data_7YHD # _entry.id 7YHD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7YHD pdb_00007yhd 10.2210/pdb7yhd/pdb WWPDB D_1300030866 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7YHD _pdbx_database_status.recvd_initial_deposition_date 2022-07-13 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Li, G.-B.' 1 0000-0002-4915-6677 'Yan, Y.-H.' 2 0000-0002-1331-1241 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country FR _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Eur.J.Med.Chem. _citation.journal_id_ASTM EJMCA5 _citation.journal_id_CSD 0493 _citation.journal_id_ISSN 0223-5234 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 257 _citation.language ? _citation.page_first 115473 _citation.page_last 115473 _citation.title 'Metal binding pharmacophore click-derived discovery of new broad-spectrum metallo-beta-lactamase inhibitors.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.ejmech.2023.115473 _citation.pdbx_database_id_PubMed 37209449 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yan, Y.H.' 1 ? primary 'Ding, H.S.' 2 ? primary 'Zhu, K.R.' 3 ? primary 'Mu, B.S.' 4 ? primary 'Zheng, Y.' 5 ? primary 'Huang, M.Y.' 6 ? primary 'Zhou, C.' 7 ? primary 'Li, W.F.' 8 ? primary 'Wang, Z.' 9 ? primary 'Wu, Y.' 10 ? primary 'Li, G.B.' 11 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7YHD _cell.details ? _cell.formula_units_Z ? _cell.length_a 67.407 _cell.length_a_esd ? _cell.length_b 77.566 _cell.length_b_esd ? _cell.length_c 79.019 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 7YHD _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Beta-lactamase class B VIM-2' 24679.439 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 3 non-polymer syn '3-[4-[4-(2-azanylethoxy)phenyl]-1,2,3-triazol-1-yl]phthalic acid' 368.343 1 ? ? ? ? 4 water nat water 18.015 44 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;BlaVIM-2,Metallo beta lactamase VIM-2,Metallo beta-lactamase,Metallo-beta lactamase protein,Metallo-beta-lactamase VIM-2,VIM-2 class B beta-lactamase,VIM-2 class B metallo b-lactamase,VIM-2 metallo beta-lactamase,VIM-2 type metallo-beta-lactamase ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;EYPTVSEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAV STHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSA SVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNR ; _entity_poly.pdbx_seq_one_letter_code_can ;EYPTVSEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAV STHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSA SVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 TYR n 1 3 PRO n 1 4 THR n 1 5 VAL n 1 6 SER n 1 7 GLU n 1 8 ILE n 1 9 PRO n 1 10 VAL n 1 11 GLY n 1 12 GLU n 1 13 VAL n 1 14 ARG n 1 15 LEU n 1 16 TYR n 1 17 GLN n 1 18 ILE n 1 19 ALA n 1 20 ASP n 1 21 GLY n 1 22 VAL n 1 23 TRP n 1 24 SER n 1 25 HIS n 1 26 ILE n 1 27 ALA n 1 28 THR n 1 29 GLN n 1 30 SER n 1 31 PHE n 1 32 ASP n 1 33 GLY n 1 34 ALA n 1 35 VAL n 1 36 TYR n 1 37 PRO n 1 38 SER n 1 39 ASN n 1 40 GLY n 1 41 LEU n 1 42 ILE n 1 43 VAL n 1 44 ARG n 1 45 ASP n 1 46 GLY n 1 47 ASP n 1 48 GLU n 1 49 LEU n 1 50 LEU n 1 51 LEU n 1 52 ILE n 1 53 ASP n 1 54 THR n 1 55 ALA n 1 56 TRP n 1 57 GLY n 1 58 ALA n 1 59 LYS n 1 60 ASN n 1 61 THR n 1 62 ALA n 1 63 ALA n 1 64 LEU n 1 65 LEU n 1 66 ALA n 1 67 GLU n 1 68 ILE n 1 69 GLU n 1 70 LYS n 1 71 GLN n 1 72 ILE n 1 73 GLY n 1 74 LEU n 1 75 PRO n 1 76 VAL n 1 77 THR n 1 78 ARG n 1 79 ALA n 1 80 VAL n 1 81 SER n 1 82 THR n 1 83 HIS n 1 84 PHE n 1 85 HIS n 1 86 ASP n 1 87 ASP n 1 88 ARG n 1 89 VAL n 1 90 GLY n 1 91 GLY n 1 92 VAL n 1 93 ASP n 1 94 VAL n 1 95 LEU n 1 96 ARG n 1 97 ALA n 1 98 ALA n 1 99 GLY n 1 100 VAL n 1 101 ALA n 1 102 THR n 1 103 TYR n 1 104 ALA n 1 105 SER n 1 106 PRO n 1 107 SER n 1 108 THR n 1 109 ARG n 1 110 ARG n 1 111 LEU n 1 112 ALA n 1 113 GLU n 1 114 VAL n 1 115 GLU n 1 116 GLY n 1 117 ASN n 1 118 GLU n 1 119 ILE n 1 120 PRO n 1 121 THR n 1 122 HIS n 1 123 SER n 1 124 LEU n 1 125 GLU n 1 126 GLY n 1 127 LEU n 1 128 SER n 1 129 SER n 1 130 SER n 1 131 GLY n 1 132 ASP n 1 133 ALA n 1 134 VAL n 1 135 ARG n 1 136 PHE n 1 137 GLY n 1 138 PRO n 1 139 VAL n 1 140 GLU n 1 141 LEU n 1 142 PHE n 1 143 TYR n 1 144 PRO n 1 145 GLY n 1 146 ALA n 1 147 ALA n 1 148 HIS n 1 149 SER n 1 150 THR n 1 151 ASP n 1 152 ASN n 1 153 LEU n 1 154 VAL n 1 155 VAL n 1 156 TYR n 1 157 VAL n 1 158 PRO n 1 159 SER n 1 160 ALA n 1 161 SER n 1 162 VAL n 1 163 LEU n 1 164 TYR n 1 165 GLY n 1 166 GLY n 1 167 CYS n 1 168 ALA n 1 169 ILE n 1 170 TYR n 1 171 GLU n 1 172 LEU n 1 173 SER n 1 174 ARG n 1 175 THR n 1 176 SER n 1 177 ALA n 1 178 GLY n 1 179 ASN n 1 180 VAL n 1 181 ALA n 1 182 ASP n 1 183 ALA n 1 184 ASP n 1 185 LEU n 1 186 ALA n 1 187 GLU n 1 188 TRP n 1 189 PRO n 1 190 THR n 1 191 SER n 1 192 ILE n 1 193 GLU n 1 194 ARG n 1 195 ILE n 1 196 GLN n 1 197 GLN n 1 198 HIS n 1 199 TYR n 1 200 PRO n 1 201 GLU n 