data_7YIP # _entry.id 7YIP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.362 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7YIP pdb_00007yip 10.2210/pdb7yip/pdb WWPDB D_1300030080 ? ? # _pdbx_database_PDB_obs_spr.id OBSLTE _pdbx_database_PDB_obs_spr.date 2023-02-01 _pdbx_database_PDB_obs_spr.pdb_id 8I29 _pdbx_database_PDB_obs_spr.replace_pdb_id 7YIP _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code OBS _pdbx_database_status.status_code_sf OBS _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 7YIP _pdbx_database_status.recvd_initial_deposition_date 2022-07-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Bai, X.' 1 0000-0003-2168-3093 'Lan, J.' 2 ? 'Bu, T.T.' 3 ? 'Wang, L.L.' 4 ? 'He, S.R.' 5 ? 'Zhang, J.' 6 ? 'Xu, Y.B.' 7 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of butanol dehydrogenase A (YqdH) in complex with NADH from Fusobacterium nucleatum' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bai, X.' 1 0000-0003-2168-3093 primary 'Lan, J.' 2 ? primary 'Bu, T.T.' 3 ? primary 'He, S.R.' 4 ? primary 'Zhang, J.' 5 ? primary 'Wang, L.L.' 6 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 7YIP _cell.details ? _cell.formula_units_Z ? _cell.length_a 64.426 _cell.length_a_esd ? _cell.length_b 79.351 _cell.length_b_esd ? _cell.length_c 212.932 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 7YIP _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'NADH-dependent butanol dehydrogenase A' 43336.102 1 1.1.1.- ? ? ? 2 non-polymer syn 'COBALT (II) ION' 58.933 1 ? ? ? ? 3 non-polymer syn NICOTINAMIDE-ADENINE-DINUCLEOTIDE 663.425 1 ? ? ? ? 4 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 5 non-polymer syn 'PHOSPHATE ION' 94.971 1 ? ? ? ? 6 water nat water 18.015 66 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDNFNYKNDTKIIFGKDNYSEIGKNIKIFSKKTPKILLHYEADGELIKKLGIYEKVISSLKEFDIEFIELGGVVPNPRLS LVYEGIKICKEENITFILAVGGASVIDSAKAISLGAVDNGDVWDFFTAKRIPQDTLGIGVVLTIPGAGSEMSESSIITDE NKKQKAVCDTEVNFPKFAILNPEVCYTIPDRLMAAGIVDILSHLMERYFTKSIDTALSDSLIEATMKIVIKYGPLLMKDR KNYNYCSQIMWAATMAHNGMIACGRVADWASHRIEHEISGIYDLTHGIGMAIIFPAWMKYTKNIRPQIFEKFFKEVFNTV NIDEGINKLEEFFKSLGINLKLSDYGITEEYFSLMAEKALGNSETLGRFMQLNKQDIINILNLAK ; _entity_poly.pdbx_seq_one_letter_code_can ;MDNFNYKNDTKIIFGKDNYSEIGKNIKIFSKKTPKILLHYEADGELIKKLGIYEKVISSLKEFDIEFIELGGVVPNPRLS LVYEGIKICKEENITFILAVGGASVIDSAKAISLGAVDNGDVWDFFTAKRIPQDTLGIGVVLTIPGAGSEMSESSIITDE NKKQKAVCDTEVNFPKFAILNPEVCYTIPDRLMAAGIVDILSHLMERYFTKSIDTALSDSLIEATMKIVIKYGPLLMKDR KNYNYCSQIMWAATMAHNGMIACGRVADWASHRIEHEISGIYDLTHGIGMAIIFPAWMKYTKNIRPQIFEKFFKEVFNTV NIDEGINKLEEFFKSLGINLKLSDYGITEEYFSLMAEKALGNSETLGRFMQLNKQDIINILNLAK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 ASN n 1 4 PHE n 1 5 ASN n 1 6 TYR n 1 7 LYS n 1 8 ASN n 1 9 ASP n 1 10 THR n 1 11 LYS n 1 12 ILE n 1 13 ILE n 1 14 PHE n 1 15 GLY n 1 16 LYS n 1 17 ASP n 1 18 ASN n 1 19 TYR n 1 20 SER n 1 21 GLU n 1 22 ILE n 1 23 GLY n 1 24 LYS n 1 25 ASN n 1 26 ILE n 1 27 LYS n 1 28 ILE n 1 29 PHE n 1 30 SER n 1 31 LYS n 1 32 LYS n 1 33 THR n 1 34 PRO n 1 35 LYS n 1 36 ILE n 1 37 LEU n 1 38 LEU n 1 39 HIS n 1 40 TYR n 1 41 GLU n 1 42 ALA n 1 43 ASP n 1 44 GLY n 1 45 GLU n 1 46 LEU n 1 47 ILE n 1 48 LYS n 1 49 LYS n 1 50 LEU n 1 51 GLY n 1 52 ILE n 1 53 TYR n 1 54 GLU n 1 55 LYS n 1 56 VAL n 1 57 ILE n 1 58 SER n 1 59 SER n 1 60 LEU n 1 61 LYS n 1 62 GLU n 1 63 PHE n 1 64 ASP n 1 65 ILE n 1 66 GLU n 1 67 PHE n 1 68 ILE n 1 69 GLU n 1 70 LEU n 1 71 GLY n 1 72 GLY n 1 73 VAL n 1 74 VAL n 1 75 PRO n 1 76 ASN n 1 77 PRO n 1 78 ARG n 1 79 LEU n 1 80 SER n 1 81 LEU n 1 82 VAL n 1 83 TYR n 1 84 GLU n 1 85 GLY n 1 86 ILE n 1 87 LYS n 1 88 ILE n 1 89 CYS n 1 90 LYS n 1 91 GLU n 1 92 GLU n 1 93 ASN n 1 94 ILE n 1 95 THR n 1 96 PHE n 1 97 ILE n 1 98 LEU n 1 99 ALA n 1 100 VAL n 1 101 GLY n 1 102 GLY n 1 103 ALA n 1 104 SER n 1 105 VAL n 1 106 ILE n 1 107 ASP n 1 108 SER n 1 109 ALA n 1 110 LYS n 1 111 ALA n 1 112 ILE n 1 113 SER n 1 114 LEU n 1 115 GLY n 1 116 ALA n 1 117 VAL n 1 118 ASP n 1 119 ASN n 1 120 GLY n 1 121 ASP n 1 122 VAL n 1 123 TRP n 1 124 ASP n 1 125 PHE n 1 126 PHE n 1 127 THR n 1 128 ALA n 1 129 LYS n 1 130 ARG n 1 131 ILE n 1 132 PRO n 1 133 GLN n 1 134 ASP n 1 135 THR n 1 136 LEU n 1 137 GLY n 1 138 ILE n 1 139 GLY n 1 140 VAL n 1 141 VAL n 1 142 LEU n 1 143 THR n 1 144 