data_7YRW # _entry.id 7YRW # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.395 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 7YRW pdb_00007yrw 10.2210/pdb7yrw/pdb WWPDB D_1300031522 ? ? BMRB 36502 ? 10.13018/BMR36502 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2023-08-16 2 'Structure model' 1 1 2024-09-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 2 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.journal_volume' 7 2 'Structure model' '_citation.page_first' 8 2 'Structure model' '_citation.page_last' 9 2 'Structure model' '_citation.pdbx_database_id_DOI' 10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 11 2 'Structure model' '_citation.title' 12 2 'Structure model' '_citation.year' 13 2 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 7YRW _pdbx_database_status.recvd_initial_deposition_date 2022-08-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details 'Solution structures of a disulfide-directed multicyclic peptide with affinity for HER2' _pdbx_database_related.db_id 36502 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email chlwu@xmu.edu.cn _pdbx_contact_author.name_first Chuanliu _pdbx_contact_author.name_last Wu _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-2946-7299 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Fan, S.H.' 1 ? 'Wu, C.L.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Am.Chem.Soc. _citation.journal_id_ASTM JACSAT _citation.journal_id_CSD ? _citation.journal_id_ISSN 1520-5126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 145 _citation.language ? _citation.page_first 1964 _citation.page_last 1972 _citation.title 'Disulfide-Directed Multicyclic Peptide Libraries for the Discovery of Peptide Ligands and Drugs.' _citation.year 2023 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/jacs.2c12462 _citation.pdbx_database_id_PubMed 36633218 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lu, S.' 1 ? primary 'Fan, S.' 2 ? primary 'Xiao, S.' 3 ? primary 'Li, J.' 4 ? primary 'Zhang, S.' 5 ? primary 'Wu, Y.' 6 ? primary 'Kong, C.' 7 ? primary 'Zhuang, J.' 8 ? primary 'Liu, H.' 9 ? primary 'Zhao, Y.' 10 0000-0001-9349-1213 primary 'Wu, C.' 11 0000-0003-2946-7299 # _entity.id 1 _entity.type polymer _entity.src_method syn _entity.pdbx_description LH2 _entity.formula_weight 3470.052 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GCPWFCIYPCKVEPICGVVYASRCPRACDDD _entity_poly.pdbx_seq_one_letter_code_can GCPWFCIYPCKVEPICGVVYASRCPRACDDD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 CYS n 1 3 PRO n 1 4 TRP n 1 5 PHE n 1 6 CYS n 1 7 ILE n 1 8 TYR n 1 9 PRO n 1 10 CYS n 1 11 LYS n 1 12 VAL n 1 13 GLU n 1 14 PRO n 1 15 ILE n 1 16 CYS n 1 17 GLY n 1 18 VAL n 1 19 VAL n 1 20 TYR n 1 21 ALA n 1 22 SER n 1 23 ARG n 1 24 CYS n 1 25 PRO n 1 26 ARG n 1 27 ALA n 1 28 CYS n 1 29 ASP n 1 30 ASP n 1 31 ASP n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 31 _pdbx_entity_src_syn.organism_scientific 'synthetic construct' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 CYS 2 2 2 CYS CYS