1 202 ALA n 1 203 GLN n 1 204 PHE n 1 205 VAL n 1 206 ILE n 1 207 PRO n 1 208 GLY n 1 209 HIS n 1 210 GLY n 1 211 LEU n 1 212 PRO n 1 213 GLY n 1 214 GLY n 1 215 LEU n 1 216 ASP n 1 217 LEU n 1 218 LEU n 1 219 LYS n 1 220 HIS n 1 221 THR n 1 222 THR n 1 223 ASN n 1 224 VAL n 1 225 VAL n 1 226 LYS n 1 227 ALA n 1 228 HIS n 1 229 THR n 1 230 ASN n 1 231 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 231 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'blaVIM-2, bla vim-2, bla-VIM-2, blasVIM-2, blaVIM2, blm, VIM-2, vim-2, PAERUG_P32_London_17_VIM_2_10_11_06255' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details 'Pseudomonas aeruginosa' _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 287 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9K2N0_PSEAI _struct_ref.pdbx_db_accession Q9K2N0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EYPTVSEIPVGEVRLYQIADGVWSHIATQSFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAV STHFHDDRVGGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHSTDNLVVYVPSA SVLYGGCAIYELSRTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGHGLPGGLDLLKHTTNVVKAHTNR ; _struct_ref.pdbx_align_begin 32 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7YHD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 231 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9K2N0 _struct_ref_seq.db_align_beg 32 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 262 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 32 _struct_ref_seq.pdbx_auth_seq_align_end 262 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IU7 non-polymer . '3-[4-[4-(2-azanylethoxy)phenyl]-1,2,3-triazol-1-yl]phthalic acid' ? 'C18 H16 N4 O5' 368.343 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7YHD _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.09 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 41.22 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Magnesium Formate, 23-30% (v/v) Polyethylene glycol 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 195 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 X CdTe 1M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2020-05-25 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL19U1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL19U1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 21.580 _reflns.entry_id 7YHD _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.6960 _reflns.d_resolution_low 19.3920 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 22860 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.12 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 11.6 _reflns.pdbx_Rmerge_I_obs 0.134 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.998 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 1.70 _reflns_shell.d_res_low 1.76 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 1854 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.851 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 117.520 _refine.B_iso_mean 32.2407 _refine.B_iso_min 8.080 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7YHD _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.6960 _refine.ls_d_res_low 19.3920 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 22586 _refine.ls_number_reflns_R_free 2002 _refine.ls_number_reflns_R_work 20584 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.9400 _refine.ls_percent_reflns_R_free 8.8600 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2788 _refine.ls_R_factor_R_free 0.3402 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2726 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.470 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6JN6 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 40.9300 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 1.6960 _refine_hist.d_res_low 19.3920 _refine_hist.number_atoms_solvent 44 _refine_hist.number_atoms_total 1806 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 231 _refine_hist.pdbx_B_iso_mean_ligand 44.48 _refine_hist.pdbx_B_iso_mean_solvent 28.34 _refine_hist.pdbx_number_atoms_protein 1733 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 29 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.024 ? 1813 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.333 ? 2469 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.062 ? 280 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 ? 324 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 13.308 ? 1043 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.6960 1.7384 . . 111 1071 73.0000 . . . 0.5181 0.0000 0.4444 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7384 1.7853 . . 140 1495 100.0000 . . . 0.3776 0.0000 0.3608 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7853 1.8378 . . 148 1507 100.0000 . . . 0.4478 0.0000 0.3624 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8378 1.8971 . . 