ILE n 1 145 PRO n 1 146 GLY n 1 147 ALA n 1 148 GLY n 1 149 SER n 1 150 GLU n 1 151 MET n 1 152 SER n 1 153 GLU n 1 154 SER n 1 155 SER n 1 156 ILE n 1 157 ILE n 1 158 THR n 1 159 ASP n 1 160 GLU n 1 161 ASN n 1 162 LYS n 1 163 LYS n 1 164 GLN n 1 165 LYS n 1 166 ALA n 1 167 VAL n 1 168 CYS n 1 169 ASP n 1 170 THR n 1 171 GLU n 1 172 VAL n 1 173 ASN n 1 174 PHE n 1 175 PRO n 1 176 LYS n 1 177 PHE n 1 178 ALA n 1 179 ILE n 1 180 LEU n 1 181 ASN n 1 182 PRO n 1 183 GLU n 1 184 VAL n 1 185 CYS n 1 186 TYR n 1 187 THR n 1 188 ILE n 1 189 PRO n 1 190 ASP n 1 191 ARG n 1 192 LEU n 1 193 MET n 1 194 ALA n 1 195 ALA n 1 196 GLY n 1 197 ILE n 1 198 VAL n 1 199 ASP n 1 200 ILE n 1 201 LEU n 1 202 SER n 1 203 HIS n 1 204 LEU n 1 205 MET n 1 206 GLU n 1 207 ARG n 1 208 TYR n 1 209 PHE n 1 210 THR n 1 211 LYS n 1 212 SER n 1 213 ILE n 1 214 ASP n 1 215 THR n 1 216 ALA n 1 217 LEU n 1 218 SER n 1 219 ASP n 1 220 SER n 1 221 LEU n 1 222 ILE n 1 223 GLU n 1 224 ALA n 1 225 THR n 1 226 MET n 1 227 LYS n 1 228 ILE n 1 229 VAL n 1 230 ILE n 1 231 LYS n 1 232 TYR n 1 233 GLY n 1 234 PRO n 1 235 LEU n 1 236 LEU n 1 237 MET n 1 238 LYS n 1 239 ASP n 1 240 ARG n 1 241 LYS n 1 242 ASN n 1 243 TYR n 1 244 ASN n 1 245 TYR n 1 246 CYS n 1 247 SER n 1 248 GLN n 1 249 ILE n 1 250 MET n 1 251 TRP n 1 252 ALA n 1 253 ALA n 1 254 THR n 1 255 MET n 1 256 ALA n 1 257 HIS n 1 258 ASN n 1 259 GLY n 1 260 MET n 1 261 ILE n 1 262 ALA n 1 263 CYS n 1 264 GLY n 1 265 ARG n 1 266 VAL n 1 267 ALA n 1 268 ASP n 1 269 TRP n 1 270 ALA n 1 271 SER n 1 272 HIS n 1 273 ARG n 1 274 ILE n 1 275 GLU n 1 276 HIS n 1 277 GLU n 1 278 ILE n 1 279 SER n 1 280 GLY n 1 281 ILE n 1 282 TYR n 1 283 ASP n 1 284 LEU n 1 285 THR n 1 286 HIS n 1 287 GLY n 1 288 ILE n 1 289 GLY n 1 290 MET n 1 291 ALA n 1 292 ILE n 1 293 ILE n 1 294 PHE n 1 295 PRO n 1 296 ALA n 1 297 TRP n 1 298 MET n 1 299 LYS n 1 300 TYR n 1 301 THR n 1 302 LYS n 1 303 ASN n 1 304 ILE n 1 305 ARG n 1 306 PRO n 1 307 GLN n 1 308 ILE n 1 309 PHE n 1 310 GLU n 1 311 LYS n 1 312 PHE n 1 313 PHE n 1 314 LYS n 1 315 GLU n 1 316 VAL n 1 317 PHE n 1 318 ASN n 1 319 THR n 1 320 VAL n 1 321 ASN n 1 322 ILE n 1 323 ASP n 1 324 GLU n 1 325 GLY n 1 326 ILE n 1 327 ASN n 1 328 LYS n 1 329 LEU n 1 330 GLU n 1 331 GLU n 1 332 PHE n 1 333 PHE n 1 334 LYS n 1 335 SER n 1 336 LEU n 1 337 GLY n 1 338 ILE n 1 339 ASN n 1 340 LEU n 1 341 LYS n 1 342 LEU n 1 343 SER n 1 344 ASP n 1 345 TYR n 1 346 GLY n 1 347 ILE n 1 348 THR n 1 349 GLU n 1 350 GLU n 1 351 TYR n 1 352 PHE n 1 353 SER n 1 354 LEU n 1 355 MET n 1 356 ALA n 1 357 GLU n 1 358 LYS n 1 359 ALA n 1 360 LEU n 1 361 GLY n 1 362 ASN n 1 363 SER n 1 364 GLU n 1 365 THR n 1 366 LEU n 1 367 GLY n 1 368 ARG n 1 369 PHE n 1 370 MET n 1 371 GLN n 1 372 LEU n 1 373 ASN n 1 374 LYS n 1 375 GLN n 1 376 ASP n 1 377 ILE n 1 378 ILE n 1 379 ASN n 1 380 ILE n 1 381 LEU n 1 382 ASN n 1 383 LEU n 1 384 ALA n 1 385 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 385 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene FN1415 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Fusobacterium nucleatum subsp. nucleatum ATCC 25586' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 190304 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli K-12' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 83333 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8R612_FUSNN _struct_ref.pdbx_db_accession Q8R612 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDNFNYKNDTKIIFGKDNYSEIGKNIKIFSKKTPKILLHYEADGELIKKLGIYEKVISSLKEFDIEFIELGGVVPNPRLS LVYEGIKICKEENITFILAVGGASVIDSAKAISLGAVDNGDVWDFFTAKRIPQDTLGIGVVLTIPGAGSEMSESSIITDE NKKQKAVCDTEVNFPKFAILNPEVCYTIPDRLMAAGIVDILSHLMERYFTKSIDTALSDSLIEATMKIVIKYGPLLMKDR KNYNYCSQIMWAATMAHNGMIACGRVADWASHRIEHEISGIYDLTHGIGMAIIFPAWMKYTKNIRPQIFEKFFKEVFNTV NIDEGINKLEEFFKSLGINLKLSDYGITEEYFSLMAEKALGNSETLGRFMQLNKQDIINILNLAK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7YIP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 385 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8R612 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 385 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 385 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CO non-polymer . 'COBALT (II) ION' ? 