTION' ? 0.164 0.200 35 ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.085 0.200 2 ? r_symmetry_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 0.106 0.200 13 ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? 0.012 0.200 1 ? r_symmetry_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? 4.284 3.660 743 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.212 3.654 742 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 6.507 5.478 927 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 6.521 5.481 928 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 4.990 4.328 785 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 4.987 4.330 786 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? 7.727 6.230 1140 ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 7.724 6.232 1141 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 9.890 43.261 1635 ? r_lrange_it ? ? 'X-RAY DIFFRACTION' ? 9.890 43.287 1635 ? r_lrange_other ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.450 2.514 . . 52 1041 99.8174 . . . 0.296 . 0.265 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.514 2.582 . . 47 1029 99.9072 . . . 0.266 . 0.257 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.582 2.657 . . 55 961 100.0000 . . . 0.290 . 0.228 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.657 2.739 . . 54 964 100.0000 . . . 0.246 . 0.225 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.739 2.829 . . 31 928 100.0000 . . . 0.290 . 0.207 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.829 2.928 . . 48 888 99.8933 . . . 0.281 . 0.199 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.928 3.038 . . 54 856 99.8902 . . . 0.202 . 0.205 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.038 3.162 . . 41 849 99.8878 . . . 0.269 . 0.216 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.162 3.302 . . 47 786 100.0000 . . . 0.262 . 0.204 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.302 3.463 . . 31 771 100.0000 . . . 0.262 . 0.211 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.463 3.650 . . 48 719 99.8698 . . . 0.251 . 0.208 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.650 3.871 . . 34 704 100.0000 . . . 0.285 . 0.205 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.871 4.138 . . 34 659 100.0000 . . . 0.192 . 0.166 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.138 4.468 . . 29 608 99.8433 . . . 0.187 . 0.152 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.468 4.893 . . 28 571 100.0000 . . . 0.142 . 0.121 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.893 5.468 . . 21 518 99.8148 . . . 0.230 . 0.163 . . . . . . . . . . . 'X-RAY DIFFRACTION' 5.468 6.309 . . 19 472 100.0000 . . . 0.261 . 0.185 . . . . . . . . . . . 'X-RAY DIFFRACTION' 6.309 7.714 . . 18 408 100.0000 . . . 0.195 . 0.155 . . . . . . . . . . . 'X-RAY DIFFRACTION' 7.714 10.858 . . 21 309 100.0000 . . . 0.112 . 