146 1496 100.0000 . . . 0.4329 0.0000 0.3531 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8971 1.9648 . . 148 1499 100.0000 . . . 0.4168 0.0000 0.3424 . . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9648 2.0434 . . 134 1486 100.0000 . . . 0.3804 0.0000 0.3159 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0434 2.1363 . . 150 1496 100.0000 . . . 0.3515 0.0000 0.2974 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1363 2.2488 . . 154 1510 100.0000 . . . 0.3262 0.0000 0.2993 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2488 2.3894 . . 143 1510 99.0000 . . . 0.3638 0.0000 0.3065 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3894 2.5736 . . 146 1495 99.0000 . . . 0.3745 0.0000 0.3217 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.5736 2.8318 . . 146 1489 98.0000 . . . 0.4194 0.0000 0.2978 . . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8318 3.2400 . . 146 1512 99.0000 . . . 0.3327 0.0000 0.2738 . . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2400 4.0758 . . 149 1516 98.0000 . . . 0.2985 0.0000 0.2264 . . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0758 19.3920 . . 141 1502 93.0000 . . . 0.2616 0.0000 0.1917 . . . . . . . . . . . # _struct.entry_id 7YHD _struct.title 'Crystal structure of VIM-2 MBL in complex with 3-(4-(4-(2-aminoethoxy)phenyl)-1H-1,2,3-triazol-1-yl)phthalic acid' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7YHD _struct_keywords.text 'Metallo-beta-lactamase VIM-2, HYDROLASE, HYDROLASE-INHIBITOR complex' _struct_keywords.pdbx_keywords HYDROLASE/INHIBITOR # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 4 ? ILE A 8 ? THR A 35 ILE A 39 5 ? 5 HELX_P HELX_P2 AA2 GLY A 57 ? ILE A 72 ? GLY A 88 ILE A 103 1 ? 16 HELX_P HELX_P3 AA3 HIS A 85 ? GLY A 90 ? HIS A 116 GLY A 121 1 ? 6 HELX_P HELX_P4 AA4 GLY A 91 ? ALA A 98 ? GLY A 122 ALA A 129 1 ? 8 HELX_P HELX_P5 AA5 SER A 105 ? GLY A 116 ? SER A 136 GLY A 147 1 ? 12 HELX_P HELX_P6 AA6 CYS A 167 ? ILE A 169 ? CYS A 198 ILE A 200 5 ? 3 HELX_P HELX_P7 AA7 GLU A 187 ? TYR A 199 ? GLU A 218 TYR A 230 1 ? 13 HELX_P HELX_P8 AA8 LEU A 215 ? ASN A 230 ? LEU A 246 ASN A 261 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 83 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 114 A ZN 302 1_555 ? ? ? ? ? ? ? 2.187 ? ? metalc2 metalc ? ? A HIS 85 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 116 A ZN 302 1_555 ? ? ? ? ? ? ? 2.102 ? ? metalc3 metalc ? ? A ASP 87 OD2 ? ? ? 1_555 B ZN . ZN ? ? A ASP 118 A ZN 301 1_555 ? ? ? ? ? ? ? 2.080 ? ? metalc4 metalc ? ? A HIS 148 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 179 A ZN 302 1_555 ? ? ? ? ? ? ? 1.977 ? ? metalc5 metalc ? ? A CYS 167 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 198 A ZN 301 1_555 ? ? ? ? ? ? ? 2.207 ? ? metalc6 metalc ? ? A HIS 209 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 240 A ZN 301 1_555 ? ? ? ? ? ? ? 2.149 ? ? metalc7 metalc ? ? B ZN . ZN ? ? ? 1_555 D IU7 . O03 ? ? A ZN 301 A IU7 303 1_555 ? ? ? ? ? ? ? 2.334 ? ? metalc8 metalc ? ? B ZN . ZN ? ? ? 1_555 D IU7 . O08 ? ? A ZN 301 A IU7 303 1_555 ? ? ? ? ? ? ? 2.188 ? ? metalc9 metalc ? ? C ZN . ZN ? ? ? 1_555 D IU7 . O03 ? ? A ZN 302 A IU7 303 1_555 ? ? ? ? ? ? ? 1.872 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 14 ? ALA A 19 ? ARG A 45 ALA A 50 AA1 2 VAL A 22 ? PHE A 31 ? VAL A 53 PHE A 62 AA1 3 ALA A 34 ? ASP A 45 ? ALA A 65 ASP A 76 AA1 4 GLU A 48 ? ILE A 52 ? GLU A 79 ILE A 83 AA1 5 VAL A 76 ? VAL A 80 ? VAL A 107 VAL A 111 AA1 6 ALA A 101 ? ALA A 104 ? ALA A 132 ALA A 135 AA1 7 HIS A 122 ? SER A 123 ? HIS A 153 SER A 154 AA2 1 ALA A 133 ? PHE A 136 ? ALA A 164 PHE A 167 AA2 2 VAL A 139 ? PHE A 142 ? VAL A 170 PHE A 173 AA2 3 VAL A 154 ? VAL A 157 ? VAL A 185 VAL A 188 AA2 4 VAL A 162 ? GLY A 166 ? VAL A 193 GLY A 197 AA2 5 PHE A 204 ? PRO A 207 ? PHE A 235 PRO A 238 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 18 ? N ILE A 49 O VAL A 22 ? O VAL A 53 AA1 2 3 N TRP A 23 ? N TRP A 54 O ILE A 42 ? O ILE A 73 AA1 3 4 N LEU A 41 ? N LEU A 72 O ILE A 52 ? O ILE A 83 AA1 4 5 N LEU A 51 ? N LEU A 82 O ARG A 78 ? O ARG A 109 AA1 5 6 N THR A 77 ? N THR A 108 O ALA A 101 ? O ALA A 132 AA1 6 7 N THR A 102 ? N THR A 133 O HIS A 122 ? O HIS A 153 AA2 1 2 N VAL A 134 ? N VAL A 165 O LEU A 141 ? O LEU A 172 AA2 2 3 N PHE A 142 ? N PHE A 173 O VAL A 154 ? O VAL A 185 AA2 3 4 N VAL A 155 ? N VAL A 186 O TYR A 164 ? O TYR A 195 AA2 4 5 N LEU A 163 ? N LEU A 194 O PHE A 204 ? O PHE A 235 # _atom_sites.entry_id 7YHD _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.014835 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012892 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012655 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 32 32 GLU GLU A . n A 1 2 TYR 2 33 33 TYR TYR A . n A 1 3 PRO 3 34 34 PRO PRO A . n A 1 4 THR 4 35 35 THR THR A . n A 1 5 VAL 5 36 36 VAL VAL A . n A 