'Co 2' 58.933 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAD non-polymer . NICOTINAMIDE-ADENINE-DINUCLEOTIDE ? 'C21 H27 N7 O14 P2' 663.425 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PO4 non-polymer . 'PHOSPHATE ION' ? 'O4 P -3' 94.971 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7YIP _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.14 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 60.83 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 279 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.8M Ammonium phosphate monobasic, 0.1M HEPES pH 7.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS3 X CdTe 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2021-05-26 _diffrn_detector.pdbx_frequency ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9796 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SSRF BEAMLINE BL17B1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9796 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL17B1 _diffrn_source.pdbx_synchrotron_site SSRF # _reflns.B_iso_Wilson_estimate 54.42 _reflns.entry_id 7YIP _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.719 _reflns.d_resolution_low 35.53 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 14920 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.53 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.4 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.233 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 11.875 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? _reflns.pdbx_CC_split_method ? # _reflns_shell.d_res_high 2.719 _reflns_shell.d_res_low 2.817 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 752 _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value 1.157 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 200.820 _refine.B_iso_mean 66.4295 _refine.B_iso_min 24.170 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 7YIP _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.7190 _refine.ls_d_res_low 35.5260 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14920 _refine.ls_number_reflns_R_free 1493 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.6100 _refine.ls_percent_reflns_R_free 10.0100 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2063 _refine.ls_R_factor_R_free 0.2678 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1993 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 6L1K _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 27.7800 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3800 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id final _refine_hist.details ? _refine_hist.d_res_high 2.7190 _refine_hist.d_res_low 35.5260 _refine_hist.number_atoms_solvent 66 _refine_hist.number_atoms_total 3147 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total 384 _refine_hist.pdbx_B_iso_mean_ligand 111.00 _refine_hist.pdbx_B_iso_mean_solvent 51.96 _refine_hist.pdbx_number_atoms_protein 3004 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 77 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 2.7195 2.8072 1068 0.2467 87.00 0.3335 . . 118 . . 'X-RAY DIFFRACTION' . 2.8072 2.9075 1203 0.2325 100.00 0.3298 . . 134 . . 'X-RAY DIFFRACTION' . 2.9075 3.0239 1215 0.2313 100.00 0.3056 . . 135 . . 'X-RAY DIFFRACTION' . 3.0239 3.1614 1214 0.2380 100.00 0.3227 . . 135 . . 'X-RAY DIFFRACTION' . 3.1614 3.3280 1222 0.2148 100.00 0.3291 . . 136 . . 'X-RAY DIFFRACTION' . 3.3280 3.5363 1222 0.2075 100.00 0.2825 . . 136 . . 'X-RAY DIFFRACTION' . 3.5363 3.8090 1242 0.1802 100.00 0.2755 . . 138 . . 'X-RAY DIFFRACTION' . 3.8090 4.1918 1223 0.1572 100.00 0.2632 . . 136 . . 'X-RAY DIFFRACTION' . 4.1918 4.7971 1245 0.1550 100.00 0.1938 . . 138 . . 'X-RAY DIFFRACTION' . 4.7971 6.0390 1260 0.1893 100.00 0.2362 . . 140 . . 'X-RAY DIFFRACTION' . 6.0390 35.5295 1313 0.2373 98.00 0.2777 . . 147 . . # _struct.entry_id 7YIP _struct.title 'Crystal structure of butanol dehydrogenase A (YqdH) in complex with NADH from Fusobacterium nucleatum' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7YIP _struct_keywords.text 'YqdH, NADH, BIOSYNTHETIC PROTEIN' _struct_keywords.pdbx_keywords 'BIOSYNTHETIC PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 TYR A 19 ? ILE A 28 ? TYR A 19 ILE A 28 1 ? 10 HELX_P HELX_P2 AA2 GLY A 44 ? LEU A 50 ? GLY A 44 LEU A 50 1 ? 