data_7YDF # _entry.id 7YDF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7YDF pdb_00007ydf 10.2210/pdb7ydf/pdb WWPDB D_1300030697 ? ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 7YDG _pdbx_database_related.db_name PDB _pdbx_database_related.details . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7YDF _pdbx_database_status.recvd_initial_deposition_date 2022-07-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Wu, S.' 1 ? 'Li, P.' 2 ? 'Zhou, X.L.' 3 ? 'Fang, P.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Nucleic Acids Res.' _citation.journal_id_ASTM NARHAD _citation.journal_id_CSD 0389 _citation.journal_id_ISSN 1362-4962 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 50 _citation.language ? _citation.page_first 11755 _citation.page_last 11774 _citation.title 'Selective degradation of tRNASer(AGY) is the primary driver for mitochondrial seryl-tRNA synthetase-related disease.' _citation.year 2022 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1093/nar/gkac1028 _citation.pdbx_database_id_PubMed 36350636 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yu, T.' 1 ? primary 'Zhang, Y.' 2 ? primary 'Zheng, W.Q.' 3 ? primary 'Wu, S.' 4 ? primary 'Li, G.' 5 ? primary 'Zhang, Y.' 6 ? primary 'Li, N.' 7 ? primary 'Yao, R.' 8 ? primary 'Fang, P.' 9 ? primary 'Wang, J.' 10 ? primary 'Zhou, X.L.' 11 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 7YDF _cell.details ? _cell.formula_units_Z ? _cell.length_a 89.850 _cell.length_a_esd ? _cell.length_b 89.850 _cell.length_b_esd ? _cell.length_c 86.220 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 7YDF _symmetry.cell_setting ? _symmetry.Int_Tables_number 151 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 1 2' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Serine--tRNA ligase, mitochondrial' _entity.formula_weight 38970.359 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 6.1.1.11 _entity.pdbx_mutation ? _entity.pdbx_fragment 'catalytic domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'SerRSmt,Seryl-tRNA synthetase,SerRS,Seryl-tRNA(Ser/Sec) synthetase' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGGDESQARVLHMVGDKPVFSFQPRGHLEIGEKLDIIRQKRLSHVSGHRSYYLRGAGALLQHGLVNFTF NKLLRRGFTPMTVPDLLRGAVFEGCGMTPNANPSQIYNIDPARFKDLNLAGTAEVGLAGYFMDHTVAFRDLPVRMVCSST CYRAETNTGQEPRGLYRVHHFTKVEMFGVTGPGLEQSSQLLEEFLSLQMEILTELGLHFRVLDMPTQELGLPAYRKFDIE AWMPGRGRFGEVTSASNCTDFQSRRLHIMFQTEAGELQFAHTVNATACAVPRLLIALLESNQQKDGSVLVPPALQSYLGT DRITAPTHVPLQYIGPNQPRKPGLPGQPAVS ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGGDESQARVLHMVGDKPVFSFQPRGHLEIGEKLDIIRQKRLSHVSGHRSYYLRGAGALLQHGLVNFTF NKLLRRGFTPMTVPDLLRGAVFEGCGMTPNANPSQIYNIDPARFKDLNLAGTAEVGLAGYFMDHTVAFRDLPVRMVCSST CYRAETNTGQEPRGLYRVHHFTKVEMFGVTGPGLEQSSQLLEEFLSLQMEILTELGLHFRVLDMPTQELGLPAYRKFDIE AWMPGRGRFGEVTSASNCTDFQSRRLHIMFQTEAGELQFAHTVNATACAVPRLLIALLESNQQKDGSVLVPPALQSYLGT DRITAPTHVPLQYIGPNQPRKPGLPGQPAVS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 GLY n 1 15 ASP n 1 16 GLU n 1 17 SER n 1 18 GLN n 1 19 ALA n 1 20 ARG n 1 21 VAL n 1 22 LEU n 1 23 HIS n 1 24 MET n 1 25 VAL n 1 26 GLY n 1 27 ASP n 1 28 LYS n 1 29 PRO n 1 30 VAL n 1 31 PHE n 1 32 SER n 1 33 PHE n 1 34 GLN n 1 35 PRO n 1 36 ARG n 1 37 GLY n 1 38 HIS n 1 39 LEU n 1 40 GLU n 1 41 ILE n 1 42 GLY n 1 43 GLU n 1 44 LYS n 1 45 LEU n 1 46 ASP n 1 47 ILE n 1 48 ILE n 1 49 ARG n 1 50 GLN n 1 51 LYS n 1 52 ARG n 1 53 LEU n 1 54 SER n 1 55 HIS n 1 56 VAL n 1 57 SER n 1 58 GLY n 1 59 HIS n 1 60 ARG n 1 61 SER n 1 62 TYR n 1 63 TYR n 1 64 LEU n 1 65 ARG n 1 66 GLY n 1 67 ALA n 1 68 GLY n 1 69 ALA n 1 70 LEU n 1 71 LEU n 1 72 GLN n 1 73 HIS n 1 74 GLY n 1 75 LEU n 1 76 VAL n 1 77 ASN n 1 78 PHE n 1 79 THR n 1 80 PHE n 1 81 ASN n 1 82 LYS n 1 83 LEU n 1 84 LEU n 1 85 ARG n 1 86 ARG n 1 87 GLY n 1 88 PHE n 1 89 THR n 1 90 PRO n 1 91 MET n 1 92 THR n 1 93 VAL n 1 94 PRO n 1 95 ASP n 1 96 LEU n 1 97 LEU n 1 98 ARG n 1 99 GLY n 1 100 ALA n 1 101 VAL n 1 102 PHE n 1 103 GLU n 1 104 GLY n 1 105 CYS n 1 106 GLY n 1 107 MET n 1 108 THR n 1 109 PRO n 1 110 ASN n 1 111 ALA n 1 112 ASN n 1 113 PRO n 1 114 SER n 1 115 GLN n 1 116 ILE n 1 117 TYR n 1 118 ASN n 1 119 ILE n 1 120 ASP n 1 121 PRO n 1 122 ALA n 1 123 ARG n 1 124 PHE n 1 125 LYS n 1 