1 6 SER 6 37 37 SER SER A . n A 1 7 GLU 7 38 38 GLU GLU A . n A 1 8 ILE 8 39 39 ILE ILE A . n A 1 9 PRO 9 40 40 PRO PRO A . n A 1 10 VAL 10 41 41 VAL VAL A . n A 1 11 GLY 11 42 42 GLY GLY A . n A 1 12 GLU 12 43 43 GLU GLU A . n A 1 13 VAL 13 44 44 VAL VAL A . n A 1 14 ARG 14 45 45 ARG ARG A . n A 1 15 LEU 15 46 46 LEU LEU A . n A 1 16 TYR 16 47 47 TYR TYR A . n A 1 17 GLN 17 48 48 GLN GLN A . n A 1 18 ILE 18 49 49 ILE ILE A . n A 1 19 ALA 19 50 50 ALA ALA A . n A 1 20 ASP 20 51 51 ASP ASP A . n A 1 21 GLY 21 52 52 GLY GLY A . n A 1 22 VAL 22 53 53 VAL VAL A . n A 1 23 TRP 23 54 54 TRP TRP A . n A 1 24 SER 24 55 55 SER SER A . n A 1 25 HIS 25 56 56 HIS HIS A . n A 1 26 ILE 26 57 57 ILE ILE A . n A 1 27 ALA 27 58 58 ALA ALA A . n A 1 28 THR 28 59 59 THR THR A . n A 1 29 GLN 29 60 60 GLN GLN A . n A 1 30 SER 30 61 61 SER SER A . n A 1 31 PHE 31 62 62 PHE PHE A . n A 1 32 ASP 32 63 63 ASP ASP A . n A 1 33 GLY 33 64 64 GLY GLY A . n A 1 34 ALA 34 65 65 ALA ALA A . n A 1 35 VAL 35 66 66 VAL VAL A . n A 1 36 TYR 36 67 67 TYR TYR A . n A 1 37 PRO 37 68 68 PRO PRO A . n A 1 38 SER 38 69 69 SER SER A . n A 1 39 ASN 39 70 70 ASN ASN A . n A 1 40 GLY 40 71 71 GLY GLY A . n A 1 41 LEU 41 72 72 LEU LEU A . n A 1 42 ILE 42 73 73 ILE ILE A . n A 1 43 VAL 43 74 74 VAL VAL A . n A 1 44 ARG 44 75 75 ARG ARG A . n A 1 45 ASP 45 76 76 ASP ASP A . n A 1 46 GLY 46 77 77 GLY GLY A . n A 1 47 ASP 47 78 78 ASP ASP A . n A 1 48 GLU 48 79 79 GLU GLU A . n A 1 49 LEU 49 80 80 LEU LEU A . n A 1 50 LEU 50 81 81 LEU LEU A . n A 1 51 LEU 51 82 82 LEU LEU A . n A 1 52 ILE 52 83 83 ILE ILE A . n A 1 53 ASP 53 84 84 ASP ASP A . n A 1 54 THR 54 85 85 THR THR A . n A 1 55 ALA 55 86 86 ALA ALA A . n A 1 56 TRP 56 87 87 TRP TRP A . n A 1 57 GLY 57 88 88 GLY GLY A . n A 1 58 ALA 58 89 89 ALA ALA A . n A 1 59 LYS 59 90 90 LYS LYS A . n A 1 60 ASN 60 91 91 ASN ASN A . n A 1 61 THR 61 92 92 THR THR A . n A 1 62 ALA 62 93 93 ALA ALA A . n A 1 63 ALA 63 94 94 ALA ALA A . n A 1 64 LEU 64 95 95 LEU LEU A . n A 1 65 LEU 65 96 96 LEU LEU A . n A 1 66 ALA 66 97 97 ALA ALA A . n A 1 67 GLU 67 98 98 GLU GLU A . n A 1 68 ILE 68 99 99 ILE ILE A . n A 1 69 GLU 69 100 100 GLU GLU A . n A 1 70 LYS 70 101 101 LYS LYS A . n A 1 71 GLN 71 102 102 GLN GLN A . n A 1 72 ILE 72 103 103 ILE ILE A . n A 1 73 GLY 73 104 104 GLY GLY A . n A 1 74 LEU 74 105 105 LEU LEU A . n A 1 75 PRO 75 106 106 PRO PRO A . n A 1 76 VAL 76 107 107 VAL VAL A . n A 1 77 THR 77 108 108 THR THR A . n A 1 78 ARG 78 109 109 ARG ARG A . n A 1 79 ALA 79 110 110 ALA ALA A . n A 1 80 VAL 80 111 111 VAL VAL A . n A 1 81 SER 81 112 112 SER SER A . n A 1 82 THR 82 113 113 THR THR A . n A 1 83 HIS 83 114 114 HIS HIS A . n A 1 84 PHE 84 115 115 PHE PHE A . n A 1 85 HIS 85 116 116 HIS HIS A . n A 1 86 ASP 86 117 117 ASP ASP A . n A 1 87 ASP 87 118 118 ASP ASP A . n A 1 88 ARG 88 119 119 ARG ARG A . n A 1 89 VAL 89 120 120 VAL VAL A . n A 1 90 GLY 90 121 121 GLY GLY A . n A 1 91 GLY 91 122 122 GLY GLY A . n A 1 92 VAL 92 123 123 VAL VAL A . n A 1 93 ASP 93 124 124 ASP ASP A . n A 1 94 VAL 94 125 125 VAL VAL A . n A 1 95 LEU 95 126 126 LEU LEU A . n A 1 96 ARG 96 127 127 ARG ARG A . n A 1 97 ALA 97 128 128 ALA ALA A . n A 1 98 ALA 98 129 129 ALA ALA A . n A 1 99 GLY 99 130 130 GLY GLY A . n A 1 100 VAL 100 131 131 VAL VAL A . n A 1 101 ALA 101 132 132 ALA ALA A . n A 1 102 THR 102 133 133 THR THR A . n A 1 103 TYR 103 134 134 TYR TYR A . n A 1 104 ALA 104 135 135 ALA ALA A . n A 1 105 SER 105 136 136 SER SER A . n A 1 106 PRO 106 137 137 PRO PRO A . n A 1 107 SER 107 138 138 SER SER A . n A 1 108 THR 108 139 139 THR THR A . n A 1 109 ARG 109 140 140 ARG ARG A . n A 1 110 ARG 110 141 141 ARG ARG A . n A 1 111 LEU 111 142 142 LEU LEU A . n A 1 112 ALA 112 143 143 ALA ALA A . n A 1 113 GLU 113 144 144 GLU GLU A . n A 1 114 VAL 114 145 145 VAL VAL A . n A 1 115 GLU 115 146 146 GLU GLU A . n A 1 116 GLY 116 147 147 GLY GLY A . n A 1 117 ASN 117 148 148 ASN ASN A . n A 1 118 GLU 118 149 149 GLU GLU A . n A 1 119 ILE 119 150 150 ILE ILE A . n A 1 120 PRO 120 151 151 PRO PRO A . n A 1 121 THR 121 152 152 THR THR A . n A 1 122 HIS 122 153 153 HIS HIS A . n A 1 123 SER 123 154 154 SER SER A . n A 1 124 LEU 124 155 155 LEU LEU A . n A 1 125 GLU 125 156 156 GLU GLU A . n A 1 126 GLY 126 157 157 GLY GLY A . n A 1 127 LEU 127 158 158 LEU LEU A . n A 1 128 SER 128 159 159 SER SER A . n A 1 129 SER 129 160 160 SER SER A . n A 1 130 SER 130 161 161 SER SER A . n A 1 131 GLY 131 162 162 GLY GLY A . n A 1 132 ASP 132 163 163 ASP ASP A . n A 1 133 ALA 133 164 164 ALA ALA A . n A 1 134 VAL 134 165 165 VAL VAL A . n A 1 135 ARG 135 166 166 ARG ARG A . n A 1 136 PHE 136 167 167 PHE PHE A . n A 1 137 GLY 137 168 168 GLY GLY A . n A 1 138 PRO 138 169 169 PRO PRO A . n A 1 139 VAL 139 170 170 VAL VAL A . n A 1 140 GLU 140 171 171 GLU GLU A . n A 1 141 LEU 141 172 172 LEU LEU A . n A 1 142 PHE 142 173 173 PHE PHE A . n