0.120 . . . . . . . . . . . 'X-RAY DIFFRACTION' 10.858 39.91 . . 10 193 97.5962 . . . 0.416 . 0.266 . . . . . . . . . . . # _struct.entry_id 7Y51 _struct.title 'Acetylxylan esterase from Caldanaerobacter subterraneus subsp. tengcongensis TTE0866 delta100 mutant' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7Y51 _struct_keywords.text 'Acetylxylan esterase, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ILE A 30 ? MET A 42 ? ILE A 150 MET A 162 1 ? 13 HELX_P HELX_P2 AA2 ILE A 51 ? HIS A 58 ? ILE A 171 HIS A 178 1 ? 8 HELX_P HELX_P3 AA3 HIS A 58 ? ASN A 68 ? HIS A 178 ASN A 188 1 ? 11 HELX_P HELX_P4 AA4 LYS A 86 ? GLY A 106 ? LYS A 206 GLY A 226 1 ? 21 HELX_P HELX_P5 AA5 PRO A 114 ? ALA A 118 ? PRO A 234 ALA A 238 5 ? 5 HELX_P HELX_P6 AA6 ASN A 120 ? LEU A 130 ? ASN A 240 LEU A 250 1 ? 11 HELX_P HELX_P7 AA7 SER A 148 ? THR A 160 ? SER A 268 THR A 280 1 ? 13 HELX_P HELX_P8 AA8 LYS A 172 ? GLU A 189 ? LYS A 292 GLU A 309 1 ? 18 HELX_P HELX_P9 AA9 THR A 195 ? GLU A 201 ? THR A 315 GLU A 321 1 ? 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 25 OD2 ? ? ? 1_555 C NI . NI ? ? A ASP 145 A NI 402 1_555 ? ? ? ? ? ? ? 2.089 ? ? metalc2 metalc ? ? A HIS 75 NE2 ? ? ? 1_555 C NI . NI ? ? A HIS 195 A NI 402 1_555 ? ? ? ? ? ? ? 2.126 ? ? metalc3 metalc ? ? A HIS 79 NE2 ? ? ? 1_555 C NI . NI ? ? A HIS 199 A NI 402 1_555 ? ? ? ? ? ? ? 2.210 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 26 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 146 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 27 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 147 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -6.88 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 4 ? AA3 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel AA3 1 2 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 71 ? LEU A 74 ? GLU A 191 LEU A 194 AA1 2 THR A 47 ? VAL A 50 ? THR A 167 VAL A 170 AA1 3 GLU A 18 ? ASP A 24 ? GLU A 138 ASP A 144 AA1 4 SER A 164 ? HIS A 169 ? SER A 284 HIS A 289 AA2 1 GLU A 71 ? LEU A 74 ? GLU A 191 LEU A 194 AA2 2 THR A 47 ? VAL A 50 ? THR A 167 VAL A 170 AA2 3 GLU A 18 ? ASP A 24 ? GLU A 138 ASP A 144 AA2 4 LYS A 192 ? PHE A 193 ? LYS A 312 PHE A 313 AA3 1 LEU A 111 ? PHE A 112 ? LEU A 231 PHE A 232 AA3 2 LYS A 133 ? VAL A 134 ? LYS A 253 VAL A 254 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 71 ? O GLU A 191 N PHE A 48 ? N PHE A 168 AA1 2 3 O THR A 47 ? O THR A 167 N PHE A 23 ? N PHE A 143 AA1 3 4 N ALA A 20 ? N ALA A 140 O ILE A 166 ? O ILE A 286 AA2 1 2 O GLU A 71 ? O GLU A 191 N PHE A 48 ? N PHE A 168 AA2 2 3 O THR A 47 ? O THR A 167 N PHE A 23 ? N PHE A 143 AA2 3 4 N VAL A 19 ? N VAL A 139 O LYS A 192 ? O LYS A 312 AA3 1 2 N PHE A 112 ? N PHE A 232 O LYS A 133 ? O LYS A 253 # _atom_sites.entry_id 7Y51 _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.015850 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009398 