126 ASP n 1 127 LEU n 1 128 ASN n 1 129 LEU n 1 130 ALA n 1 131 GLY n 1 132 THR n 1 133 ALA n 1 134 GLU n 1 135 VAL n 1 136 GLY n 1 137 LEU n 1 138 ALA n 1 139 GLY n 1 140 TYR n 1 141 PHE n 1 142 MET n 1 143 ASP n 1 144 HIS n 1 145 THR n 1 146 VAL n 1 147 ALA n 1 148 PHE n 1 149 ARG n 1 150 ASP n 1 151 LEU n 1 152 PRO n 1 153 VAL n 1 154 ARG n 1 155 MET n 1 156 VAL n 1 157 CYS n 1 158 SER n 1 159 SER n 1 160 THR n 1 161 CYS n 1 162 TYR n 1 163 ARG n 1 164 ALA n 1 165 GLU n 1 166 THR n 1 167 ASN n 1 168 THR n 1 169 GLY n 1 170 GLN n 1 171 GLU n 1 172 PRO n 1 173 ARG n 1 174 GLY n 1 175 LEU n 1 176 TYR n 1 177 ARG n 1 178 VAL n 1 179 HIS n 1 180 HIS n 1 181 PHE n 1 182 THR n 1 183 LYS n 1 184 VAL n 1 185 GLU n 1 186 MET n 1 187 PHE n 1 188 GLY n 1 189 VAL n 1 190 THR n 1 191 GLY n 1 192 PRO n 1 193 GLY n 1 194 LEU n 1 195 GLU n 1 196 GLN n 1 197 SER n 1 198 SER n 1 199 GLN n 1 200 LEU n 1 201 LEU n 1 202 GLU n 1 203 GLU n 1 204 PHE n 1 205 LEU n 1 206 SER n 1 207 LEU n 1 208 GLN n 1 209 MET n 1 210 GLU n 1 211 ILE n 1 212 LEU n 1 213 THR n 1 214 GLU n 1 215 LEU n 1 216 GLY n 1 217 LEU n 1 218 HIS n 1 219 PHE n 1 220 ARG n 1 221 VAL n 1 222 LEU n 1 223 ASP n 1 224 MET n 1 225 PRO n 1 226 THR n 1 227 GLN n 1 228 GLU n 1 229 LEU n 1 230 GLY n 1 231 LEU n 1 232 PRO n 1 233 ALA n 1 234 TYR n 1 235 ARG n 1 236 LYS n 1 237 PHE n 1 238 ASP n 1 239 ILE n 1 240 GLU n 1 241 ALA n 1 242 TRP n 1 243 MET n 1 244 PRO n 1 245 GLY n 1 246 ARG n 1 247 GLY n 1 248 ARG n 1 249 PHE n 1 250 GLY n 1 251 GLU n 1 252 VAL n 1 253 THR n 1 254 SER n 1 255 ALA n 1 256 SER n 1 257 ASN n 1 258 CYS n 1 259 THR n 1 260 ASP n 1 261 PHE n 1 262 GLN n 1 263 SER n 1 264 ARG n 1 265 ARG n 1 266 LEU n 1 267 HIS n 1 268 ILE n 1 269 MET n 1 270 PHE n 1 271 GLN n 1 272 THR n 1 273 GLU n 1 274 ALA n 1 275 GLY n 1 276 GLU n 1 277 LEU n 1 278 GLN n 1 279 PHE n 1 280 ALA n 1 281 HIS n 1 282 THR n 1 283 VAL n 1 284 ASN n 1 285 ALA n 1 286 THR n 1 287 ALA n 1 288 CYS n 1 289 ALA n 1 290 VAL n 1 291 PRO n 1 292 ARG n 1 293 LEU n 1 294 LEU n 1 295 ILE n 1 296 ALA n 1 297 LEU n 1 298 LEU n 1 299 GLU n 1 300 SER n 1 301 ASN n 1 302 GLN n 1 303 GLN n 1 304 LYS n 1 305 ASP n 1 306 GLY n 1 307 SER n 1 308 VAL n 1 309 LEU n 1 310 VAL n 1 311 PRO n 1 312 PRO n 1 313 ALA n 1 314 LEU n 1 315 GLN n 1 316 SER n 1 317 TYR n 1 318 LEU n 1 319 GLY n 1 320 THR n 1 321 ASP n 1 322 ARG n 1 323 ILE n 1 324 THR n 1 325 ALA n 1 326 PRO n 1 327 THR n 1 328 HIS n 1 329 VAL n 1 330 PRO n 1 331 LEU n 1 332 GLN n 1 333 TYR n 1 334 ILE n 1 335 GLY n 1 336 PRO n 1 337 ASN n 1 338 GLN n 1 339 PRO n 1 340 ARG n 1 341 LYS n 1 342 PRO n 1 343 GLY n 1 344 LEU n 1 345 PRO n 1 346 GLY n 1 347 GLN n 1 348 PRO n 1 349 ALA n 1 350 VAL n 1 351 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 351 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SARS2, SARSM' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SYSM_HUMAN _struct_ref.pdbx_db_accession Q9NP81 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GDESQARVLHMVGDKPVFSFQPRGHLEIGEKLDIIRQKRLSHVSGHRSYYLRGAGALLQHGLVNFTFNKLLRRGFTPMTV PDLLRGAVFEGCGMTPNANPSQIYNIDPARFKDLNLAGTAEVGLAGYFMDHTVAFRDLPVRMVCSSTCYRAETNTGQEPR GLYRVHHFTKVEMFGVTGPGLEQSSQLLEEFLSLQMEILTELGLHFRVLDMPTQELGLPAYRKFDIEAWMPGRGRFGEVT SASNCTDFQSRRLHIMFQTEAGELQFAHTVNATACAVPRLLIALLESNQQKDGSVLVPPALQSYLGTDRITAPTHVPLQY IGPNQPRKPGLPGQPAVS ; _struct_ref.pdbx_align_begin 181 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7YDF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 14 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 351 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9NP81 _struct_ref_seq.db_align_beg 181 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 518 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 181 _struct_ref_seq.pdbx_auth_seq_align_end 518 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 7YDF MET A 1 ? UNP Q9NP81 ? ? 'initiating methionine' 168 1 1 7YDF GLY A 2 ? UNP Q9NP81 ? ? 'expression tag' 169 2 1 7YDF SER A 3 ? UNP Q9NP81 ? ? 'expression tag' 170 3 1 7YDF SER A 4 ? UNP Q9NP81 ? ? 'expression tag' 171 4 1 7YDF HIS A 5 ? UNP Q9NP81 ? ? 'expression tag' 172 5 1 7YDF HIS A 6 ? UNP Q9NP81 ? ? 'expression tag' 173 6 1 7YDF HIS A 7 ? UNP Q9NP81 ? ? 