A 1 143 TYR 143 174 174 TYR TYR A . n A 1 144 PRO 144 175 175 PRO PRO A . n A 1 145 GLY 145 176 176 GLY GLY A . n A 1 146 ALA 146 177 177 ALA ALA A . n A 1 147 ALA 147 178 178 ALA ALA A . n A 1 148 HIS 148 179 179 HIS HIS A . n A 1 149 SER 149 180 180 SER SER A . n A 1 150 THR 150 181 181 THR THR A . n A 1 151 ASP 151 182 182 ASP ASP A . n A 1 152 ASN 152 183 183 ASN ASN A . n A 1 153 LEU 153 184 184 LEU LEU A . n A 1 154 VAL 154 185 185 VAL VAL A . n A 1 155 VAL 155 186 186 VAL VAL A . n A 1 156 TYR 156 187 187 TYR TYR A . n A 1 157 VAL 157 188 188 VAL VAL A . n A 1 158 PRO 158 189 189 PRO PRO A . n A 1 159 SER 159 190 190 SER SER A . n A 1 160 ALA 160 191 191 ALA ALA A . n A 1 161 SER 161 192 192 SER SER A . n A 1 162 VAL 162 193 193 VAL VAL A . n A 1 163 LEU 163 194 194 LEU LEU A . n A 1 164 TYR 164 195 195 TYR TYR A . n A 1 165 GLY 165 196 196 GLY GLY A . n A 1 166 GLY 166 197 197 GLY GLY A . n A 1 167 CYS 167 198 198 CYS CYS A . n A 1 168 ALA 168 199 199 ALA ALA A . n A 1 169 ILE 169 200 200 ILE ILE A . n A 1 170 TYR 170 201 201 TYR TYR A . n A 1 171 GLU 171 202 202 GLU GLU A . n A 1 172 LEU 172 203 203 LEU LEU A . n A 1 173 SER 173 204 204 SER SER A . n A 1 174 ARG 174 205 205 ARG ARG A . n A 1 175 THR 175 206 206 THR THR A . n A 1 176 SER 176 207 207 SER SER A . n A 1 177 ALA 177 208 208 ALA ALA A . n A 1 178 GLY 178 209 209 GLY GLY A . n A 1 179 ASN 179 210 210 ASN ASN A . n A 1 180 VAL 180 211 211 VAL VAL A . n A 1 181 ALA 181 212 212 ALA ALA A . n A 1 182 ASP 182 213 213 ASP ASP A . n A 1 183 ALA 183 214 214 ALA ALA A . n A 1 184 ASP 184 215 215 ASP ASP A . n A 1 185 LEU 185 216 216 LEU LEU A . n A 1 186 ALA 186 217 217 ALA ALA A . n A 1 187 GLU 187 218 218 GLU GLU A . n A 1 188 TRP 188 219 219 TRP TRP A . n A 1 189 PRO 189 220 220 PRO PRO A . n A 1 190 THR 190 221 221 THR THR A . n A 1 191 SER 191 222 222 SER SER A . n A 1 192 ILE 192 223 223 ILE ILE A . n A 1 193 GLU 193 224 224 GLU GLU A . n A 1 194 ARG 194 225 225 ARG ARG A . n A 1 195 ILE 195 226 226 ILE ILE A . n A 1 196 GLN 196 227 227 GLN GLN A . n A 1 197 GLN 197 228 228 GLN GLN A . n A 1 198 HIS 198 229 229 HIS HIS A . n A 1 199 TYR 199 230 230 TYR TYR A . n A 1 200 PRO 200 231 231 PRO PRO A . n A 1 201 GLU 201 232 232 GLU GLU A . n A 1 202 ALA 202 233 233 ALA ALA A . n A 1 203 GLN 203 234 234 GLN GLN A . n A 1 204 PHE 204 235 235 PHE PHE A . n A 1 205 VAL 205 236 236 VAL VAL A . n A 1 206 ILE 206 237 237 ILE ILE A . n A 1 207 PRO 207 238 238 PRO PRO A . n A 1 208 GLY 208 239 239 GLY GLY A . n A 1 209 HIS 209 240 240 HIS HIS A . n A 1 210 GLY 210 241 241 GLY GLY A . n A 1 211 LEU 211 242 242 LEU LEU A . n A 1 212 PRO 212 243 243 PRO PRO A . n A 1 213 GLY 213 244 244 GLY GLY A . n A 1 214 GLY 214 245 245 GLY GLY A . n A 1 215 LEU 215 246 246 LEU LEU A . n A 1 216 ASP 216 247 247 ASP ASP A . n A 1 217 LEU 217 248 248 LEU LEU A . n A 1 218 LEU 218 249 249 LEU LEU A . n A 1 219 LYS 219 250 250 LYS LYS A . n A 1 220 HIS 220 251 251 HIS HIS A . n A 1 221 THR 221 252 252 THR THR A . n A 1 222 THR 222 253 253 THR THR A . n A 1 223 ASN 223 254 254 ASN ASN A . n A 1 224 VAL 224 255 255 VAL VAL A . n A 1 225 VAL 225 256 256 VAL VAL A . n A 1 226 LYS 226 257 257 LYS LYS A . n A 1 227 ALA 227 258 258 ALA ALA A . n A 1 228 HIS 228 259 259 HIS HIS A . n A 1 229 THR 229 260 260 THR THR A . n A 1 230 ASN 230 261 261 ASN ASN A . n A 1 231 ARG 231 262 262 ARG ARG A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email liguobo@scu.edu.cn _pdbx_contact_author.name_first Guo-Bo _pdbx_contact_author.name_last Li _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-4915-6677 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 301 301 ZN ZN A . C 2 ZN 1 302 302 ZN ZN A . D 3 IU7 1 303 401 IU7 112 A . E 4 HOH 1 401 14 HOH HOH A . E 4 HOH 2 402 1 HOH HOH A . E 4 HOH 3 403 29 HOH HOH A . E 4 HOH 4 404 46 HOH HOH A . E 4 HOH 5 405 35 HOH HOH A . E 4 HOH 6 406 10 HOH HOH A . E 4 HOH 7 407 26 HOH HOH A . E 4 HOH 8 408 30 HOH HOH A . E 4 HOH 9 409 19 HOH HOH A . E 4 HOH 10 410 12 HOH HOH A . E 4 HOH 11 411 4 HOH HOH A . E 4 HOH 12 412 15 HOH HOH A . E 4 HOH 13 413 37 HOH HOH A . E 4 HOH 14 414 25 HOH HOH A . E 4 HOH 15 415 3 HOH HOH A . E 4 HOH 16 416 38 HOH HOH A . E 4 HOH 17 417 6 HOH HOH A . E 4 HOH 18 418 13 HOH HOH A . E 4 HOH 19 419 21 HOH HOH A . E 4 HOH 20 420 5 HOH HOH A . E 4 HOH 21 421 18 HOH HOH A . E 4 HOH 22 422 32 HOH HOH A . E 4 HOH 23 423 24 HOH HOH A . E 4 HOH 24 424 7 HOH HOH A . E 4 HOH 25 425 33 HOH HOH A . E 4 HOH 26 426 34 HOH HOH A . E 4 HOH 27 427 22 HOH HOH A . E 4 HOH 28 428 8 HOH HOH A . E 4 HOH 29 429 20 HOH HOH A . E 4 HOH 30 430 44 HOH HOH A . E 4 HOH 31 431 42 HOH HOH A . E 4 HOH 32 432 47 HOH HOH A . E 4 HOH 33 433 27 HOH HOH A . E 4 HOH 34 434 9 HOH HOH A . E 4 HOH 35 435 28 HOH HOH A . E 4 HOH 36 436 45 HOH HOH A . E 4 HOH 37 437 11 HOH HOH A . E 4 HOH 38 438 40 HOH HOH A . E 4 HOH 39 439 16 HOH HOH A . E 4 HOH 40 440 31 HOH HOH A . E 4 HOH 41 441 23 HOH HOH A . E 4 HOH 42 442 41 HOH HOH A . E 4 HOH 43 443 43 HOH HOH A . E 4 HOH 44 444 36 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 83 ? A HIS 114 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 ND1 ? A HIS 85 ? A HIS 116 ? 