A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 TRP 4 4 4 TRP TRP A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 CYS 24 24 24 CYS CYS A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 CYS 28 28 28 CYS CYS A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 ASP 31 31 31 ASP ASP A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 7YRW _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 7YRW _struct.title 'Solution structures of a disulfide-directed multicyclic peptide with affinity for HER2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 7YRW _struct_keywords.text 'disulfide-rich; HER2, PEPTIDE BINDING PROTEIN' _struct_keywords.pdbx_keywords 'PEPTIDE BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 7YRW _struct_ref.pdbx_db_accession 7YRW _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 7YRW _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 31 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 7YRW _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 31 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 31 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 3 ? TYR A 8 ? PRO A 3 TYR A 8 1 ? 6 HELX_P HELX_P2 AA2 PRO A 14 ? ARG A 23 ? PRO A 14 ARG A 23 1 ? 10 HELX_P HELX_P3 AA3 PRO A 25 ? ASP A 29 ? PRO A 25 ASP A 29 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 2 SG ? ? ? 1_555 A CYS 28 SG ? ? A CYS 2 A CYS 28 1_555 ? ? ? ? ? ? ? 2.029 ? ? disulf2 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 24 SG ? ? A CYS 6 A CYS 24 1_555 ? ? ? ? ? ? ? 2.033 ? ? disulf3 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 16 SG ? ? A CYS 10 A CYS 16 1_555 ? ? ? ? ? ? ? 2.023 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLU 13 A . ? GLU 13 A PRO 14 A ? PRO 14 A 1 1.71 2 GLU 13 A . ? GLU 13 A PRO 14 A ? PRO 14 A 2 -3.61 3 GLU 13 A . ? GLU 13 A PRO 14 A ? PRO 14 A 3 5.60 4 GLU 13 A . ? GLU 13 A PRO 14 A ? PRO 14 A 4 0.51 5 GLU 13 A . ? GLU 13 A PRO 14 A ? PRO 14 A 5 -2.78 6 GLU 13 A . ? GLU 13 A PRO 14 A ? PRO 14 A 6 -0.35 7 GLU 13 A . ? GLU 13 A PRO 14 A ? PRO 14 A 7 -2.99 8 GLU 13 A . ? GLU 13 A PRO 14 A ? PRO 14 A 8 -1.37 9 GLU 13 A . ? GLU 13 A PRO 14 A ? PRO 14 A 9 -6.04 10 GLU 13 A . ? GLU 13 A PRO 14 A ? PRO 14 A 10 -3.02 11 GLU 13 A . ? GLU 13 A PRO 14 A ? PRO 14 A 11 -1.92 12 GLU 13 A . ? GLU 13 A PRO 14 A ? PRO 14 A 12 -2.99 13 GLU 13 A . ? GLU 13 A PRO 14 A ? PRO 14 A 13 -3.02 14 GLU 13 A . ? GLU 13 A PRO 14 A ? PRO 14 A 14 2.85 15 GLU 13 A . ? GLU 13 A PRO 14 A ? PRO 14 A 15 -0.92 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 5 ASP A 29 ? ? -93.09 34.22 2 6 ASP A 30 ? ? 57.06 71.11 3 7 TYR A 8 ? ? -113.84 78.75 4 8 CYS A 24 ? ? -119.41 73.82 5 8 ASP A 30 ? ? 58.58 70.39 6 10 ARG A 26 ? ? -59.81 -9.56 7 10 CYS A 28 ? ? -79.12 24.81 8 11 ASP A 30 ? ? 