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008490 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 NI 28 28 12.843 3.878 7.295 0.257 4.446 12.176 2.381 66.342 1.059 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.056 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 121 ? ? ? A . n A 1 2 PRO 2 122 ? ? ? A . n A 1 3 ALA 3 123 ? ? ? A . n A 1 4 PHE 4 124 ? ? ? A . n A 1 5 SER 5 125 ? ? ? A . n A 1 6 LYS 6 126 ? ? ? A . n A 1 7 LYS 7 127 ? ? ? A . n A 1 8 VAL 8 128 ? ? ? A . n A 1 9 LEU 9 129 ? ? ? A . n A 1 10 GLY 10 130 ? ? ? A . n A 1 11 SER 11 131 ? ? ? A . n A 1 12 ASN 12 132 ? ? ? A . n A 1 13 PRO 13 133 ? ? ? A . n A 1 14 SER 14 134 ? ? ? A . n A 1 15 SER 15 135 ? ? ? A . n A 1 16 GLY 16 136 136 GLY GLY A . n A 1 17 LYS 17 137 137 LYS LYS A . n A 1 18 GLU 18 138 138 GLU GLU A . n A 1 19 VAL 19 139 139 VAL VAL A . n A 1 20 ALA 20 140 140 ALA ALA A . n A 1 21 LEU 21 141 141 LEU LEU A . n A 1 22 THR 22 142 142 THR THR A . n A 1 23 PHE 23 143 143 PHE PHE A . n A 1 24 ASP 24 144 144 ASP ASP A . n A 1 25 ASP 25 145 145 ASP ASP A . n A 1 26 GLY 26 146 146 GLY GLY A . n A 1 27 PRO 27 147 147 PRO PRO A . n A 1 28 PHE 28 148 148 PHE PHE A . n A 1 29 PRO 29 149 149 PRO PRO A . n A 1 30 ILE 30 150 150 ILE ILE A . n A 1 31 TYR 31 151 151 TYR TYR A . n A 1 32 THR 32 152 152 THR THR A . n A 1 33 GLU 33 153 153 GLU GLU A . n A 1 34 LYS 34 154 154 LYS LYS A . n A 1 35 TYR 35 155 155 TYR TYR A . n A 1 36 VAL 36 156 156 VAL VAL A . n A 1 37 ASP 37 157 157 ASP ASP A . n A 1 38 ILE 38 158 158 ILE ILE A . n A 1 39 LEU 39 159 159 LEU LEU A . n A 1 40 LYS 40 160 160 LYS LYS A . n A 1 41 SER 41 161 161 SER SER A . n A 1 42 MET 42 162 162 MET MET A . n A 1 43 ASP 43 163 163 ASP ASP A . n A 1 44 VAL 44 164 164 VAL VAL A . n A 1 45 LYS 45 165 165 LYS LYS A . n A 1 46 ALA 46 166 166 ALA ALA A . n A 1 47 THR 47 167 167 THR THR A . n A 1 48 PHE 48 168 168 PHE PHE A . n A 1 49 PHE 49 169 169 PHE PHE A . n A 1 50 VAL 50 170 170 VAL VAL A . n A 1 51 ILE 51 171 171 ILE ILE A . n A 1 52 GLY 52 172 172 GLY GLY A . n A 1 53 LYS 53 173 173 LYS LYS A . n A 1 54 HIS 54 174 174 HIS HIS A . n A 1 55 ALA 55 175 175 ALA ALA A . n A 1 56 GLU 56 176 176 GLU GLU A . n A 1 57 LYS 57 177 177 LYS LYS A . n A 1 58 HIS 58 178 178 HIS HIS A . n A 1 59 PRO 59 179 179 PRO PRO A . n A 1 60 GLU 60 180 180 GLU GLU A . n A 1 61 LEU 61 181 181 LEU LEU A . n A 1 62 LEU 62 182 182 LEU LEU A . n A 1 63 LYS 63 183 183 LYS LYS A . n A 1 64 TYR 64 184 184 TYR TYR A . n A 1 65 ILE 65 185 185 ILE ILE A . n A 1 66 VAL 66 186 186 VAL VAL A . n A 1 67 GLU 67 187 187 GLU GLU A . n A 1 68 ASN 68 188 188 ASN ASN A . n A 1 69 GLY 69 189 189 GLY GLY A . n A 1 70 ASN 70 190 190 ASN ASN A . n A 1 71 GLU 71 191 191 GLU GLU A . n A 1 72 ILE 72 192 192 ILE ILE A . n A 1 73 GLY 73 193 193 GLY GLY A . n A 1 74 LEU 74 194 194 LEU LEU A . n A 1 75 HIS 75 195 195 HIS HIS A . n A 1 76 SER 76 196 196 SER SER A . n A 1 77 TYR 77 