1_555 89.3 ? 2 NE2 ? A HIS 83 ? A HIS 114 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 NE2 ? A HIS 148 ? A HIS 179 ? 1_555 98.8 ? 3 ND1 ? A HIS 85 ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 NE2 ? A HIS 148 ? A HIS 179 ? 1_555 102.0 ? 4 NE2 ? A HIS 83 ? A HIS 114 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O03 ? D IU7 . ? A IU7 303 ? 1_555 127.5 ? 5 ND1 ? A HIS 85 ? A HIS 116 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O03 ? D IU7 . ? A IU7 303 ? 1_555 120.1 ? 6 NE2 ? A HIS 148 ? A HIS 179 ? 1_555 ZN ? C ZN . ? A ZN 302 ? 1_555 O03 ? D IU7 . ? A IU7 303 ? 1_555 113.9 ? 7 OD2 ? A ASP 87 ? A ASP 118 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 SG ? A CYS 167 ? A CYS 198 ? 1_555 99.1 ? 8 OD2 ? A ASP 87 ? A ASP 118 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 209 ? A HIS 240 ? 1_555 94.1 ? 9 SG ? A CYS 167 ? A CYS 198 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 209 ? A HIS 240 ? 1_555 103.1 ? 10 OD2 ? A ASP 87 ? A ASP 118 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O03 ? D IU7 . ? A IU7 303 ? 1_555 85.6 ? 11 SG ? A CYS 167 ? A CYS 198 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O03 ? D IU7 . ? A IU7 303 ? 1_555 114.8 ? 12 NE2 ? A HIS 209 ? A HIS 240 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O03 ? D IU7 . ? A IU7 303 ? 1_555 141.6 ? 13 OD2 ? A ASP 87 ? A ASP 118 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O08 ? D IU7 . ? A IU7 303 ? 1_555 162.0 ? 14 SG ? A CYS 167 ? A CYS 198 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O08 ? D IU7 . ? A IU7 303 ? 1_555 98.7 ? 15 NE2 ? A HIS 209 ? A HIS 240 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O08 ? D IU7 . ? A IU7 303 ? 1_555 79.3 ? 16 O03 ? D IU7 . ? A IU7 303 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 O08 ? D IU7 . ? A IU7 303 ? 1_555 89.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-06-07 2 'Structure model' 1 1 2023-11-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' pdbx_initial_refinement_model # _pdbx_phasing_MR.entry_id 7YHD _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 5.780 _pdbx_phasing_MR.d_res_low_rotation 19.390 _pdbx_phasing_MR.d_res_high_translation 5.780 _pdbx_phasing_MR.d_res_low_translation 19.390 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.6.0 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.10.1 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.27 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 5 # _pdbx_entry_details.entry_id 7YHD _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 402 ? ? O A HOH 432 ? ? 1.36 2 1 O A HOH 404 ? ? O A HOH 436 ? ? 1.53 3 1 O A ARG 262 ? ? O A HOH 401 ? ? 1.89 4 1 NE2 A HIS 153 ? ? O A HOH 402 ? ? 1.89 5 1 O A TYR 33 ? ? O A HOH 403 ? ? 2.04 6 1 OE1 A GLU 202 ? ? O A HOH 405 ? ? 2.15 7 1 ND1 A HIS 251 ? ? O A HOH 404 ? ? 2.15 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 402 ? ? 1_555 O A HOH 404 ? ? 6_555 1.35 2 1 OD1 A ASP 63 ? ? 1_555 OG A SER 207 ? ? 3_555 2.00 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 37 ? ? -67.40 1.07 2 1 PRO A 40 ? ? -43.12 170.52 3 1 ALA A 50 ? ? 173.95 172.54 4 1 ASP A 84 ? ? 73.55 156.13 5 1 TRP A 87 ? ? 68.28 75.18 6 1 ILE A 99 ? ? -21.25 -63.73 7 1 HIS A 114 ? ? -172.92 -178.57 8 1 ALA A 129 ? ? -68.51 7.32 9 1 ALA A 135 ? ? -173.92 141.67 10 1 SER A 136 ? ? -49.04 150.69 11 1 LEU A 155 ? ? -102.42 70.64 12 1 GLU A 156 ? ? -49.21 158.10 13 1 LEU A 158 ? ? -143.73 34.82 14 1 SER A 161 ? ? -42.12 150.22 15 1 ALA A 178 ? ? -158.86 -109.48 16 1 ALA A 208 ? ? -34.16 -70.58 17 1 ASN A 210 ? ? -7.44 97.30 18 1 SER A 222 ? ? -34.78 -34.53 19 1 TYR A 230 ? ? -142.53 52.78 20 1 ASN A 261 ? ? -82.69 37.48 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 32 ? CG ? A GLU 1 CG 2 1 Y 1 A GLU 32 ? CD ? A GLU 1 CD 3 1 Y 1 A GLU 32 ? OE1 ? A GLU 1 OE1 4 1 Y 1 A GLU 32 ? OE2 ? A GLU 1 OE2 5 1 Y 1 A ARG 262 ? CG ? A ARG 231 CG 6 1 Y 1 A ARG 262 ? CD ? A ARG 231 CD 7 1 Y 1 A ARG 262 ? NE ? A ARG 231 NE 8 1 Y 1 A ARG 262 ? CZ ? A ARG 231 CZ 9 1 Y 1 A ARG 262 ? NH1 ? A ARG 231 NH1 10 1 Y 1 A ARG 262 ? NH2 ? A ARG 231 NH2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 IU7 O01 O N N 183 IU7 C02 C N N 184 IU7 O03 O N N 185 IU7 C04 C Y N 186 IU7 C05 C Y N 187 IU7 C06 C N N 188 IU7 O07 O N N 189 IU7 O08 O N N 190 IU7 C09 C Y N 191 IU7 C10 C Y N 192 IU7 C11 C Y N 193 IU7 C12 C Y N 194 IU7 N13 N Y N 195 IU7 N14 N Y N 196 IU7 N15 N Y N 197 IU7 C16 C Y N 198 IU7 C17 C Y N 199 IU7 C18 C Y N 200 IU7 C19 C Y N 201 IU7 C20 C Y N 202 IU7 O21 O N N 203 IU7 C22 C N N 204 IU7 C23 C N N 205 IU7 N24 N N N 206 IU7 C25 C Y N 207 