'expression tag' 174 7 1 7YDF HIS A 8 ? UNP Q9NP81 ? ? 'expression tag' 175 8 1 7YDF HIS A 9 ? UNP Q9NP81 ? ? 'expression tag' 176 9 1 7YDF HIS A 10 ? UNP Q9NP81 ? ? 'expression tag' 177 10 1 7YDF SER A 11 ? UNP Q9NP81 ? ? 'expression tag' 178 11 1 7YDF SER A 12 ? UNP Q9NP81 ? ? 'expression tag' 179 12 1 7YDF GLY A 13 ? UNP Q9NP81 ? ? 'expression tag' 180 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7YDF _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.58 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.29 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Na citrate, PEG4000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-06-04 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97853 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97853 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 84.810 _reflns.entry_id 7YDF _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.800 _reflns.d_resolution_low 44.920 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 18615 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.600 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.600 _reflns.pdbx_Rmerge_I_obs 0.170 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 8.300 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.180 _reflns.pdbx_Rpim_I_all 0.059 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.997 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 2.800 2.950 ? ? 14262 ? ? ? 1446 100.000 ? ? ? ? 2.572 ? ? ? ? ? ? ? ? 9.900 ? ? ? 1.000 2.713 0.859 ? 1 1 0.354 ? ? ? ? ? ? ? ? ? ? 8.850 44.920 ? ? 2908 ? ? ? 341 99.100 ? ? ? ? 0.080 ? ? ? ? ? ? ? ? 8.500 ? ? ? 21.800 0.086 0.029 ? 2 1 0.997 ? ? ? ? ? ? ? ? ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 234.980 _refine.B_iso_mean 98.5092 _refine.B_iso_min 59.390 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7YDF _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.8000 _refine.ls_d_res_low 44.9200 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 18615 _refine.ls_number_reflns_R_free 872 _refine.ls_number_reflns_R_work 17743 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.9700 _refine.ls_percent_reflns_R_free 4.6800 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2905 _refine.ls_R_factor_R_free 0.3325 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2886 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.020 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1WLE _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 39.2500 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.5400 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.8000 _refine_hist.d_res_low 44.9200 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1988 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 252 _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1988 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.8000 2.9800 3216 . 136 3080 100.0000 . . . 0.4412 0.0000 0.4030 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 2.9800 3.2000 3177 . 132 3045 100.0000 . . . 0.4032 0.0000 0.3622 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 3.2100 3.5300 3189 . 182 3007 100.0000 . . . 0.3759 0.0000 0.3393 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 3.5300 4.0400 2644 . 147 2497 82.0000 . . . 0.5989 0.0000 0.4629 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 4.0400 5.0800 3194 . 126 3068 100.0000 . . . 0.2696 0.0000 0.2325 . . . . . . . 6 . . . 'X-RAY DIFFRACTION' 5.0900 44.9200 3195 . 149 3046 100.0000 . . . 0.2140 0.0000 0.2165 . . . . . . . 6 . . . # _struct.entry_id 7YDF _struct.title 'Crystal structure of human SARS2 catalytic domain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7YDF _struct_keywords.text 'mitochondrial Seryl-tRNA synthetase, LIGASE' _struct_keywords.pdbx_keywords LIGASE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 37 ? LEU A 45 ? GLY A 204 LEU A 212 1 ? 9 HELX_P HELX_P2 AA2 GLY A 66 ? ARG A 86 ? GLY A 233 ARG A 253 1 ? 21 HELX_P HELX_P3 AA3 GLY A 136 ? TYR A 140 ? GLY A 303 TYR A 307 1 ? 5 HELX_P HELX_P4 AA4 ALA A 147 ? LEU A 151 ? ALA A 314 LEU A 318 5 ? 5 HELX_P HELX_P5 AA5 PRO A 192 ? LEU A 215 ? PRO A 359 LEU A 382 1 ? 