7 HELX_P HELX_P3 AA3 GLY A 51 ? GLU A 62 ? GLY A 51 GLU A 62 1 ? 12 HELX_P HELX_P4 AA4 ARG A 78 ? GLU A 92 ? ARG A 78 GLU A 92 1 ? 15 HELX_P HELX_P5 AA5 GLY A 102 ? ALA A 116 ? GLY A 102 ALA A 116 1 ? 15 HELX_P HELX_P6 AA6 ASP A 121 ? PHE A 126 ? ASP A 121 PHE A 126 5 ? 6 HELX_P HELX_P7 AA7 GLY A 148 ? SER A 152 ? GLY A 148 SER A 152 5 ? 5 HELX_P HELX_P8 AA8 ASN A 181 ? TYR A 186 ? ASN A 181 TYR A 186 5 ? 6 HELX_P HELX_P9 AA9 PRO A 189 ? PHE A 209 ? PRO A 189 PHE A 209 1 ? 21 HELX_P HELX_P10 AB1 THR A 215 ? ASP A 239 ? THR A 215 ASP A 239 1 ? 25 HELX_P HELX_P11 AB2 ASN A 242 ? HIS A 257 ? ASN A 242 HIS A 257 1 ? 16 HELX_P HELX_P12 AB3 TRP A 269 ? GLY A 280 ? TRP A 269 GLY A 280 1 ? 12 HELX_P HELX_P13 AB4 THR A 285 ? LYS A 302 ? THR A 285 LYS A 302 1 ? 18 HELX_P HELX_P14 AB5 ARG A 305 ? ASN A 318 ? ARG A 305 ASN A 318 1 ? 14 HELX_P HELX_P15 AB6 ASN A 321 ? LEU A 336 ? ASN A 321 LEU A 336 1 ? 16 HELX_P HELX_P16 AB7 LEU A 342 ? GLY A 346 ? LEU A 342 GLY A 346 5 ? 5 HELX_P HELX_P17 AB8 THR A 348 ? GLU A 350 ? THR A 348 GLU A 350 5 ? 3 HELX_P HELX_P18 AB9 TYR A 351 ? GLY A 361 ? TYR A 351 GLY A 361 1 ? 11 HELX_P HELX_P19 AC1 ASN A 373 ? LYS A 385 ? ASN A 373 LYS A 385 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A GLU 206 OE1 ? ? ? 1_555 B CO . CO ? ? A GLU 206 A CO 401 1_555 ? ? ? ? ? ? ? 2.796 ? ? metalc2 metalc ? ? B CO . CO ? ? ? 1_555 F HOH . O ? ? A CO 401 A HOH 554 1_555 ? ? ? ? ? ? ? 2.739 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 11 ? PHE A 14 ? LYS A 11 PHE A 14 AA1 2 PHE A 177 ? LEU A 180 ? PHE A 177 LEU A 180 AA1 3 ILE A 138 ? LEU A 142 ? ILE A 138 LEU A 142 AA1 4 PHE A 96 ? GLY A 101 ? PHE A 96 GLY A 101 AA1 5 LYS A 35 ? HIS A 39 ? LYS A 35 HIS A 39 AA1 6 GLU A 66 ? LEU A 70 ? GLU A 66 LEU A 70 AA2 1 SER A 154 ? ASP A 159 ? SER A 154 ASP A 159 AA2 2 GLN A 164 ? ASP A 169 ? GLN A 164 ASP A 169 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 13 ? N ILE A 13 O LEU A 180 ? O LEU A 180 AA1 2 3 O ILE A 179 ? O ILE A 179 N VAL A 140 ? N VAL A 140 AA1 3 4 O GLY A 139 ? O GLY A 139 N ALA A 99 ? N ALA A 99 AA1 4 5 O LEU A 98 ? O LEU A 98 N LEU A 37 ? N LEU A 37 AA1 5 6 N LEU A 38 ? N LEU A 38 O ILE A 68 ? O ILE A 68 AA2 1 2 N ILE A 157 ? N ILE A 157 O ALA A 166 ? O ALA A 166 # _atom_sites.entry_id 7YIP _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 0.015522 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012602 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004696 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CL CO H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 ASN 3 3 3 ASN ASN A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 ASN 5 5 5 ASN ASN A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 PHE 14 14 14 PHE PHE A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 ILE 28 28 28 ILE ILE A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 PRO 34 34 34 PRO PRO A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 LEU 70 70 70 LEU LEU A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 GLY 72 72 72 GLY GLY A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 PRO 75 75 75 PRO PRO A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 ILE 88 88 88 ILE ILE A . n A 1 89 CYS 89 89 89 CYS CYS A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 PHE 96 96 96 PHE PHE A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 ALA 99 99 99 ALA ALA A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 LYS 110 110 110 LYS LYS A . n A 1 111 ALA 111 111 111 ALA ALA A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 SER 113 113 113 SER SER A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 ASP 118 118 118 ASP ASP A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 TRP 123 123 123 TRP TRP A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 PHE 126 126 126 PHE PHE A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 ARG 130 130 130 ARG ARG A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 PRO 132 132 132 PRO PRO A . n A 1 133 GLN 133 133 133 GLN GLN A . n A 1 134 ASP 134 134 134 ASP ASP A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 ILE 138 138 138 ILE ILE A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 VAL 140 140 140 VAL VAL A . n A 1 141 VAL 141 141 141 VAL VAL