IU7 C26 C Y N 208 IU7 C27 C Y N 209 IU7 H1 H N N 210 IU7 H2 H N N 211 IU7 H3 H N N 212 IU7 H4 H N N 213 IU7 H5 H N N 214 IU7 H6 H N N 215 IU7 H7 H N N 216 IU7 H8 H N N 217 IU7 H9 H N N 218 IU7 H10 H N N 219 IU7 H11 H N N 220 IU7 H12 H N N 221 IU7 H13 H N N 222 IU7 H15 H N N 223 IU7 H16 H N N 224 IU7 H17 H N N 225 LEU N N N N 226 LEU CA C N S 227 LEU C C N N 228 LEU O O N N 229 LEU CB C N N 230 LEU CG C N N 231 LEU CD1 C N N 232 LEU CD2 C N N 233 LEU OXT O N N 234 LEU H H N N 235 LEU H2 H N N 236 LEU HA H N N 237 LEU HB2 H N N 238 LEU HB3 H N N 239 LEU HG H N N 240 LEU HD11 H N N 241 LEU HD12 H N N 242 LEU HD13 H N N 243 LEU HD21 H N N 244 LEU HD22 H N N 245 LEU HD23 H N N 246 LEU HXT H N N 247 LYS N N N N 248 LYS CA C N S 249 LYS C C N N 250 LYS O O N N 251 LYS CB C N N 252 LYS CG C N N 253 LYS CD C N N 254 LYS CE C N N 255 LYS NZ N N N 256 LYS OXT O N N 257 LYS H H N N 258 LYS H2 H N N 259 LYS HA H N N 260 LYS HB2 H N N 261 LYS HB3 H N N 262 LYS HG2 H N N 263 LYS HG3 H N N 264 LYS HD2 H N N 265 LYS HD3 H N N 266 LYS HE2 H N N 267 LYS HE3 H N N 268 LYS HZ1 H N N 269 LYS HZ2 H N N 270 LYS HZ3 H N N 271 LYS HXT H N N 272 PHE N N N N 273 PHE CA C N S 274 PHE C C N N 275 PHE O O N N 276 PHE CB C N N 277 PHE CG C Y N 278 PHE CD1 C Y N 279 PHE CD2 C Y N 280 PHE CE1 C Y N 281 PHE CE2 C Y N 282 PHE CZ C Y N 283 PHE OXT O N N 284 PHE H H N N 285 PHE H2 H N N 286 PHE HA H N N 287 PHE HB2 H N N 288 PHE HB3 H N N 289 PHE HD1 H N N 290 PHE HD2 H N N 291 PHE HE1 H N N 292 PHE HE2 H N N 293 PHE HZ H N N 294 PHE HXT H N N 295 PRO N N N N 296 PRO CA C N S 297 PRO C C N N 298 PRO O O N N 299 PRO CB C N N 300 PRO CG C N N 301 PRO CD C N N 302 PRO OXT O N N 303 PRO H H N N 304 PRO HA H N N 305 PRO HB2 H N N 306 PRO HB3 H N N 307 PRO HG2 H N N 308 PRO HG3 H N N 309 PRO HD2 H N N 310 PRO HD3 H N N 311 PRO HXT H N N 312 SER N N N N 313 SER CA C N S 314 SER C C N N 315 SER O O N N 316 SER CB C N N 317 SER OG O N N 318 SER OXT O N N 319 SER H H N N 320 SER H2 H N N 321 SER HA H N N 322 SER HB2 H N N 323 SER HB3 H N N 324 SER HG H N N 325 SER HXT H N N 326 THR N N N N 327 THR CA C N S 328 THR C C N N 329 THR O O N N 330 THR CB C N R 331 THR OG1 O N N 332 THR CG2 C N N 333 THR OXT O N N 334 THR H H N N 335 THR H2 H N N 336 THR HA H N N 337 THR HB H N N 338 THR HG1 H N N 339 THR HG21 H N N 340 THR HG22 H N N 341 THR HG23 H N N 342 THR HXT H N N 343 TRP N N N N 344 TRP CA C N S 345 TRP C C N N 346 TRP O O N N 347 TRP CB C N N 348 TRP CG C Y N 349 TRP CD1 C Y N 350 TRP CD2 C Y N 351 TRP NE1 N Y N 352 TRP CE2 C Y N 353 TRP CE3 C Y N 354 TRP CZ2 C Y N 355 TRP CZ3 C Y N 356 TRP CH2 C Y N 357 TRP OXT O N N 358 TRP H H N N 359 TRP H2 H N N 360 TRP HA H N N 361 TRP HB2 H N N 362 TRP HB3 H N N 363 TRP HD1 H N N 364 TRP HE1 H N N 365 TRP HE3 H N N 366 TRP HZ2 H N N 367 TRP HZ3 H N N 368 TRP HH2 H N N 369 TRP HXT H N N 370 TYR N N N N 371 TYR CA C N S 372 TYR C C N N 373 TYR O O N N 374 TYR CB C N N 375 TYR CG C Y N 376 TYR CD1 C Y N 377 TYR CD2 C Y N 378 TYR CE1 C Y N 379 TYR CE2 C Y N 380 TYR CZ C Y N 381 TYR OH O N N 382 TYR OXT O N N 383 TYR H H N N 384 TYR H2 H N N 385 TYR HA H N N 386 TYR HB2 H N N 387 TYR HB3 H N N 388 TYR HD1 H N N 389 TYR HD2 H N N 390 TYR HE1 H N N 391 TYR HE2 H N N 392 TYR HH H N N 393 TYR HXT H N N 394 VAL N N N N 395 VAL CA C N S 396 VAL C C N N 397 VAL O O N N 398 VAL CB C N N 399 VAL CG1 C N N 400 VAL CG2 C N N 401 VAL OXT O N N 402 VAL H H N N 403 VAL H2 H N N 404 VAL HA H N N 405 VAL HB H N N 406 VAL HG11 H N N 407 VAL HG12 H N N 408 VAL HG13 H N N 409 VAL HG21 H N N 410 VAL HG22 H N N 411 VAL HG23 H N N 412 VAL HXT H N N 413 ZN ZN ZN N N 414 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 IU7 O07 C06 doub N N 173 IU7 C09 C10 doub Y N 174 IU7 C09 C05 sing Y N 175 IU7 C06 O08 sing N N 176 IU7 C06 C05 sing N N 177 IU7 C10 C11 sing Y N 178 IU7 C05 C04 doub Y N 179 IU7 C11 C12 doub Y N 180 IU7 C04 C12 sing Y N 181 IU7 C04 C02 sing N N 182 IU7 C12 N13 sing N N 183 IU7 O01 C02 doub N N 184 IU7 C02 O03 sing N N 185 IU7 N13 C27 sing Y N 186 IU7 N13 N14 sing Y N 187 IU7 C27 C16 doub Y N 188 IU7 N14 N15 doub Y N 189 IU7 C16 N15 sing Y N 190 IU7 C16 C17 sing N N 191 IU7 C17 C26 doub Y N 192 IU7 C17 C18 sing Y N 193 IU7 C26 C25 sing Y N 194 IU7 C18 C19 doub Y N 195 IU7 C25 C20 doub Y N 196 IU7 C19 C20 sing Y N 197 IU7 C20 O21 sing N N 198 IU7 C22 O21 sing N N 199 IU7 C22 C23 sing N N 200 IU7 C23 N24 sing N N 201 IU7 O03 H1 sing N N 202 IU7 O08 H2 sing N N 203 IU7 C09 H3 sing N N 204 IU7 C10 H4 sing N N 205 IU7 C11 H5 sing N N 206 IU7 C18 H6 sing N N 207 IU7 C19 H7 sing N N 208 IU7 C22 H8 sing N N 209 IU7 C22 H9 sing N N 210 IU7 C23 H10 sing N N 211 IU7 C23 H11 sing N N 212 IU7 N24 H12 sing N N 213 IU7 N24 H13 sing N N 214 IU7 C25 H15 sing N N 215 IU7 C26 H16 sing N N 216 IU7 C27 H17 sing N N 217 LEU N CA sing N N 218 LEU N H sing N N 219 LEU N H2 sing N N 220 LEU CA C sing N N 221 LEU CA CB sing N N 222 LEU CA HA sing N N 223 LEU C O doub N N 224 LEU C OXT sing N N 225 LEU CB CG sing N N 226 LEU CB HB2 sing N N 227 LEU CB HB3 sing N N 228 LEU CG CD1 sing N N 229 LEU CG CD2 sing N N 230 LEU CG HG sing N N 231 LEU CD1 HD11 sing N N 232 LEU CD1 HD12 sing N N 233 LEU CD1 HD13 sing N N 234 LEU CD2 HD21 sing N N 235 LEU CD2 HD22 sing N N 236 LEU CD2 HD23 sing N N 237 LEU OXT HXT sing N N 238 LYS N CA sing N N 239 LYS N H sing N N 240 LYS N H2 sing N N 241 LYS CA C sing N N 242 LYS CA CB sing N N 243 LYS CA HA sing N N 244 LYS C O doub N N 245 LYS C OXT sing N N 246 LYS CB CG sing N N 247 LYS CB HB2 sing N N 248 LYS CB HB3 sing N N 249 LYS CG CD sing N N 250 LYS CG HG2 sing N N 251 LYS CG HG3 sing N N 252 LYS CD CE sing N N 253 LYS CD HD2 sing N N 254 LYS CD HD3 sing N N 255 LYS CE NZ sing N N 256 LYS CE HE2 sing N N 257 LYS CE HE3 sing N N 258 LYS NZ HZ1 sing N N 259 LYS NZ HZ2 sing N N 260 LYS NZ HZ3 sing N N 261 LYS OXT HXT sing N N 262 PHE N CA sing N N 263 PHE N H sing N N 264 PHE N H2 sing N N 265 PHE CA C sing N N 266 PHE CA CB sing N N 267 PHE CA HA sing N N 268 PHE C O doub N N 269 PHE C OXT sing N N 270 PHE CB CG sing N N 271 PHE CB HB2 sing N N 272 PHE CB HB3 sing N N 273 PHE CG CD1 doub Y N 274 PHE CG CD2 sing Y N 275 PHE CD1 CE1 sing Y N 276 PHE CD1 HD1 sing N N 277 PHE CD2 CE2 doub Y N 278 PHE CD2 HD2 sing N N 279 PHE CE1 CZ doub Y N 280 PHE CE1 HE1 sing N N 281 PHE CE2 CZ sing Y N 282 PHE CE2 HE2 sing N N 283 PHE CZ HZ sing N N 284 PHE OXT HXT sing N N 285 PRO N CA sing N N 286 PRO N CD sing N N 287 PRO N H sing N N 288 PRO CA C sing N N 289 PRO CA CB sing N N 290 PRO CA HA sing N N 291 PRO C O doub N N 292 PRO C OXT sing N N 293 PRO CB CG sing N N 294 PRO CB HB2 sing N N 295 PRO CB HB3 sing N N 296 PRO CG CD sing N N 297 PRO CG HG2 sing N N 298 PRO CG HG3 sing N N 299 PRO CD HD2 sing N N 300 PRO CD HD3 sing N N 301 PRO OXT HXT sing N N 302 SER N CA sing N N 303 SER N H sing N N 304 SER N H2 sing N N 305 SER CA C sing N N 306 SER CA CB sing N N 307 SER CA HA sing N N 308 SER C O doub N N 309 SER C OXT sing N N 310 SER CB OG sing N N 311 SER CB HB2 sing N N 312 SER CB HB3 sing N N 313 SER OG HG sing N N 314 SER OXT HXT sing N N 315 THR N CA sing N N 316 THR N H sing N N 317 THR N H2 sing N N 318 THR CA C sing N N 319 THR CA CB sing N N 320 THR CA HA sing N N 321 THR C O doub N N 322 THR C OXT sing N N 323 THR CB OG1 sing N N 324 THR CB CG2 sing N N 325 THR CB HB sing N N 326 THR OG1 HG1 sing N N 327 THR CG2 HG21 sing N N 328 THR CG2 HG22 sing N N 329 THR CG2 HG23 sing N N 330 THR OXT HXT sing N N 331 TRP N CA sing N N 332 TRP N H sing N N 333 TRP N H2 sing N N 334 TRP CA C sing N N 335 TRP CA CB sing N N 336 TRP CA HA sing N N 337 TRP C O doub N N 338 TRP C OXT sing N N 339 TRP CB CG sing N N 340 TRP CB HB2 sing N N 341 TRP CB HB3 sing N N 342 TRP CG CD1 doub Y N 343 TRP CG CD2 sing Y N 344 TRP CD1 NE1 sing Y N 345 TRP CD1 HD1 sing N N 346 TRP CD2 CE2 doub Y N 347 TRP CD2 CE3 sing Y N 348 TRP NE1 CE2 sing Y N 349 TRP NE1 HE1 sing N N 350 TRP CE2 CZ2 sing Y N 351 TRP CE3 CZ3 doub Y N 352 TRP CE3 HE3 sing N N 353 TRP CZ2 CH2 doub Y N 354 TRP CZ2 HZ2 sing N N 355 TRP CZ3 CH2 sing Y N 356 TRP CZ3 HZ3 sing N N 357 TRP CH2 HH2 sing N N 358 TRP OXT HXT sing N N 359 TYR N CA sing N N 360 TYR N H sing N N 361 TYR N H2 sing N N 362 TYR CA C sing N N 363 TYR CA CB sing N N 364 TYR CA HA sing N N 365 TYR C O doub N N 366 TYR C OXT sing N N 367 TYR CB CG sing N N 368 TYR CB HB2 sing N N 369 TYR CB HB3 sing N N 370 TYR CG CD1 doub Y N 371 TYR CG CD2 sing Y N 372 TYR CD1 CE1 sing Y N 373 TYR CD1 HD1 sing N N 374 TYR CD2 CE2 doub Y N 375 TYR CD2 HD2 sing N N 376 TYR CE1 CZ doub Y N 377 TYR CE1 HE1 sing N N 378 TYR CE2 CZ sing Y N 379 TYR CE2 HE2 sing N N 380 TYR CZ OH sing N N 381 TYR OH HH sing N N 382 TYR OXT HXT sing N N 383 VAL N CA sing N N 384 VAL N H sing N N 385 VAL N H2 sing N N 386 VAL CA C sing N N 387 VAL CA CB sing N N 388 VAL CA HA sing N N 389 VAL C O doub N N 390 VAL C OXT sing N N 391 VAL CB CG1 sing N N 392 VAL CB CG2 sing N N 393 VAL CB HB sing N N 394 VAL CG1 HG11 sing N N 395 VAL CG1 HG12 sing N N 396 VAL CG1 HG13 sing N N 397 VAL CG2 HG21 sing N N 398 VAL CG2 HG22 sing N N 399 VAL CG2 HG23 sing N N 400 VAL OXT HXT sing N N 401 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Natural Science Foundation of China (NSFC)' China 82122065 1 'National Natural Science Foundation of China (NSFC)' China 82073698 2 'National Natural Science Foundation of China (NSFC)' China 81874291 3 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id IU7 _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id IU7 _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 '3-[4-[4-(2-azanylethoxy)phenyl]-1,2,3-triazol-1-yl]phthalic acid' IU7 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 6JN6 _pdbx_initial_refinement_model.details ? # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? #