61.42 60.01 # _pdbx_nmr_ensemble.entry_id 7YRW _pdbx_nmr_ensemble.conformers_calculated_total_number 150 _pdbx_nmr_ensemble.conformers_submitted_total_number 15 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 7YRW _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1 mM LH2, 60% perdeuterated acetonitrile and 40% H2O' _pdbx_nmr_sample_details.solvent_system '60% perdeuterated acetonitrile and 40% H2O' _pdbx_nmr_sample_details.label LH2 _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component LH2 _pdbx_nmr_exptl_sample.concentration 1 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units 'Not defined' _pdbx_nmr_exptl_sample_conditions.label condition _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-13C HSQC' 1 anisotropic 2 1 1 '2D 1H-15N HSQC' 1 anisotropic 3 1 1 '2D 1H-1H NOESY' 1 anisotropic 4 1 1 '2D 1H-1H TOCSY' 1 anisotropic # _pdbx_nmr_refine.entry_id 7YRW _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement CNS ? 'Brunger A. T. et.al.' 2 'structure calculation' ARIA ? ;Linge, O'Donoghue and Nilges ; 3 'chemical shift assignment' NMRFAM-SPARKY ? 'Lee W, Tonelli M, Markley JL' 4 collection TopSpin ? 'Bruker Biospin' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLU N N N N 71 GLU CA C N S 72 GLU C C N N 73 GLU O O N N 74 GLU CB C N N 75 GLU CG C N N 76 GLU CD C N N 77 GLU OE1 O N N 78 GLU OE2 O N N 79 GLU OXT O N N 80 GLU H H N N 81 GLU H2 H N N 82 GLU HA H N N 83 GLU HB2 H N N 84 GLU HB3 H N N 85 GLU HG2 H N N 86 GLU HG3 H N N 87 GLU HE2 H N N 88 GLU HXT H N N 89 GLY N N N N 90 GLY CA C N N 91 GLY C C N N 92 GLY O O N N 93 GLY OXT O N N 94 GLY H H N N 95 GLY H2 H N N 96 GLY HA2 H N N 97 GLY HA3 H N N 98 GLY HXT H N N 99 ILE N N N N 100 ILE CA C N S 101 ILE C C N N 102 ILE O O N N 103 ILE CB C N S 104 ILE CG1 C N N 105 ILE CG2 C N N 106 ILE CD1 C N N 107 ILE OXT O N N 108 ILE H H N N 109 ILE H2 H N N 110 ILE HA H N N 111 ILE HB H N N 112 ILE HG12 H N N 113 ILE HG13 H N N 114 ILE HG21 H N N 115 ILE HG22 H N N 116 ILE HG23 H N N 117 ILE HD11 H N N 118 ILE HD12 H N N 119 ILE HD13 H N N 120 ILE HXT H N N 121 LYS N N N N 122 LYS CA C N S 123 LYS C C N N 124 LYS O O N N 125 LYS CB C N N 126 LYS CG C N N 127 LYS CD C N N 128 LYS CE C N N 129 LYS NZ N N N 130 LYS OXT O N N 131 LYS H H N N 132 LYS H2 H N N 133 LYS HA H N N 134 LYS HB2 H N N 135 LYS HB3 H N N 136 LYS HG2 H N N 137 LYS HG3 H N N 138 LYS HD2 H N N 139 LYS HD3 H N N 140 LYS HE2 H N N 141 LYS HE3 H N N 142 LYS HZ1 H N N 143 LYS HZ2 H N N 144 LYS HZ3 H N N 145 LYS HXT H N N 146 PHE N N N N 147 PHE CA C N S 148 PHE C C N N 149 PHE O O N N 150 PHE CB C N N 151 PHE CG C Y N 152 PHE CD1 C Y N 153 PHE CD2 C Y N 154 PHE CE1 C Y N 155 PHE CE2 C Y N 156 PHE CZ C Y N 157 PHE OXT O N N 158 PHE H H N N 159 PHE H2 H N N 160 PHE HA H N N 161 PHE HB2 H N N 162 PHE HB3 H N N 163 PHE HD1 H N N 164 PHE HD2 H N N 165 PHE HE1 H N N 166 PHE HE2 H N N 167 PHE HZ H N N 168 PHE HXT H N N 169 PRO N N N N 170 PRO CA C N S 171 PRO C C N N 172 PRO O O N N 173 PRO CB C N N 174 PRO CG C N N 175 PRO CD C N N 176 PRO OXT O N N 177 PRO H H N N 178 PRO HA H N N 179 PRO HB2 H N N 180 PRO HB3 H N N 181 PRO HG2 H N N 182 PRO HG3 H N N 183 PRO HD2 H N N 184 PRO HD3 H N N 185 PRO HXT H N N 186 SER N N N N 187 SER CA C N S 188 SER C C N N 189 SER O O N N 190 SER CB C N N 191 SER OG O N N 192 SER OXT O N N 193 SER H H N N 194 SER H2 H N N 195 SER HA H N N 