A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 THR 143 143 143 THR THR A . n A 1 144 ILE 144 144 144 ILE ILE A . n A 1 145 PRO 145 145 145 PRO PRO A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 GLY 148 148 148 GLY GLY A . n A 1 149 SER 149 149 149 SER SER A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 MET 151 151 151 MET MET A . n A 1 152 SER 152 152 152 SER SER A . n A 1 153 GLU 153 153 153 GLU GLU A . n A 1 154 SER 154 154 154 SER SER A . n A 1 155 SER 155 155 155 SER SER A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 ILE 157 157 157 ILE ILE A . n A 1 158 THR 158 158 158 THR THR A . n A 1 159 ASP 159 159 159 ASP ASP A . n A 1 160 GLU 160 160 160 GLU GLU A . n A 1 161 ASN 161 161 161 ASN ASN A . n A 1 162 LYS 162 162 162 LYS LYS A . n A 1 163 LYS 163 163 163 LYS LYS A . n A 1 164 GLN 164 164 164 GLN GLN A . n A 1 165 LYS 165 165 165 LYS LYS A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 VAL 167 167 167 VAL VAL A . n A 1 168 CYS 168 168 168 CYS CYS A . n A 1 169 ASP 169 169 169 ASP ASP A . n A 1 170 THR 170 170 170 THR THR A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 VAL 172 172 172 VAL VAL A . n A 1 173 ASN 173 173 173 ASN ASN A . n A 1 174 PHE 174 174 174 PHE PHE A . n A 1 175 PRO 175 175 175 PRO PRO A . n A 1 176 LYS 176 176 176 LYS LYS A . n A 1 177 PHE 177 177 177 PHE PHE A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 ILE 179 179 179 ILE ILE A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 ASN 181 181 181 ASN ASN A . n A 1 182 PRO 182 182 182 PRO PRO A . n A 1 183 GLU 183 183 183 GLU GLU A . n A 1 184 VAL 184 184 184 VAL VAL A . n A 1 185 CYS 185 185 185 CYS CYS A . n A 1 186 TYR 186 186 186 TYR TYR A . n A 1 187 THR 187 187 187 THR THR A . n A 1 188 ILE 188 188 188 ILE ILE A . n A 1 189 PRO 189 189 189 PRO PRO A . n A 1 190 ASP 190 190 190 ASP ASP A . n A 1 191 ARG 191 191 191 ARG ARG A . n A 1 192 LEU 192 192 192 LEU LEU A . n A 1 193 MET 193 193 193 MET MET A . n A 1 194 ALA 194 194 194 ALA ALA A . n A 1 195 ALA 195 195 195 ALA ALA A . n A 1 196 GLY 196 196 196 GLY GLY A . n A 1 197 ILE 197 197 197 ILE ILE A . n A 1 198 VAL 198 198 198 VAL VAL A . n A 1 199 ASP 199 199 199 ASP ASP A . n A 1 200 ILE 200 200 200 ILE ILE A . n A 1 201 LEU 201 201 201 LEU LEU A . n A 1 202 SER 202 202 202 SER SER A . n A 1 203 HIS 203 203 203 HIS HIS A . n A 1 204 LEU 204 204 204 LEU LEU A . n A 1 205 MET 205 205 205 MET MET A . n A 1 206 GLU 206 206 206 GLU GLU A . n A 1 207 ARG 207 207 207 ARG ARG A . n A 1 208 TYR 208 208 208 TYR TYR A . n A 1 209 PHE 209 209 209 PHE PHE A . n A 1 210 THR 210 210 210 THR THR A . n A 1 211 LYS 211 211 211 LYS LYS A . n A 1 212 SER 212 212 212 SER SER A . n A 1 213 ILE 213 213 213 ILE ILE A . n A 1 214 ASP 214 214 214 ASP ASP A . n A 1 215 THR 215 215 215 THR THR A . n A 1 216 ALA 216 216 216 ALA ALA A . n A 1 217 LEU 217 217 217 LEU LEU A . n A 1 218 SER 218 218 218 SER SER A . n A 1 219 ASP 219 219 219 ASP ASP A . n A 1 220 SER 220 220 220 SER SER A . n A 1 221 LEU 221 221 221 LEU LEU A . n A 1 222 ILE 222 222 222 ILE ILE A . n A 1 223 GLU 223 223 223 GLU GLU A . n A 1 224 ALA 224 224 224 ALA ALA A . n A 1 225 THR 225 225 225 THR THR A . n A 1 226 MET 226 226 226 MET MET A . n A 1 227 LYS 227 227 227 LYS LYS A . n A 1 228 ILE 228 228 228 ILE ILE A . n A 1 229 VAL 229 229 229 VAL VAL A . n A 1 230 ILE 230 230 230 ILE ILE A . n A 1 231 LYS 231 231 231 LYS LYS A . n A 1 232 TYR 232 232 232 TYR TYR A . n A 1 233 GLY 233 233 233 GLY GLY A . n A 1 234 PRO 234 234 234 PRO PRO A . n A 1 235 LEU 235 235 235 LEU LEU A . n A 1 236 LEU 236 236 236 LEU LEU A . n A 1 237 MET 237 237 237 MET MET A . n A 1 238 LYS 238 238 238 LYS LYS A . n A 1 239 ASP 239 239 239 ASP ASP A . n A 1 240 ARG 240 240 240 ARG ARG A . n A 1 241 LYS 241 241 241 LYS LYS A . n A 1 242 ASN 242 242 242 ASN ASN A . n A 1 243 TYR 243 243 243 TYR TYR A . n A 1 244 ASN 244 244 244 ASN ASN A . n A 1 245 TYR 245 245 245 TYR TYR A . n A 1 246 CYS 246 246 246 CYS CYS A . n A 1 247 SER 247 247 247 SER SER A . n A 1 248 GLN 248 248 248 GLN GLN A . n A 1 249 ILE 249 249 249 ILE ILE A . n A 1 250 MET 250 250 250 MET MET A . n A 1 251 TRP 251 251 251 TRP TRP A . n A 1 252 ALA 252 252 252 ALA ALA A . n A 1 253 ALA 253 253 253 ALA ALA A . n A 1 254 THR 254 254 254 