24 HELX_P HELX_P6 AA6 ASP A 260 ? HIS A 267 ? ASP A 427 HIS A 434 1 ? 8 HELX_P HELX_P7 AA7 VAL A 290 ? GLN A 302 ? VAL A 457 GLN A 469 1 ? 13 HELX_P HELX_P8 AA8 PRO A 311 ? GLY A 319 ? PRO A 478 GLY A 486 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LEU _struct_mon_prot_cis.label_seq_id 151 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LEU _struct_mon_prot_cis.auth_seq_id 318 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 152 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 319 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -7.34 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 8 ? AA2 ? 2 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? parallel AA2 1 2 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 20 ? VAL A 25 ? ARG A 187 VAL A 192 AA1 2 PHE A 219 ? MET A 224 ? PHE A 386 MET A 391 AA1 3 ARG A 235 ? MET A 243 ? ARG A 402 MET A 410 AA1 4 ARG A 248 ? THR A 259 ? ARG A 415 THR A 426 AA1 5 HIS A 281 ? ALA A 289 ? HIS A 448 ALA A 456 AA1 6 HIS A 180 ? THR A 190 ? HIS A 347 THR A 357 AA1 7 VAL A 153 ? TYR A 162 ? VAL A 320 TYR A 329 AA1 8 THR A 89 ? MET A 91 ? THR A 256 MET A 258 AA2 1 ILE A 48 ? ARG A 49 ? ILE A 215 ARG A 216 AA2 2 TYR A 63 ? LEU A 64 ? TYR A 230 LEU A 231 AA3 1 THR A 145 ? VAL A 146 ? THR A 312 VAL A 313 AA3 2 MET A 269 ? GLN A 271 ? MET A 436 GLN A 438 AA3 3 LEU A 277 ? PHE A 279 ? LEU A 444 PHE A 446 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 22 ? N LEU A 189 O VAL A 221 ? O VAL A 388 AA1 2 3 N LEU A 222 ? N LEU A 389 O ASP A 238 ? O ASP A 405 AA1 3 4 N PHE A 237 ? N PHE A 404 O ALA A 255 ? O ALA A 422 AA1 4 5 N SER A 254 ? N SER A 421 O THR A 286 ? O THR A 453 AA1 5 6 O ALA A 285 ? O ALA A 452 N MET A 186 ? N MET A 353 AA1 6 7 O PHE A 181 ? O PHE A 348 N CYS A 161 ? N CYS A 328 AA1 7 8 O ARG A 154 ? O ARG A 321 N THR A 89 ? N THR A 256 AA2 1 2 N ARG A 49 ? N ARG A 216 O TYR A 63 ? O TYR A 230 AA3 1 2 N VAL A 146 ? N VAL A 313 O GLN A 271 ? O GLN A 438 AA3 2 3 N PHE A 270 ? N PHE A 437 O GLN A 278 ? O GLN A 445 # _atom_sites.entry_id 7YDF _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.011130 _atom_sites.fract_transf_matrix[1][2] 0.006426 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012851 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011598 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 168 ? ? ? A . n A 1 2 GLY 2 169 ? ? ? A . n A 1 3 SER 3 170 ? ? ? A . n A 1 4 SER 4 171 ? ? ? A . n A 1 5 HIS 5 172 ? ? ? A . n A 1 6 HIS 6 173 ? ? ? A . n A 1 7 HIS 7 174 ? ? ? A . n A 1 8 HIS 8 175 ? ? ? A . n A 1 9 HIS 9 176 ? ? ? A . n A 1 10 HIS 10 177 ? ? ? A . n A 1 11 SER 11 178 ? ? ? A . n A 1 12 SER 12 179 ? ? ? A . n A 1 13 GLY 13 180 ? ? ? A . n A 1 14 GLY 14 181 ? ? ? A . n A 1 15 ASP 15 182 ? ? ? A . n A 1 16 GLU 16 183 ? ? ? A . n A 1 17 SER 17 184 184 SER SER A . n A 1 18 GLN 18 185 185 GLN GLN A . n A 1 19 ALA 19 186 186 ALA ALA A . n A 1 20 ARG 20 187 187 ARG ARG A . n A 1 21 VAL 21 188 188 VAL VAL A . n A 1 22 LEU 22 189 189 LEU LEU A . n A 1 23 HIS 23 190 190 HIS HIS A . n A 1 24 MET 24 191 191 MET MET A . n A 1 25 VAL 25 192 192 VAL VAL A . n A 1 26 GLY 26 193 193 GLY GLY A . n A 1 27 ASP 27 194 194 ASP ASP A . n A 1 28 LYS 28 195 195 LYS LYS A . n A 1 29 PRO 29 196 196 PRO PRO A . n A 1 30 VAL 30 197 197 VAL VAL A . n A 1 31 PHE 31 198 198 PHE PHE A . n A 1 32 SER 32 199 199 SER SER A . n A 1 33 PHE 33 200 200 PHE PHE A . n A 1 34 GLN 34 201 201 GLN GLN A . n A 1 35 PRO 35 202 202 PRO PRO A . n A 1 36 ARG 36 203 203 ARG ARG A . n A 1 37 GLY 37 204 204 GLY GLY A . n A 1 38 HIS 38 205 205 HIS HIS A . n A 1 39 LEU 39 206 206 LEU LEU A . n A 1 40 GLU 40 207 207 GLU GLU A . n A 1 41 ILE 41 208 208 ILE ILE A . n A 1 42 GLY 42 209 209 GLY GLY A . n A 1 43 GLU 43 210 210 GLU GLU A . n A 1 44 LYS 44 211 211 LYS LYS A . n A 1 45 LEU 45 212 212 LEU LEU A . n A 1 46 ASP 46 213 213 ASP ASP A . n A 1 47 ILE 47 214 214 ILE ILE A . n A 1 48 ILE 48 215 215 ILE ILE A . n A 1 49 ARG 49 216 216 ARG ARG A . n A 1 50 GLN 50 217 217 GLN GLN A . n A 1 51 LYS 51 218 ? ? ? A . n A 1 52 ARG 52 219 ? ? ? A . n A 1 53 LEU 53 220 ? ? ? A . n A 1 54 SER 54 221 ? ? ? A . n A 1 55 HIS 55 222 ? ? ? A . n A 1 56 VAL 56 223 ? ? ? A . n A 1 57 SER 57 224 ? ? ? A . n A 