196 SER HB2 H N N 197 SER HB3 H N N 198 SER HG H N N 199 SER HXT H N N 200 TRP N N N N 201 TRP CA C N S 202 TRP C C N N 203 TRP O O N N 204 TRP CB C N N 205 TRP CG C Y N 206 TRP CD1 C Y N 207 TRP CD2 C Y N 208 TRP NE1 N Y N 209 TRP CE2 C Y N 210 TRP CE3 C Y N 211 TRP CZ2 C Y N 212 TRP CZ3 C Y N 213 TRP CH2 C Y N 214 TRP OXT O N N 215 TRP H H N N 216 TRP H2 H N N 217 TRP HA H N N 218 TRP HB2 H N N 219 TRP HB3 H N N 220 TRP HD1 H N N 221 TRP HE1 H N N 222 TRP HE3 H N N 223 TRP HZ2 H N N 224 TRP HZ3 H N N 225 TRP HH2 H N N 226 TRP HXT H N N 227 TYR N N N N 228 TYR CA C N S 229 TYR C C N N 230 TYR O O N N 231 TYR CB C N N 232 TYR CG C Y N 233 TYR CD1 C Y N 234 TYR CD2 C Y N 235 TYR CE1 C Y N 236 TYR CE2 C Y N 237 TYR CZ C Y N 238 TYR OH O N N 239 TYR OXT O N N 240 TYR H H N N 241 TYR H2 H N N 242 TYR HA H N N 243 TYR HB2 H N N 244 TYR HB3 H N N 245 TYR HD1 H N N 246 TYR HD2 H N N 247 TYR HE1 H N N 248 TYR HE2 H N N 249 TYR HH H N N 250 TYR HXT H N N 251 VAL N N N N 252 VAL CA C N S 253 VAL C C N N 254 VAL O O N N 255 VAL CB C N N 256 VAL CG1 C N N 257 VAL CG2 C N N 258 VAL OXT O N N 259 VAL H H N N 260 VAL H2 H N N 261 VAL HA H N N 262 VAL HB H N N 263 VAL HG11 H N N 264 VAL HG12 H N N 265 VAL HG13 H N N 266 VAL HG21 H N N 267 VAL HG22 H N N 268 VAL HG23 H N N 269 VAL HXT H N N 270 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLU N CA sing N N 67 GLU N H sing N N 68 GLU N H2 sing N N 69 GLU CA C sing N N 70 GLU CA CB sing N N 71 GLU CA HA sing N N 72 GLU C O doub N N 73 GLU C OXT sing N N 74 GLU CB CG sing N N 75 GLU CB HB2 sing N N 76 GLU CB HB3 sing N N 77 GLU CG CD sing N N 78 GLU CG HG2 sing N N 79 GLU CG HG3 sing N N 80 GLU CD OE1 doub N N 81 GLU CD OE2 sing N N 82 GLU OE2 HE2 sing N N 83 GLU OXT HXT sing N N 84 GLY N CA sing N N 85 GLY N H sing N N 86 GLY N H2 sing N N 87 GLY CA C sing N N 88 GLY CA HA2 sing N N 89 GLY CA HA3 sing N N 90 GLY C O doub N N 91 GLY C OXT sing N N 92 GLY OXT HXT sing N N 93 ILE N CA sing N N 94 ILE N H sing N N 95 ILE N H2 sing N N 96 ILE CA C sing N N 97 ILE CA CB sing N N 98 ILE CA HA sing N N 99 ILE C O doub N N 100 ILE C OXT sing N N 101 ILE CB CG1 sing N N 102 ILE CB CG2 sing N N 103 ILE CB HB sing N N 104 ILE CG1 CD1 sing N N 105 ILE CG1 HG12 sing N N 106 ILE CG1 HG13 sing N N 107 ILE CG2 HG21 sing N N 108 ILE CG2 HG22 sing N N 109 ILE CG2 HG23 sing N N 110 ILE CD1 HD11 sing N N 111 ILE CD1 HD12 sing N N 112 ILE CD1 HD13 sing N N 113 ILE OXT HXT sing N N 114 LYS N CA sing N N 115 LYS N H sing N N 116 LYS N H2 sing N N 117 LYS CA C sing N N 118 LYS CA CB sing N N 119 LYS CA HA sing N N 120 LYS C O doub N N 121 LYS C OXT sing N N 122 LYS CB CG sing N N 123 LYS CB HB2 sing N N 124 LYS CB HB3 sing N N 125 LYS CG CD sing N N 126 LYS CG HG2 sing N N 127 LYS CG HG3 sing N N 128 LYS CD CE sing N N 129 LYS CD HD2 sing N N 130 LYS CD HD3 sing N N 131 LYS CE NZ sing N N 132 LYS CE HE2 sing N N 133 LYS CE HE3 sing N N 134 LYS NZ HZ1 sing N N 135 LYS NZ HZ2 sing N N 136 LYS NZ HZ3 sing N N 137 LYS OXT HXT sing N N 138 PHE N CA sing N N 139 PHE N H sing N N 140 PHE N H2 sing N N 