197 197 TYR TYR A . n A 1 78 SER 78 198 198 SER SER A . n A 1 79 HIS 79 199 199 HIS HIS A . n A 1 80 PHE 80 200 200 PHE PHE A . n A 1 81 ASN 81 201 201 ASN ASN A . n A 1 82 MET 82 202 202 MET MET A . n A 1 83 LYS 83 203 203 LYS LYS A . n A 1 84 LYS 84 204 204 LYS LYS A . n A 1 85 LEU 85 205 205 LEU LEU A . n A 1 86 LYS 86 206 206 LYS LYS A . n A 1 87 PRO 87 207 207 PRO PRO A . n A 1 88 GLU 88 208 208 GLU GLU A . n A 1 89 LYS 89 209 209 LYS LYS A . n A 1 90 MET 90 210 210 MET MET A . n A 1 91 VAL 91 211 211 VAL VAL A . n A 1 92 GLU 92 212 212 GLU GLU A . n A 1 93 GLU 93 213 213 GLU GLU A . n A 1 94 LEU 94 214 214 LEU LEU A . n A 1 95 TYR 95 215 215 TYR TYR A . n A 1 96 LYS 96 216 216 LYS LYS A . n A 1 97 THR 97 217 217 THR THR A . n A 1 98 GLN 98 218 218 GLN GLN A . n A 1 99 GLN 99 219 219 GLN GLN A . n A 1 100 ILE 100 220 220 ILE ILE A . n A 1 101 ILE 101 221 221 ILE ILE A . n A 1 102 VAL 102 222 222 VAL VAL A . n A 1 103 GLU 103 223 223 GLU GLU A . n A 1 104 ALA 104 224 224 ALA ALA A . n A 1 105 THR 105 225 225 THR THR A . n A 1 106 GLY 106 226 226 GLY GLY A . n A 1 107 ILE 107 227 227 ILE ILE A . n A 1 108 LYS 108 228 228 LYS LYS A . n A 1 109 PRO 109 229 229 PRO PRO A . n A 1 110 THR 110 230 230 THR THR A . n A 1 111 LEU 111 231 231 LEU LEU A . n A 1 112 PHE 112 232 232 PHE PHE A . n A 1 113 ARG 113 233 233 ARG ARG A . n A 1 114 PRO 114 234 234 PRO PRO A . n A 1 115 PRO 115 235 235 PRO PRO A . n A 1 116 PHE 116 236 236 PHE PHE A . n A 1 117 GLY 117 237 237 GLY GLY A . n A 1 118 ALA 118 238 238 ALA ALA A . n A 1 119 TYR 119 239 239 TYR TYR A . n A 1 120 ASN 120 240 240 ASN ASN A . n A 1 121 SER 121 241 241 SER SER A . n A 1 122 THR 122 242 242 THR THR A . n A 1 123 LEU 123 243 243 LEU LEU A . n A 1 124 ILE 124 244 244 ILE ILE A . n A 1 125 GLU 125 245 245 GLU GLU A . n A 1 126 ILE 126 246 246 ILE ILE A . n A 1 127 SER 127 247 247 SER SER A . n A 1 128 ASN 128 248 248 ASN ASN A . n A 1 129 ALA 129 249 249 ALA ALA A . n A 1 130 LEU 130 250 250 LEU LEU A . n A 1 131 GLY 131 251 251 GLY GLY A . n A 1 132 LEU 132 252 252 LEU LEU A . n A 1 133 LYS 133 253 253 LYS LYS A . n A 1 134 VAL 134 254 254 VAL VAL A . n A 1 135 VAL 135 255 255 VAL VAL A . n A 1 136 LEU 136 256 256 LEU LEU A . n A 1 137 TRP 137 257 257 TRP TRP A . n A 1 138 ASN 138 258 258 ASN ASN A . n A 1 139 VAL 139 259 259 VAL VAL A . n A 1 140 ASP 140 260 260 ASP ASP A . n A 1 141 PRO 141 261 261 PRO PRO A . n A 1 142 ASP 142 262 262 ASP ASP A . n A 1 143 ASP 143 263 263 ASP ASP A . n A 1 144 TRP 144 264 264 TRP TRP A . n A 1 145 ARG 145 265 265 ARG ARG A . n A 1 146 ASN 146 266 266 ASN ASN A . n A 1 147 PRO 147 267 267 PRO PRO A . n A 1 148 SER 148 268 268 SER SER A . n A 1 149 VAL 149 269 269 VAL VAL A . n A 1 150 GLU 150 270 270 GLU GLU A . n A 1 151 SER 151 271 271 SER SER A . n A 1 152 VAL 152 272 272 VAL VAL A . n A 1 153 VAL 153 273 273 VAL VAL A . n A 1 154 ASN 154 274 274 ASN ASN A . n A 