1 58 GLY 58 225 ? ? ? A . n A 1 59 HIS 59 226 ? ? ? A . n A 1 60 ARG 60 227 ? ? ? A . n A 1 61 SER 61 228 228 SER SER A . n A 1 62 TYR 62 229 229 TYR TYR A . n A 1 63 TYR 63 230 230 TYR TYR A . n A 1 64 LEU 64 231 231 LEU LEU A . n A 1 65 ARG 65 232 232 ARG ARG A . n A 1 66 GLY 66 233 233 GLY GLY A . n A 1 67 ALA 67 234 234 ALA ALA A . n A 1 68 GLY 68 235 235 GLY GLY A . n A 1 69 ALA 69 236 236 ALA ALA A . n A 1 70 LEU 70 237 237 LEU LEU A . n A 1 71 LEU 71 238 238 LEU LEU A . n A 1 72 GLN 72 239 239 GLN GLN A . n A 1 73 HIS 73 240 240 HIS HIS A . n A 1 74 GLY 74 241 241 GLY GLY A . n A 1 75 LEU 75 242 242 LEU LEU A . n A 1 76 VAL 76 243 243 VAL VAL A . n A 1 77 ASN 77 244 244 ASN ASN A . n A 1 78 PHE 78 245 245 PHE PHE A . n A 1 79 THR 79 246 246 THR THR A . n A 1 80 PHE 80 247 247 PHE PHE A . n A 1 81 ASN 81 248 248 ASN ASN A . n A 1 82 LYS 82 249 249 LYS LYS A . n A 1 83 LEU 83 250 250 LEU LEU A . n A 1 84 LEU 84 251 251 LEU LEU A . n A 1 85 ARG 85 252 252 ARG ARG A . n A 1 86 ARG 86 253 253 ARG ARG A . n A 1 87 GLY 87 254 254 GLY GLY A . n A 1 88 PHE 88 255 255 PHE PHE A . n A 1 89 THR 89 256 256 THR THR A . n A 1 90 PRO 90 257 257 PRO PRO A . n A 1 91 MET 91 258 258 MET MET A . n A 1 92 THR 92 259 259 THR THR A . n A 1 93 VAL 93 260 260 VAL VAL A . n A 1 94 PRO 94 261 261 PRO PRO A . n A 1 95 ASP 95 262 262 ASP ASP A . n A 1 96 LEU 96 263 ? ? ? A . n A 1 97 LEU 97 264 ? ? ? A . n A 1 98 ARG 98 265 ? ? ? A . n A 1 99 GLY 99 266 ? ? ? A . n A 1 100 ALA 100 267 ? ? ? A . n A 1 101 VAL 101 268 ? ? ? A . n A 1 102 PHE 102 269 ? ? ? A . n A 1 103 GLU 103 270 ? ? ? A . n A 1 104 GLY 104 271 ? ? ? A . n A 1 105 CYS 105 272 ? ? ? A . n A 1 106 GLY 106 273 ? ? ? A . n A 1 107 MET 107 274 ? ? ? A . n A 1 108 THR 108 275 ? ? ? A . n A 1 109 PRO 109 276 ? ? ? A . n A 1 110 ASN 110 277 ? ? ? A . n A 1 111 ALA 111 278 ? ? ? A . n A 1 112 ASN 112 279 ? ? ? A . n A 1 113 PRO 113 280 ? ? ? A . n A 1 114 SER 114 281 ? ? ? A . n A 1 115 GLN 115 282 ? ? ? A . n A 1 116 ILE 116 283 ? ? ? A . n A 1 117 TYR 117 284 ? ? ? A . n A 1 118 ASN 118 285 ? ? ? A . n A 1 119 ILE 119 286 ? ? ? A . n A 1 120 ASP 120 287 ? ? ? A . n A 1 121 PRO 121 288 ? ? ? A . n A 1 122 ALA 122 289 ? ? ? A . n A 1 123 ARG 123 290 ? ? ? A . n A 1 124 PHE 124 291 ? ? ? A . n A 1 125 LYS 125 292 ? ? ? A . n A 1 126 ASP 126 293 ? ? ? A . n A 1 127 LEU 127 294 ? ? ? A . n A 1 128 ASN 128 295 ? ? ? A . n A 1 129 LEU 129 296 ? ? ? A . n A 1 130 ALA 130 297 ? ? ? A . n A 1 131 GLY 131 298 ? ? ? A . n A 1 132 THR 132 299 ? ? ? A . n A 1 133 ALA 133 300 ? ? ? A . n A 1 134 GLU 134 301 ? ? ? A . n A 1 135 VAL 135 302 302 VAL VAL A . n A 1 136 GLY 136 303 303 GLY GLY A . n A 1 137 LEU 137 304 304 LEU LEU A . n A 1 138 ALA 138 305 305 ALA ALA A . n A 1 139 GLY 139 306 306 GLY GLY A . n A 1 140 TYR 140 307 307 TYR TYR A . n A 1 141 PHE 141 308 308 PHE PHE A . n A 1 142 MET 142 309 309 MET MET A . n A 1 143 ASP 143 310 310 ASP ASP A . n A 1 144 HIS 144 311 311 HIS HIS A . n A 1 145 THR 145 312 312 THR THR A . n A 1 146 VAL 146 313 313 VAL VAL A . n A 1 147 ALA 147 314 314 ALA ALA A . n A 1 148 PHE 148 315 315 PHE PHE A . n A 1 149 ARG 149 316 316 ARG ARG A . n A 1 150 ASP 150 317 317 ASP ASP A . n A 1 151 LEU 151 318 318 LEU LEU A . n A 1 152 PRO 152 319 319 PRO PRO A . n A 1 153 VAL 153 320 320 VAL VAL A . n A 1 154 ARG 154 321 321 ARG ARG A . n A 1 155 MET 155 322 322 MET MET A . n A 1 156 VAL 156 323 323 VAL VAL A . n A 1 157 CYS 157 324 324 CYS CYS A . n A 1 158 SER 158 325 325 SER SER A . n A 1 159 SER 159 326 326 SER SER A . n A 1 160 THR 160 327 327 THR THR A . n A 1 161 CYS 161 328 328 CYS CYS A . n A 1 162 TYR 162 329 329 TYR TYR A . n A 1 163 ARG 163 330 330 ARG ARG A . n A 1 164 ALA 164 331 ? ? ? A . n A 1 165 GLU 165 332 ? ? ? A . n A 1 166 THR 166 333 ? ? ? A . n A 1 167 ASN 167 334 ? ? ? A . n A 1 168 THR 168 335 ? ? ? A . n A 1 169 GLY 169 336 ? ? ? A . n A 1 170 GLN 170 337 ? ? ? A . n A 1 171 GLU 171 338 ? ? ? A . n A 1 172 PRO 172 339 ? ? ? A . n A 1 173 ARG 173 340 ? ? ? A . n A 1 174 GLY 174 341 341 GLY GLY A . n A 1 175 LEU 175 342 342 LEU LEU A . n A 1 176 TYR 176 343 343 TYR TYR A . n A 1 177 ARG 177 344 344 ARG ARG A . n A 1 178 VAL 178 345 345 VAL VAL A . n A 1 