141 PHE CA C sing N N 142 PHE CA CB sing N N 143 PHE CA HA sing N N 144 PHE C O doub N N 145 PHE C OXT sing N N 146 PHE CB CG sing N N 147 PHE CB HB2 sing N N 148 PHE CB HB3 sing N N 149 PHE CG CD1 doub Y N 150 PHE CG CD2 sing Y N 151 PHE CD1 CE1 sing Y N 152 PHE CD1 HD1 sing N N 153 PHE CD2 CE2 doub Y N 154 PHE CD2 HD2 sing N N 155 PHE CE1 CZ doub Y N 156 PHE CE1 HE1 sing N N 157 PHE CE2 CZ sing Y N 158 PHE CE2 HE2 sing N N 159 PHE CZ HZ sing N N 160 PHE OXT HXT sing N N 161 PRO N CA sing N N 162 PRO N CD sing N N 163 PRO N H sing N N 164 PRO CA C sing N N 165 PRO CA CB sing N N 166 PRO CA HA sing N N 167 PRO C O doub N N 168 PRO C OXT sing N N 169 PRO CB CG sing N N 170 PRO CB HB2 sing N N 171 PRO CB HB3 sing N N 172 PRO CG CD sing N N 173 PRO CG HG2 sing N N 174 PRO CG HG3 sing N N 175 PRO CD HD2 sing N N 176 PRO CD HD3 sing N N 177 PRO OXT HXT sing N N 178 SER N CA sing N N 179 SER N H sing N N 180 SER N H2 sing N N 181 SER CA C sing N N 182 SER CA CB sing N N 183 SER CA HA sing N N 184 SER C O doub N N 185 SER C OXT sing N N 186 SER CB OG sing N N 187 SER CB HB2 sing N N 188 SER CB HB3 sing N N 189 SER OG HG sing N N 190 SER OXT HXT sing N N 191 TRP N CA sing N N 192 TRP N H sing N N 193 TRP N H2 sing N N 194 TRP CA C sing N N 195 TRP CA CB sing N N 196 TRP CA HA sing N N 197 TRP C O doub N N 198 TRP C OXT sing N N 199 TRP CB CG sing N N 200 TRP CB HB2 sing N N 201 TRP CB HB3 sing N N 202 TRP CG CD1 doub Y N 203 TRP CG CD2 sing Y N 204 TRP CD1 NE1 sing Y N 205 TRP CD1 HD1 sing N N 206 TRP CD2 CE2 doub Y N 207 TRP CD2 CE3 sing Y N 208 TRP NE1 CE2 sing Y N 209 TRP NE1 HE1 sing N N 210 TRP CE2 CZ2 sing Y N 211 TRP CE3 CZ3 doub Y N 212 TRP CE3 HE3 sing N N 213 TRP CZ2 CH2 doub Y N 214 TRP CZ2 HZ2 sing N N 215 TRP CZ3 CH2 sing Y N 216 TRP CZ3 HZ3 sing N N 217 TRP CH2 HH2 sing N N 218 TRP OXT HXT sing N N 219 TYR N CA sing N N 220 TYR N H sing N N 221 TYR N H2 sing N N 222 TYR CA C sing N N 223 TYR CA CB sing N N 224 TYR CA HA sing N N 225 TYR C O doub N N 226 TYR C OXT sing N N 227 TYR CB CG sing N N 228 TYR CB HB2 sing N N 229 TYR CB HB3 sing N N 230 TYR CG CD1 doub Y N 231 TYR CG CD2 sing Y N 232 TYR CD1 CE1 sing Y N 233 TYR CD1 HD1 sing N N 234 TYR CD2 CE2 doub Y N 235 TYR CD2 HD2 sing N N 236 TYR CE1 CZ doub Y N 237 TYR CE1 HE1 sing N N 238 TYR CE2 CZ sing Y N 239 TYR CE2 HE2 sing N N 240 TYR CZ OH sing N N 241 TYR OH HH sing N N 242 TYR OXT HXT sing N N 243 VAL N CA sing N N 244 VAL N H sing N N 245 VAL N H2 sing N N 246 VAL CA C sing N N 247 VAL CA CB sing N N 248 VAL CA HA sing N N 249 VAL C O doub N N 250 VAL C OXT sing N N 251 VAL CB CG1 sing N N 252 VAL CB CG2 sing N N 253 VAL CB HB sing N N 254 VAL CG1 HG11 sing N N 255 VAL CG1 HG12 sing N N 256 VAL CG1 HG13 sing N N 257 VAL CG2 HG21 sing N N 258 VAL CG2 HG22 sing N N 259 VAL CG2 HG23 sing N N 260 VAL OXT HXT sing N N 261 # _pdbx_audit_support.funding_organization 'Other government' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 850 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 7YRW _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_