1 155 ARG 155 275 275 ARG ARG A . n A 1 156 VAL 156 276 276 VAL VAL A . n A 1 157 LEU 157 277 277 LEU LEU A . n A 1 158 SER 158 278 278 SER SER A . n A 1 159 HIS 159 279 279 HIS HIS A . n A 1 160 THR 160 280 280 THR THR A . n A 1 161 ARG 161 281 281 ARG ARG A . n A 1 162 ASP 162 282 282 ASP ASP A . n A 1 163 GLY 163 283 283 GLY GLY A . n A 1 164 SER 164 284 284 SER SER A . n A 1 165 ILE 165 285 285 ILE ILE A . n A 1 166 ILE 166 286 286 ILE ILE A . n A 1 167 LEU 167 287 287 LEU LEU A . n A 1 168 MET 168 288 288 MET MET A . n A 1 169 HIS 169 289 289 HIS HIS A . n A 1 170 GLU 170 290 290 GLU GLU A . n A 1 171 GLY 171 291 291 GLY GLY A . n A 1 172 LYS 172 292 292 LYS LYS A . n A 1 173 PRO 173 293 293 PRO PRO A . n A 1 174 SER 174 294 294 SER SER A . n A 1 175 THR 175 295 295 THR THR A . n A 1 176 LEU 176 296 296 LEU LEU A . n A 1 177 ALA 177 297 297 ALA ALA A . n A 1 178 ALA 178 298 298 ALA ALA A . n A 1 179 LEU 179 299 299 LEU LEU A . n A 1 180 PRO 180 300 300 PRO PRO A . n A 1 181 GLN 181 301 301 GLN GLN A . n A 1 182 ILE 182 302 302 ILE ILE A . n A 1 183 ILE 183 303 303 ILE ILE A . n A 1 184 LYS 184 304 304 LYS LYS A . n A 1 185 LYS 185 305 305 LYS LYS A . n A 1 186 LEU 186 306 306 LEU LEU A . n A 1 187 LYS 187 307 307 LYS LYS A . n A 1 188 GLU 188 308 308 GLU GLU A . n A 1 189 GLU 189 309 309 GLU GLU A . n A 1 190 GLY 190 310 310 GLY GLY A . n A 1 191 TYR 191 311 311 TYR TYR A . n A 1 192 LYS 192 312 312 LYS LYS A . n A 1 193 PHE 193 313 313 PHE PHE A . n A 1 194 VAL 194 314 314 VAL VAL A . n A 1 195 THR 195 315 315 THR THR A . n A 1 196 VAL 196 316 316 VAL VAL A . n A 1 197 SER 197 317 317 SER SER A . n A 1 198 GLU 198 318 318 GLU GLU A . n A 1 199 LEU 199 319 319 LEU LEU A . n A 1 200 LEU 200 320 320 LEU LEU A . n A 1 201 GLU 201 321 321 GLU GLU A . n A 1 202 LYS 202 322 ? ? ? A . n A 1 203 ARG 203 323 ? ? ? A . n A 1 204 ASP 204 324 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email t-himiyama@aist.go.jp _pdbx_contact_author.name_first Tomoki _pdbx_contact_author.name_last Himiyama _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-5252-1834 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 401 421 GOL GOL A . C 3 NI 1 402 1 NI NI A . D 4 HOH 1 501 28 HOH HOH A . D 4 HOH 2 502 16 HOH HOH A . D 4 HOH 3 503 27 HOH HOH A . D 4 HOH 4 504 22 HOH HOH A . D 4 HOH 5 505 10 HOH HOH A . D 4 HOH 6 506 4 HOH HOH A . D 4 HOH 7 507 24 HOH HOH A . D 4 HOH 8 508 11 HOH HOH A . D 4 HOH 9 509 34 HOH HOH A . D 4 HOH 10 510 8 HOH HOH A . D 4 HOH 11 511 1 HOH HOH A . D 4 HOH 12 512 2 HOH HOH A . D 4 HOH 13 513 12 HOH HOH A . D 4 HOH 14 514 41 HOH HOH A . D 4 HOH 15 515 6 HOH HOH A . D 4 HOH 16 516 38 HOH HOH A . D 4 HOH 17 517 5 HOH HOH A . D 4 HOH 18 518 39 HOH HOH A . D 4 HOH 19 519 18 HOH HOH A . D 4 HOH 20 520 33 HOH HOH A . D 4 HOH 21 521 9 HOH HOH A . D 4 HOH 22 522 20 HOH HOH A . D 4 HOH 23 523 31 HOH HOH A . D 4 HOH 24 524 30 HOH HOH A . D 4 HOH 25 525 23 HOH HOH A . D 4 HOH 26 526 3 HOH HOH A . D 4 HOH 27 527 29 HOH HOH A . D 4 HOH 28 528 36 HOH HOH A . D 4 HOH 29 529 37 HOH HOH A . D 4 HOH 30 530 15 HOH HOH A . D 4 HOH 31 531 13 HOH HOH A . D 4 HOH 32 532 7 HOH HOH A . D 4 HOH 33 533 32 HOH HOH A . D 4 HOH 34 534 17 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3210 ? 