179 HIS 179 346 346 HIS HIS A . n A 1 180 HIS 180 347 347 HIS HIS A . n A 1 181 PHE 181 348 348 PHE PHE A . n A 1 182 THR 182 349 349 THR THR A . n A 1 183 LYS 183 350 350 LYS LYS A . n A 1 184 VAL 184 351 351 VAL VAL A . n A 1 185 GLU 185 352 352 GLU GLU A . n A 1 186 MET 186 353 353 MET MET A . n A 1 187 PHE 187 354 354 PHE PHE A . n A 1 188 GLY 188 355 355 GLY GLY A . n A 1 189 VAL 189 356 356 VAL VAL A . n A 1 190 THR 190 357 357 THR THR A . n A 1 191 GLY 191 358 358 GLY GLY A . n A 1 192 PRO 192 359 359 PRO PRO A . n A 1 193 GLY 193 360 360 GLY GLY A . n A 1 194 LEU 194 361 361 LEU LEU A . n A 1 195 GLU 195 362 362 GLU GLU A . n A 1 196 GLN 196 363 363 GLN GLN A . n A 1 197 SER 197 364 364 SER SER A . n A 1 198 SER 198 365 365 SER SER A . n A 1 199 GLN 199 366 366 GLN GLN A . n A 1 200 LEU 200 367 367 LEU LEU A . n A 1 201 LEU 201 368 368 LEU LEU A . n A 1 202 GLU 202 369 369 GLU GLU A . n A 1 203 GLU 203 370 370 GLU GLU A . n A 1 204 PHE 204 371 371 PHE PHE A . n A 1 205 LEU 205 372 372 LEU LEU A . n A 1 206 SER 206 373 373 SER SER A . n A 1 207 LEU 207 374 374 LEU LEU A . n A 1 208 GLN 208 375 375 GLN GLN A . n A 1 209 MET 209 376 376 MET MET A . n A 1 210 GLU 210 377 377 GLU GLU A . n A 1 211 ILE 211 378 378 ILE ILE A . n A 1 212 LEU 212 379 379 LEU LEU A . n A 1 213 THR 213 380 380 THR THR A . n A 1 214 GLU 214 381 381 GLU GLU A . n A 1 215 LEU 215 382 382 LEU LEU A . n A 1 216 GLY 216 383 383 GLY GLY A . n A 1 217 LEU 217 384 384 LEU LEU A . n A 1 218 HIS 218 385 385 HIS HIS A . n A 1 219 PHE 219 386 386 PHE PHE A . n A 1 220 ARG 220 387 387 ARG ARG A . n A 1 221 VAL 221 388 388 VAL VAL A . n A 1 222 LEU 222 389 389 LEU LEU A . n A 1 223 ASP 223 390 390 ASP ASP A . n A 1 224 MET 224 391 391 MET MET A . n A 1 225 PRO 225 392 392 PRO PRO A . n A 1 226 THR 226 393 393 THR THR A . n A 1 227 GLN 227 394 394 GLN GLN A . n A 1 228 GLU 228 395 395 GLU GLU A . n A 1 229 LEU 229 396 396 LEU LEU A . n A 1 230 GLY 230 397 397 GLY GLY A . n A 1 231 LEU 231 398 398 LEU LEU A . n A 1 232 PRO 232 399 399 PRO PRO A . n A 1 233 ALA 233 400 400 ALA ALA A . n A 1 234 TYR 234 401 401 TYR TYR A . n A 1 235 ARG 235 402 402 ARG ARG A . n A 1 236 LYS 236 403 403 LYS LYS A . n A 1 237 PHE 237 404 404 PHE PHE A . n A 1 238 ASP 238 405 405 ASP ASP A . n A 1 239 ILE 239 406 406 ILE ILE A . n A 1 240 GLU 240 407 407 GLU GLU A . n A 1 241 ALA 241 408 408 ALA ALA A . n A 1 242 TRP 242 409 409 TRP TRP A . n A 1 243 MET 243 410 410 MET MET A . n A 1 244 PRO 244 411 411 PRO PRO A . n A 1 245 GLY 245 412 412 GLY GLY A . n A 1 246 ARG 246 413 413 ARG ARG A . n A 1 247 GLY 247 414 414 GLY GLY A . n A 1 248 ARG 248 415 415 ARG ARG A . n A 1 249 PHE 249 416 416 PHE PHE A . n A 1 250 GLY 250 417 417 GLY GLY A . n A 1 251 GLU 251 418 418 GLU GLU A . n A 1 252 VAL 252 419 419 VAL VAL A . n A 1 253 THR 253 420 420 THR THR A . n A 1 254 SER 254 421 421 SER SER A . n A 1 255 ALA 255 422 422 ALA ALA A . n A 1 256 SER 256 423 423 SER SER A . n A 1 257 ASN 257 424 424 ASN ASN A . n A 1 258 CYS 258 425 425 CYS CYS A . n A 1 259 THR 259 426 426 THR THR A . n A 1 260 ASP 260 427 427 ASP ASP A . n A 1 261 PHE 261 428 428 PHE PHE A . n A 1 262 GLN 262 429 429 GLN GLN A . n A 1 263 SER 263 430 430 SER SER A . n A 1 264 ARG 264 431 431 ARG ARG A . n A 1 265 ARG 265 432 432 ARG ARG A . n A 1 266 LEU 266 433 433 LEU LEU A . n A 1 267 HIS 267 434 434 HIS HIS A . n A 1 268 ILE 268 435 435 ILE ILE A . n A 1 269 MET 269 436 436 MET MET A . n A 1 270 PHE 270 437 437 PHE PHE A . n A 1 271 GLN 271 438 438 GLN GLN A . n A 1 272 THR 272 439 439 THR THR A . n A 1 273 GLU 273 440 440 GLU GLU A . n A 1 274 ALA 274 441 441 ALA ALA A . n A 1 275 GLY 275 442 442 GLY GLY A . n A 1 276 GLU 276 443 443 GLU GLU A . n A 1 277 LEU 277 444 444 LEU LEU A . n A 1 278 GLN 278 445 445 GLN GLN A . n A 1 279 PHE 279 446 446 PHE PHE A . n A 1 280 ALA 280 447 447 ALA ALA A . n A 1 281 HIS 281 448 448 HIS HIS A . n A 1 282 THR 282 449 449 THR THR A . n A 1 283 VAL 283 450 450 VAL VAL A . n A 1 284 ASN 284 451 451 ASN ASN A . n A 1 285 ALA 285 452 452 ALA ALA A . n A 1 286 THR 286 453 453 THR THR A . n A 1 287 ALA 287 454 454 ALA ALA A . n A 1 288 CYS 288 455 455 CYS CYS A . n A 1 289 ALA 289 456 456 