THR THR A . n A 1 255 MET 255 255 255 MET MET A . n A 1 256 ALA 256 256 256 ALA ALA A . n A 1 257 HIS 257 257 257 HIS HIS A . n A 1 258 ASN 258 258 258 ASN ASN A . n A 1 259 GLY 259 259 259 GLY GLY A . n A 1 260 MET 260 260 260 MET MET A . n A 1 261 ILE 261 261 261 ILE ILE A . n A 1 262 ALA 262 262 262 ALA ALA A . n A 1 263 CYS 263 263 263 CYS CYS A . n A 1 264 GLY 264 264 264 GLY GLY A . n A 1 265 ARG 265 265 265 ARG ARG A . n A 1 266 VAL 266 266 266 VAL VAL A . n A 1 267 ALA 267 267 267 ALA ALA A . n A 1 268 ASP 268 268 268 ASP ASP A . n A 1 269 TRP 269 269 269 TRP TRP A . n A 1 270 ALA 270 270 270 ALA ALA A . n A 1 271 SER 271 271 271 SER SER A . n A 1 272 HIS 272 272 272 HIS HIS A . n A 1 273 ARG 273 273 273 ARG ARG A . n A 1 274 ILE 274 274 274 ILE ILE A . n A 1 275 GLU 275 275 275 GLU GLU A . n A 1 276 HIS 276 276 276 HIS HIS A . n A 1 277 GLU 277 277 277 GLU GLU A . n A 1 278 ILE 278 278 278 ILE ILE A . n A 1 279 SER 279 279 279 SER SER A . n A 1 280 GLY 280 280 280 GLY GLY A . n A 1 281 ILE 281 281 281 ILE ILE A . n A 1 282 TYR 282 282 282 TYR TYR A . n A 1 283 ASP 283 283 283 ASP ASP A . n A 1 284 LEU 284 284 284 LEU LEU A . n A 1 285 THR 285 285 285 THR THR A . n A 1 286 HIS 286 286 286 HIS HIS A . n A 1 287 GLY 287 287 287 GLY GLY A . n A 1 288 ILE 288 288 288 ILE ILE A . n A 1 289 GLY 289 289 289 GLY GLY A . n A 1 290 MET 290 290 290 MET MET A . n A 1 291 ALA 291 291 291 ALA ALA A . n A 1 292 ILE 292 292 292 ILE ILE A . n A 1 293 ILE 293 293 293 ILE ILE A . n A 1 294 PHE 294 294 294 PHE PHE A . n A 1 295 PRO 295 295 295 PRO PRO A . n A 1 296 ALA 296 296 296 ALA ALA A . n A 1 297 TRP 297 297 297 TRP TRP A . n A 1 298 MET 298 298 298 MET MET A . n A 1 299 LYS 299 299 299 LYS LYS A . n A 1 300 TYR 300 300 300 TYR TYR A . n A 1 301 THR 301 301 301 THR THR A . n A 1 302 LYS 302 302 302 LYS LYS A . n A 1 303 ASN 303 303 303 ASN ASN A . n A 1 304 ILE 304 304 304 ILE ILE A . n A 1 305 ARG 305 305 305 ARG ARG A . n A 1 306 PRO 306 306 306 PRO PRO A . n A 1 307 GLN 307 307 307 GLN GLN A . n A 1 308 ILE 308 308 308 ILE ILE A . n A 1 309 PHE 309 309 309 PHE PHE A . n A 1 310 GLU 310 310 310 GLU GLU A . n A 1 311 LYS 311 311 311 LYS LYS A . n A 1 312 PHE 312 312 312 PHE PHE A . n A 1 313 PHE 313 313 313 PHE PHE A . n A 1 314 LYS 314 314 314 LYS LYS A . n A 1 315 GLU 315 315 315 GLU GLU A . n A 1 316 VAL 316 316 316 VAL VAL A . n A 1 317 PHE 317 317 317 PHE PHE A . n A 1 318 ASN 318 318 318 ASN ASN A . n A 1 319 THR 319 319 319 THR THR A . n A 1 320 VAL 320 320 320 VAL VAL A . n A 1 321 ASN 321 321 321 ASN ASN A . n A 1 322 ILE 322 322 322 ILE ILE A . n A 1 323 ASP 323 323 323 ASP ASP A . n A 1 324 GLU 324 324 324 GLU GLU A . n A 1 325 GLY 325 325 325 GLY GLY A . n A 1 326 ILE 326 326 326 ILE ILE A . n A 1 327 ASN 327 327 327 ASN ASN A . n A 1 328 LYS 328 328 328 LYS LYS A . n A 1 329 LEU 329 329 329 LEU LEU A . n A 1 330 GLU 330 330 330 GLU GLU A . n A 1 331 GLU 331 331 331 GLU GLU A . n A 1 332 PHE 332 332 332 PHE PHE A . n A 1 333 PHE 333 333 333 PHE PHE A . n A 1 334 LYS 334 334 334 LYS LYS A . n A 1 335 SER 335 335 335 SER SER A . n A 1 336 LEU 336 336 336 LEU LEU A . n A 1 337 GLY 337 337 337 GLY GLY A . n A 1 338 ILE 338 338 338 ILE ILE A . n A 1 339 ASN 339 339 339 ASN ASN A . n A 1 340 LEU 340 340 340 LEU LEU A . n A 1 341 LYS 341 341 341 LYS LYS A . n A 1 342 LEU 342 342 342 LEU LEU A . n A 1 343 SER 343 343 343 SER SER A . n A 1 344 ASP 344 344 344 ASP ASP A . n A 1 345 TYR 345 345 345 TYR TYR A . n A 1 346 GLY 346 346 346 GLY GLY A . n A 1 347 ILE 347 347 347 ILE ILE A . n A 1 348 THR 348 348 348 THR THR A . n A 1 349 GLU 349 349 349 GLU GLU A . n A 1 350 GLU 350 350 350 GLU GLU A . n A 1 351 TYR 351 351 351 TYR TYR A . n A 1 352 PHE 352 352 352 PHE PHE A . n A 1 353 SER 353 353 353 SER SER A . n A 1 354 LEU 354 354 354 LEU LEU A . n A 1 355 MET 355 355 355 MET MET A . n A 1 356 ALA 356 356 356 ALA ALA A . n A 1 357 GLU 357 357 357 GLU GLU A . n A 1 358 LYS 358 358 358 LYS LYS A . n A 1 359 ALA 359 359 359 ALA ALA A . n A 1 360 LEU 360 360 360 LEU LEU A . n A 1 361 GLY 361 361 361 GLY GLY A . n A 1 362 ASN 362 362 362 ASN ASN A . n A 1 363 SER 363 363 363 SER SER A . n A 1 364 GLU 364 364 364 GLU GLU A . n A 1 365 THR 365 365 365 THR THR A . n A 1 366 LEU 366 366 366 LEU LEU