1 MORE -26 ? 1 'SSA (A^2)' 15160 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_555 -x,-y+1/2,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 53.2000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 25 ? A ASP 145 ? 1_555 NI ? C NI . ? A NI 402 ? 1_555 NE2 ? A HIS 75 ? A HIS 195 ? 1_555 83.6 ? 2 OD2 ? A ASP 25 ? A ASP 145 ? 1_555 NI ? C NI . ? A NI 402 ? 1_555 NE2 ? A HIS 79 ? A HIS 199 ? 1_555 94.7 ? 3 NE2 ? A HIS 75 ? A HIS 195 ? 1_555 NI ? C NI . ? A NI 402 ? 1_555 NE2 ? A HIS 79 ? A HIS 199 ? 1_555 94.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-08-31 2 'Structure model' 1 1 2022-09-21 3 'Structure model' 1 2 2022-10-19 4 'Structure model' 1 3 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 4 'Structure model' chem_comp_atom 4 4 'Structure model' chem_comp_bond 5 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_volume' 2 2 'Structure model' '_citation.pdbx_database_id_PubMed' 3 2 'Structure model' '_citation.title' 4 3 'Structure model' '_citation.journal_volume' 5 3 'Structure model' '_citation.page_first' 6 3 'Structure model' '_citation.page_last' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _pdbx_entry_details.entry_id 7Y51 _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CB _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 GLU _pdbx_validate_rmsd_angle.auth_seq_id_1 318 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CA _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 GLU _pdbx_validate_rmsd_angle.auth_seq_id_2 318 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 C _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 GLU _pdbx_validate_rmsd_angle.auth_seq_id_3 318 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 125.32 _pdbx_validate_rmsd_angle.angle_target_value 110.40 _pdbx_validate_rmsd_angle.angle_deviation 14.92 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.00 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 145 ? ? 95.83 1.66 2 1 ILE A 150 ? ? 78.16 -73.16 3 1 SER A 196 ? ? 86.09 171.39 4 1 HIS A 199 ? ? 70.58 36.82 5 1 LEU A 256 ? ? -96.39 -124.50 6 1 PRO A 261 ? ? -74.63 21.16 7 1 ASN A 266 ? ? -34.05 105.14 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 121 ? A GLY 1 2 1 Y 1 A PRO 122 ? A PRO 2 3 1 Y 1 A ALA 123 ? A ALA 3 4 1 Y 1 A PHE 124 ? A PHE 4 5 1 Y 1 A SER 125 ? A SER 5 6 1 Y 1 A LYS 126 ? A LYS 6 7 1 Y 1 A LYS 127 ? A LYS 7 8 1 Y 1 A VAL 128 ? A VAL 8 9 1 Y 1 A LEU 129 ? A LEU 9 10 1 Y 1 A GLY 130 ? A GLY 10 11 1 Y 1 A SER 131 ? A SER 11 12 1 Y 1 A ASN 132 ? A ASN 12 13 1 Y 1 A PRO 133 ? A PRO 13 14 1 Y 1 A