ALA ALA A . n A 1 290 VAL 290 457 457 VAL VAL A . n A 1 291 PRO 291 458 458 PRO PRO A . n A 1 292 ARG 292 459 459 ARG ARG A . n A 1 293 LEU 293 460 460 LEU LEU A . n A 1 294 LEU 294 461 461 LEU LEU A . n A 1 295 ILE 295 462 462 ILE ILE A . n A 1 296 ALA 296 463 463 ALA ALA A . n A 1 297 LEU 297 464 464 LEU LEU A . n A 1 298 LEU 298 465 465 LEU LEU A . n A 1 299 GLU 299 466 466 GLU GLU A . n A 1 300 SER 300 467 467 SER SER A . n A 1 301 ASN 301 468 468 ASN ASN A . n A 1 302 GLN 302 469 469 GLN GLN A . n A 1 303 GLN 303 470 470 GLN GLN A . n A 1 304 LYS 304 471 471 LYS LYS A . n A 1 305 ASP 305 472 472 ASP ASP A . n A 1 306 GLY 306 473 473 GLY GLY A . n A 1 307 SER 307 474 474 SER SER A . n A 1 308 VAL 308 475 475 VAL VAL A . n A 1 309 LEU 309 476 476 LEU LEU A . n A 1 310 VAL 310 477 477 VAL VAL A . n A 1 311 PRO 311 478 478 PRO PRO A . n A 1 312 PRO 312 479 479 PRO PRO A . n A 1 313 ALA 313 480 480 ALA ALA A . n A 1 314 LEU 314 481 481 LEU LEU A . n A 1 315 GLN 315 482 482 GLN GLN A . n A 1 316 SER 316 483 483 SER SER A . n A 1 317 TYR 317 484 484 TYR TYR A . n A 1 318 LEU 318 485 485 LEU LEU A . n A 1 319 GLY 319 486 486 GLY GLY A . n A 1 320 THR 320 487 487 THR THR A . n A 1 321 ASP 321 488 488 ASP ASP A . n A 1 322 ARG 322 489 489 ARG ARG A . n A 1 323 ILE 323 490 490 ILE ILE A . n A 1 324 THR 324 491 491 THR THR A . n A 1 325 ALA 325 492 492 ALA ALA A . n A 1 326 PRO 326 493 493 PRO PRO A . n A 1 327 THR 327 494 494 THR THR A . n A 1 328 HIS 328 495 ? ? ? A . n A 1 329 VAL 329 496 ? ? ? A . n A 1 330 PRO 330 497 ? ? ? A . n A 1 331 LEU 331 498 ? ? ? A . n A 1 332 GLN 332 499 ? ? ? A . n A 1 333 TYR 333 500 ? ? ? A . n A 1 334 ILE 334 501 ? ? ? A . n A 1 335 GLY 335 502 ? ? ? A . n A 1 336 PRO 336 503 ? ? ? A . n A 1 337 ASN 337 504 ? ? ? A . n A 1 338 GLN 338 505 ? ? ? A . n A 1 339 PRO 339 506 ? ? ? A . n A 1 340 ARG 340 507 ? ? ? A . n A 1 341 LYS 341 508 ? ? ? A . n A 1 342 PRO 342 509 ? ? ? A . n A 1 343 GLY 343 510 ? ? ? A . n A 1 344 LEU 344 511 ? ? ? A . n A 1 345 PRO 345 512 ? ? ? A . n A 1 346 GLY 346 513 ? ? ? A . n A 1 347 GLN 347 514 ? ? ? A . n A 1 348 PRO 348 515 ? ? ? A . n A 1 349 ALA 349 516 ? ? ? A . n A 1 350 VAL 350 517 ? ? ? A . n A 1 351 SER 351 518 ? ? ? A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email fangpengfei@sioc.ac.cn _pdbx_contact_author.name_first Pengfei _pdbx_contact_author.name_last Fang _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-3448-5494 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2400 ? 1 MORE -14 ? 1 'SSA (A^2)' 23660 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_555 x,x-y,-z 0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-11-02 2 'Structure model' 1 1 2022-11-23 3 'Structure model' 1 2 2022-12-21 4 'Structure model' 1 3 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 3 'Structure model' citation 3 4 'Structure model' chem_comp_atom 4 4 'Structure model' chem_comp_bond 5 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.pdbx_database_id_PubMed' 2 2 'Structure model' '_citation.title' 3 3 'Structure model' '_citation.journal_volume' 4 3 'Structure model' '_citation.page_first' 5 3 'Structure model' '_citation.page_last' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 18.9196 _pdbx_refine_tls.origin_y 25.0498 _pdbx_refine_tls.origin_z -9.0877 _pdbx_refine_tls.T[1][1] 0.5849 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0529 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0474 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.7177 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0720 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.6567 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 1.5628 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.3229 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.5466 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 2.3255 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.0212 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 3.9375 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.1566 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.0058 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.0736 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.2270 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] 0.0516 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.4440 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.1361 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.5724 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.1796 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 184 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 494 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.13 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.7 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 230 ? ? -175.75 115.90 2 1 LEU A 396 ? ? 54.48 -154.45 3 1 LEU A 398 ? ? 124.87 -48.22 4 1 THR A 426 ? ? 56.61 -132.77 5 1 VAL A 475 ? ? 52.23 124.65 6 1 ALA A 492 ? ? 68.41 145.24 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 168 ? A MET 1 2 1 Y 1 A GLY 169 ? A GLY 2 3 1 Y 1 A SER 170 ? A SER 3 4 1 Y 1 A SER 171 ? A SER 4 5 1 Y 1 A HIS 172 ? A HIS 5 6 1 Y 1 A HIS 173 ? A HIS 6 7 1 Y 1 A HIS 174 ? A HIS 7 8 1 Y 1 A HIS 175 ? A HIS 8 9 1 Y 1 A HIS 176 ? A HIS 9 10 1 Y 1 A HIS 177 ? A HIS 10 11 1 Y 1 A SER 178 ? A SER 11 12 1 Y 1 A SER 179 ? A SER 12 13 1 Y 1 A GLY 180 ? A GLY 13 14 1 Y 1 A GLY 181 ? A GLY 14 15 1 Y 1 A ASP 182 ? A ASP 15 16 1 Y 1 A GLU 183 ? A GLU 16 17 1 Y 1 A LYS 218 ? A LYS 51 18 1 Y 1 A ARG 219 ? A ARG 52 19 1 Y 1 A LEU 220 ? A LEU 53 20 1 Y 1 A SER 221 ? A SER 54 21 1 Y 1 A HIS 222 ? A HIS 55 22 1 Y 1 A VAL 223 ? A VAL 56 23 1 Y 1 A SER 224 ? A SER 57 24 1 Y 1 A GLY 225 ? A GLY 58 25 1 Y 1 A HIS 226 ? A HIS 59 26 1 Y 1 A ARG 227 ? A ARG 60 27 1 Y 1 A LEU 263 ? A LEU 96 28 1 Y 1 A LEU 264 ? A LEU 97 29 1 Y 1 A ARG 265 ? A ARG 98 30 1 Y 1 A GLY 266 ? A GLY 99 31 1 Y 1 A ALA 267 ? A ALA 100 32 1 Y 1 A VAL 268 ? A VAL 101 33 1 Y 1 A PHE 269 ? A PHE 102 34 1 Y 1 A GLU 270 ? A GLU 103 35 1 Y 1 A GLY 271 ? A GLY 104 36 1 Y 1 A CYS 272 ? A CYS 105 37 1 Y 1 A GLY 273 ? A GLY 106 38 1 Y 1 A MET 274 ? A MET 107 39 1 Y 1 A THR 275 ? A THR 108 40 1 Y 1 A PRO 276 ? A PRO 109 41 1 Y 1 A ASN 277 ? A ASN 110 42 1 Y 1 A ALA 278 ? A ALA 111 43 1 Y 1 A ASN 279 ? A ASN 112 44 1 Y 1 A PRO 280 ? A PRO 113 45 1 Y 1 A SER 281 ? A SER 114 46 1 Y 1 A GLN 282 ? A GLN 115 47 1 Y 1 A ILE 283 ? A ILE 116 48 1 Y 1 A TYR 284 ? A TYR 117 49 1 Y 1 A ASN 285 ? A ASN 118 50 1 Y 1 A ILE 286 ? A ILE 119 51 1 Y 1 A ASP 287 ? A ASP 120 52 1 Y 1 A PRO 288 ? A PRO 121 53 1 Y 1 A ALA 289 ? A ALA 122 54 1 Y 1 A ARG 290 ? A ARG 123 55 1 Y 1 A PHE 291 ? A PHE 124 56 1 Y 1 A LYS 292 ? A LYS 125 57 1 Y 1 A ASP 293 ? A ASP 126 58 1 Y 1 A LEU 294 ? A LEU 127 59 1 Y 1 A ASN 295 ? A ASN 128 60 1 Y 1 A LEU 296 ? A LEU 129 61 1 Y 1 A ALA 297 ? A ALA 130 62 1 Y 1 A GLY 298 ? A GLY 131 63 1 Y 1 A THR 299 ? A THR 132 64 1 Y 1 A ALA 300 ? A ALA 133 65 1 Y 1 A GLU 301 ? A GLU 134 66 1 Y 1 A ALA 331 ? A ALA 164 67 1 Y 1 A GLU 332 ? A GLU 165 68 1 Y 1 A THR 333 ? A THR 166 69 1 Y 1 A ASN 334 ? A ASN 167 70 1 Y 1 A THR 335 ? A THR 168 71 1 Y 1 A GLY 336 ? A GLY 169 72 1 Y 1 A GLN 337 ? A GLN 170 73 1 Y 1 A GLU 338 ? A GLU 171 74 1 Y 1 A PRO 339 ? A PRO 172 75 1 Y 1 A ARG 340 ? A ARG 173 76 1 Y 1 A HIS 495 ? A HIS 328 77 1 Y 1 A VAL 496 ? A VAL 329 78 1 Y 1 A PRO 497 ? A PRO 330 79 1 Y 1 A LEU 498 ? A LEU 331 80 1 Y 1 A GLN 499 ? A GLN 332 81 1 Y 1 A TYR 500 ? A TYR 333 82 1 Y 1 A ILE 501 ? A ILE 334 83 1 Y 1 A GLY 502 ? A GLY 335 84 1 Y 1 A PRO 503 ? A PRO 336 85 1 Y 1 A ASN 504 ? A ASN 337 86 1 Y 1 A GLN 505 ? A GLN 338 87 1 Y 1 A PRO 506 ? A PRO 339 88 1 Y 1 A ARG 507 ? A ARG 340 89 1 Y 1 A LYS 508 ? A LYS 341 90 1 Y 1 A PRO 509 ? A PRO 342 91 1 Y 1 A GLY 510 ? A GLY 343 92 1 Y 1 A LEU 511 ? A LEU 344 93 1 Y 1 A PRO 512 ? A PRO 345 94 1 Y 1 A GLY 513 ? A GLY 346 95 1 Y 1 A GLN 514 ? A GLN 347 96 1 Y 1 A PRO 515 ? A PRO 348 97 1 Y 1 A ALA 516 ? A ALA 349 98 1 Y 1 A VAL 517 ? A VAL 350 99 1 Y 1 A SER 518 ? A SER 351 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Natural Science Foundation of China (NSFC)' China 21778064 1 'National Natural Science Foundation of China (NSFC)' China 21977107 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1WLE _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support homology _pdbx_struct_assembly_auth_evidence.details ? #