A . n A 1 367 GLY 367 367 367 GLY GLY A . n A 1 368 ARG 368 368 368 ARG ARG A . n A 1 369 PHE 369 369 369 PHE PHE A . n A 1 370 MET 370 370 370 MET MET A . n A 1 371 GLN 371 371 371 GLN GLN A . n A 1 372 LEU 372 372 372 LEU LEU A . n A 1 373 ASN 373 373 373 ASN ASN A . n A 1 374 LYS 374 374 374 LYS LYS A . n A 1 375 GLN 375 375 375 GLN GLN A . n A 1 376 ASP 376 376 376 ASP ASP A . n A 1 377 ILE 377 377 377 ILE ILE A . n A 1 378 ILE 378 378 378 ILE ILE A . n A 1 379 ASN 379 379 379 ASN ASN A . n A 1 380 ILE 380 380 380 ILE ILE A . n A 1 381 LEU 381 381 381 LEU LEU A . n A 1 382 ASN 382 382 382 ASN ASN A . n A 1 383 LEU 383 383 383 LEU LEU A . n A 1 384 ALA 384 384 384 ALA ALA A . n A 1 385 LYS 385 385 385 LYS LYS A . n # _pdbx_contact_author.id 2 _pdbx_contact_author.email 2908629686@qq.com _pdbx_contact_author.name_first Yongbin _pdbx_contact_author.name_last Xu _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-0859-8719 # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CO 1 401 1 CO CO A . C 3 NAD 1 402 104 NAD NAD A . D 4 CL 1 403 1 CL CL A . E 5 PO4 1 404 1 PO4 PO4 A . F 6 HOH 1 501 2 HOH HOH A . F 6 HOH 2 502 7 HOH HOH A . F 6 HOH 3 503 49 HOH HOH A . F 6 HOH 4 504 65 HOH HOH A . F 6 HOH 5 505 20 HOH HOH A . F 6 HOH 6 506 63 HOH HOH A . F 6 HOH 7 507 53 HOH HOH A . F 6 HOH 8 508 31 HOH HOH A . F 6 HOH 9 509 11 HOH HOH A . F 6 HOH 10 510 14 HOH HOH A . F 6 HOH 11 511 69 HOH HOH A . F 6 HOH 12 512 52 HOH HOH A . F 6 HOH 13 513 37 HOH HOH A . F 6 HOH 14 514 12 HOH HOH A . F 6 HOH 15 515 3 HOH HOH A . F 6 HOH 16 516 26 HOH HOH A . F 6 HOH 17 517 30 HOH HOH A . F 6 HOH 18 518 4 HOH HOH A . F 6 HOH 19 519 6 HOH HOH A . F 6 HOH 20 520 15 HOH HOH A . F 6 HOH 21 521 61 HOH HOH A . F 6 HOH 22 522 36 HOH HOH A . F 6 HOH 23 523 34 HOH HOH A . F 6 HOH 24 524 19 HOH HOH A . F 6 HOH 25 525 44 HOH HOH A . F 6 HOH 26 526 29 HOH HOH A . F 6 HOH 27 527 33 HOH HOH A . F 6 HOH 28 528 8 HOH HOH A . F 6 HOH 29 529 17 HOH HOH A . F 6 HOH 30 530 18 HOH HOH A . F 6 HOH 31 531 28 HOH HOH A . F 6 HOH 32 532 48 HOH HOH A . F 6 HOH 33 533 35 HOH HOH A . F 6 HOH 34 534 13 HOH HOH A . F 6 HOH 35 535 9 HOH HOH A . F 6 HOH 36 536 66 HOH HOH A . F 6 HOH 37 537 16 HOH HOH A . F 6 HOH 38 538 59 HOH HOH A . F 6 HOH 39 539 45 HOH HOH A . F 6 HOH 40 540 47 HOH HOH A . F 6 HOH 41 541 68 HOH HOH A . F 6 HOH 42 542 10 HOH HOH A . F 6 HOH 43 543 51 HOH HOH A . F 6 HOH 44 544 60 HOH HOH A . F 6 HOH 45 545 32 HOH HOH A . F 6 HOH 46 546 56 HOH HOH A . F 6 HOH 47 547 40 HOH HOH A . F 6 HOH 48 548 43 HOH HOH A . F 6 HOH 49 549 27 HOH HOH A . F 6 HOH 50 550 62 HOH HOH A . F 6 HOH 51 551 21 HOH HOH A . F 6 HOH 52 552 70 HOH HOH A . F 6 HOH 53 553 58 HOH HOH A . F 6 HOH 54 554 22 HOH HOH A . F 6 HOH 55 555 39 HOH HOH A . F 6 HOH 56 556 50 HOH HOH A . F 6 HOH 57 557 25 HOH HOH A . F 6 HOH 58 558 23 HOH HOH A . F 6 HOH 59 559 57 HOH HOH A . F 6 HOH 60 560 42 HOH HOH A . F 6 HOH 61 561 64 HOH HOH A . F 6 HOH 62 562 67 HOH HOH A . F 6 HOH 63 563 24 HOH HOH A . F 6 HOH 64 564 54 HOH HOH A . F 6 HOH 65 565 55 HOH HOH A . F 6 HOH 66 566 41 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1280 ? 1 MORE -20 ? 1 'SSA (A^2)' 16920 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id OE1 _pdbx_struct_conn_angle.ptnr1_label_alt_id ? _pdbx_struct_conn_angle.ptnr1_label_asym_id A _pdbx_struct_conn_angle.ptnr1_label_comp_id GLU _pdbx_struct_conn_angle.ptnr1_label_seq_id 206 _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id A _pdbx_struct_conn_angle.ptnr1_auth_comp_id GLU _pdbx_struct_conn_angle.ptnr1_auth_seq_id 206 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id CO _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id B _pdbx_struct_conn_angle.ptnr2_label_comp_id CO _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id A _pdbx_struct_conn_angle.ptnr2_auth_comp_id CO _pdbx_struct_conn_angle.ptnr2_auth_seq_id 401 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 1_555 _pdbx_struct_conn_angle.ptnr3_label_atom_id O _pdbx_struct_conn_angle.ptnr3_label_alt_id ? _pdbx_struct_conn_angle.ptnr3_label_asym_id F _pdbx_struct_conn_angle.ptnr3_label_comp_id HOH _pdbx_struct_conn_angle.ptnr3_label_seq_id . _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id A _pdbx_struct_conn_angle.ptnr3_auth_comp_id HOH _pdbx_struct_conn_angle.ptnr3_auth_seq_id 554 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 1_555 _pdbx_struct_conn_angle.value 119.4 _pdbx_struct_conn_angle.value_esd ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2022-10-05 2 'Structure model' 1 1 2023-02-01 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'Structure model' repository Obsolete ? ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' pdbx_database_PDB_obs_spr 2 2 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_pdbx_database_status.status_code' 2 2 'Structure model' '_pdbx_database_status.status_code_sf' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.15.2_3472 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 3 # _pdbx_entry_details.entry_id 7YIP _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HH11 A ARG 207 ? ? O A HOH 501 ? ? 1.50 2 1 HH A TYR 300 ? ? OD1 A ASP 376 ? ? 1.57 3 1 NH1 A ARG 207 ? ? O A HOH 501 ? ? 1.97 4 1 ND2 A ASN 119 ? ? O A HOH 502 ? ? 2.04 5 1 OE1 A GLU 91 ? ? O A HOH 503 ? ? 2.10 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A CYS 263 ? ? CB A CYS 263 ? ? SG A CYS 263 ? ? 122.84 114.20 8.64 1.10 N 2 1 CA A MET 298 ? ? CB A MET 298 ? ? CG A MET 298 ? ? 130.63 113.30 17.33 1.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 8 ? ? -162.95 108.42 2 1 ASN A 18 ? ? -161.41 34.43 3 1 LYS A 31 ? ? -50.66 101.19 4 1 LYS A 32 ? ? 41.82 -118.07 5 1 ALA A 42 ? ? 50.95 -150.14 6 1 ASP A 43 ? ? -97.56 48.19 7 1 GLU A 45 ? ? -58.66 -74.94 8 1 SER A 80 ? ? -9.82 -57.08 9 1 PHE A 96 ? ? 174.33 144.30 10 1 ASP A 124 ? ? -59.14 -8.45 11 1 THR A 127 ? ? -49.88 -12.96 12 1 ALA A 128 ? ? 31.04 87.01 13 1 ILE A 144 ? ? -161.90 116.01 14 1 ALA A 147 ? ? 77.66 -60.55 15 1 MET A 151 ? ? -160.99 6.15 16 1 THR A 170 ? ? -174.75 149.91 17 1 PHE A 174 ? ? -46.16 107.22 18 1 PRO A 175 ? ? -31.73 142.80 19 1 ASP A 214 ? ? 73.35 39.69 20 1 ASP A 239 ? ? -150.07 75.20 21 1 CYS A 263 ? ? -110.07 77.17 22 1 GLU A 349 ? ? -68.65 1.35 23 1 ASN A 362 ? ? -88.79 33.08 24 1 ARG A 368 ? ? -123.23 -52.83 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 THR _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 127 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 ALA _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 128 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -149.79 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 32 ? CG ? A LYS 32 CG 2 1 Y 1 A LYS 32 ? CD ? A LYS 32 CD 3 1 Y 1 A LYS 32 ? CE ? A LYS 32 CE 4 1 Y 1 A LYS 32 ? NZ ? A LYS 32 NZ 5 1 Y 1 A LYS 48 ? CG ? A LYS 48 CG 6 1 Y 1 A LYS 48 ? CD ? A LYS 48 CD 7 1 Y 1 A LYS 48 ? CE ? A LYS 48 CE 8 1 Y 1 A LYS 48 ? NZ ? A LYS 48 NZ 9 1 Y 1 A LYS 49 ? CG ? A LYS 49 CG 10 1 Y 1 A LYS 49 ? CD ? A LYS 49 CD 11 1 Y 1 A LYS 49 ? CE ? A LYS 49 CE 12 1 Y 1 A LYS 49 ? NZ ? A LYS 49 NZ 13 1 Y 1 A LYS 55 ? CG ? A LYS 55 CG 14 1 Y 1 A LYS 55 ? CD ? A LYS 55 CD 15 1 Y 1 A LYS 55 ? CE ? A LYS 55 CE 16 1 Y 1 A LYS 55 ? NZ ? A LYS 55 NZ 17 1 Y 1 A LYS 61 ? CG ? A LYS 61 CG 18 1 Y 1 A LYS 61 ? CD ? A LYS 61 CD 19 1 Y 1 A LYS 61 ? CE ? A LYS 61 CE 20 1 Y 1 A LYS 61 ? NZ ? A LYS 61 NZ 21 1 Y 1 A ASN 76 ? CG ? A ASN 76 CG 22 1 Y 1 A ASN 76 ? OD1 ? A ASN 76 OD1 23 1 Y 1 A ASN 76 ? ND2 ? A ASN 76 ND2 24 1 Y 1 A LEU 79 ? CG ? A LEU 79 CG 25 1 Y 1 A LEU 79 ? CD1 ? A LEU 79 CD1 26 1 Y 1 A LEU 79 ? CD2 ? A LEU 79 CD2 27 1 Y 1 A GLU 84 ? CG ? A GLU 84 CG 28 1 Y 1 A GLU 84 ? CD ? A GLU 84 CD 29 1 Y 1 A GLU 84 ? OE1 ? A GLU 84 OE1 30 1 Y 1 A GLU 84 ? OE2 ? A GLU 84 OE2 # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id MET _pdbx_unobs_or_zero_occ_residues.auth_seq_id 1 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id MET _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 # _pdbx_audit_support.funding_organization 'National Research Foundation (NRF, Korea)' _pdbx_audit_support.country 'Korea, Republic Of' _pdbx_audit_support.grant_number NRF-2017M3A9F6029736 _pdbx_audit_support.ordinal 1 # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id NAD _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id NAD _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COBALT (II) ION' CO 3 NICOTINAMIDE-ADENINE-DINUCLEOTIDE NAD 4 'CHLORIDE ION' CL 5 'PHOSPHATE ION' PO4 6 water HOH # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? #