SER 134 ? A SER 14 15 1 Y 1 A SER 135 ? A SER 15 16 1 Y 1 A LYS 322 ? A LYS 202 17 1 Y 1 A ARG 323 ? A ARG 203 18 1 Y 1 A ASP 324 ? A ASP 204 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 GOL C1 C N N 123 GOL O1 O N N 124 GOL C2 C N N 125 GOL O2 O N N 126 GOL C3 C N N 127 GOL O3 O N N 128 GOL H11 H N N 129 GOL H12 H N N 130 GOL HO1 H N N 131 GOL H2 H N N 132 GOL HO2 H N N 133 GOL H31 H N N 134 GOL H32 H N N 135 GOL HO3 H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 NI NI NI N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TRP N N N N 322 TRP CA C N S 323 TRP C C N N 324 TRP O O N N 325 TRP CB C N N 326 TRP CG C Y N 327 TRP CD1 C Y N 328 TRP CD2 C Y N 329 TRP NE1 N Y N 330 TRP CE2 C Y N 331 TRP CE3 C Y N 332 TRP CZ2 C Y N 333 TRP CZ3 C Y N 334 TRP CH2 C Y N 335 TRP OXT O N N 336 TRP H H N N 337 TRP H2 H N N 338 TRP HA H N N 339 TRP HB2 H N N 340 TRP HB3 H N N 341 TRP HD1 H N N 342 TRP HE1 H N N 343 TRP HE3 H N N 344 TRP HZ2 H N N 345 TRP HZ3 H N N 346 TRP HH2 H N N 347 TRP HXT H N N 348 TYR N N N N 349 TYR CA C N S 350 TYR C C N N 351 TYR O O N N 352 TYR CB C N N 353 TYR CG C Y N 354 TYR CD1 C Y N 355 TYR CD2 C Y N 356 TYR CE1 C Y N 357 TYR CE2 C Y N 358 TYR CZ C Y N 359 TYR OH O N N 360 TYR OXT O N N 361 TYR H H N N 362 TYR H2 H N N 363 TYR HA H N N 364 TYR HB2 H N N 365 TYR HB3 H N N 366 TYR HD1 H N N 367 TYR HD2 H N N 368 TYR HE1 H N N 369 TYR HE2 H N N 370 TYR HH H N N 371 TYR HXT H N N 372 VAL N N N N 373 VAL CA C N S 374 VAL C C N N 375 VAL O O N N 376 VAL CB C N N 377 VAL CG1 C N N 378 VAL CG2 C N N 379 VAL OXT O N N 380 VAL H H N N 381 VAL H2 H N N 382 VAL HA H N N 383 VAL HB H N N 384 VAL HG11 H N N 385 VAL HG12 H N N 386 VAL HG13 H N N 387 VAL HG21 H N N 388 VAL HG22 H N N 389 VAL HG23 H N N 390 VAL HXT H N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 GOL C1 O1 sing N N 116 GOL C1 C2 sing N N 117 GOL C1 H11 sing N N 118 GOL C1 H12 sing N N 119 GOL O1 HO1 sing N N 120 GOL C2 O2 sing N N 121 GOL C2 C3 sing N N 122 GOL C2 H2 sing N N 123 GOL O2 HO2 sing N N 124 GOL C3 O3 sing N N 125 GOL C3 H31 sing N N 126 GOL C3 H32 sing N N 127 GOL O3 HO3 sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Japan Society for the Promotion of Science (JSPS)' Japan 18K06616 1 'Japan Society for the Promotion of Science (JSPS)' Japan 20K15403 2 'Japan Society for the Promotion of Science (JSPS)' Japan 20K05740 3 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id NI _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id NI _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 'NICKEL (II) ION' NI 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 7FBW _pdbx_initial_refinement_model.details ? # _pdbx_serial_crystallography_sample_delivery.diffrn_id 1 _pdbx_serial_crystallography_sample_delivery.description ? _pdbx_serial_crystallography_sample_delivery.method 'fixed target' # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #